Psyllid ID: psy15272


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MQTCWPKRQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVNKGQRSSSLHYAACFGRPSVAKVLLRHGANPDLRDEDGKTPLDKARERVDEGHRE
ccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccccccc
ccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccccccc
mqtcwpkrqliecirskDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCErgadvnkgqrssslhyaacfgRPSVAKVLLRhganpdlrdedgktpldkarervdeghre
mqtcwpkrqliecirskdtDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVNKGQRSSSLHYAACFGRPSVAKVLLRHGanpdlrdedgktpldkarervdeghre
MQTCWPKRQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVNKGQRSSSLHYAACFGRPSVAKVLLRHGANPDLRDEDGKTPLDKARERVDEGHRE
***CWPKRQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVNKG***SSLHYAACFGRPSVAKVLLR*****************************
***CWPKRQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVNKGQRSSSLHYAACFGRPSVAKVLLRHGANPDLRDEDGKTPLDKARERVD*****
MQTCWPKRQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVNKGQRSSSLHYAACFGRPSVAKVLLRHGANPDLRDEDGKTPLDK***********
****WPKRQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVNKGQRSSSLHYAACFGRPSVAKVLLRHGANPDLRDEDGKTPLDKARERV******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTCWPKRQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVNKGQRSSSLHYAACFGRPSVAKVLLRHGANPDLRDEDGKTPLDKARERVDEGHRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query121 2.2.26 [Sep-21-2011]
Q9ULT8 2610 E3 ubiquitin-protein liga yes N/A 0.917 0.042 0.885 9e-55
Q69ZR2 2618 E3 ubiquitin-protein liga yes N/A 0.917 0.042 0.878 2e-53
Q5RJK8282 Acyl-CoA-binding domain-c no N/A 0.826 0.354 0.352 5e-12
A2VDR2282 Acyl-CoA-binding domain-c no N/A 0.826 0.354 0.343 2e-11
Q9BR61282 Acyl-CoA-binding domain-c no N/A 0.826 0.354 0.343 3e-11
Q9D061282 Acyl-CoA-binding domain-c no N/A 0.826 0.354 0.333 2e-10
Q876L4 730 Probable palmitoyltransfe N/A N/A 0.768 0.127 0.36 2e-10
O95271 1327 Tankyrase-1 OS=Homo sapie no N/A 0.768 0.070 0.357 4e-10
Q6PFX9 1320 Tankyrase-1 OS=Mus muscul no N/A 0.768 0.070 0.357 5e-10
Q9STP8354 Acyl-CoA-binding domain-c no N/A 0.776 0.265 0.360 5e-10
>sp|Q9ULT8|HECD1_HUMAN E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens GN=HECTD1 PE=1 SV=3 Back     alignment and function desciption
 Score =  211 bits (538), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 101/114 (88%), Positives = 105/114 (92%), Gaps = 3/114 (2%)

Query: 8   RQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVN 67
           RQLI+CIRSKDTDALI+ ID+G  EVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVN
Sbjct: 364 RQLIDCIRSKDTDALIDAIDTGAFEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVN 423

Query: 68  KGQRSSSLHYAACFGRPSVAKVLLRHGANPDLRDEDGKTPLDKARERVDEGHRE 121
           +GQRSSSLHYAACFGRP VAK LLRHGANPDLRDEDGKTPLDKARER   GH E
Sbjct: 424 RGQRSSSLHYAACFGRPQVAKTLLRHGANPDLRDEDGKTPLDKARER---GHSE 474




Probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. May be required for development of the head mesenchyme and neural tube closure.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q69ZR2|HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus GN=Hectd1 PE=1 SV=2 Back     alignment and function description
>sp|Q5RJK8|ACBD6_RAT Acyl-CoA-binding domain-containing protein 6 OS=Rattus norvegicus GN=Acbd6 PE=2 SV=1 Back     alignment and function description
>sp|A2VDR2|ACBD6_BOVIN Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus GN=ACBD6 PE=2 SV=1 Back     alignment and function description
>sp|Q9BR61|ACBD6_HUMAN Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens GN=ACBD6 PE=1 SV=1 Back     alignment and function description
>sp|Q9D061|ACBD6_MOUSE Acyl-CoA-binding domain-containing protein 6 OS=Mus musculus GN=Acbd6 PE=1 SV=2 Back     alignment and function description
>sp|Q876L4|AKR2_SACBA Probable palmitoyltransferase AKR2 OS=Saccharomyces bayanus GN=AKR2 PE=3 SV=1 Back     alignment and function description
>sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 Back     alignment and function description
>sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 Back     alignment and function description
>sp|Q9STP8|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
307197829 2600 E3 ubiquitin-protein ligase HECTD1 [Harp 0.942 0.043 0.947 2e-59
307166390 2551 E3 ubiquitin-protein ligase HECTD1 [Camp 0.942 0.044 0.938 4e-59
270005044 2552 hypothetical protein TcasGA2_TC007046 [T 0.942 0.044 0.929 1e-58
189236840 2609 PREDICTED: similar to hect E3 ubiquitin 0.942 0.043 0.929 1e-58
242008012 2686 hect E3 ubiquitin ligase, putative [Pedi 0.942 0.042 0.929 1e-58
345495040 2621 PREDICTED: E3 ubiquitin-protein ligase H 0.942 0.043 0.929 1e-58
350419570 2495 PREDICTED: E3 ubiquitin-protein ligase H 0.942 0.045 0.938 1e-58
345495044 2608 PREDICTED: E3 ubiquitin-protein ligase H 0.942 0.043 0.929 1e-58
345495042 2506 PREDICTED: E3 ubiquitin-protein ligase H 0.942 0.045 0.929 1e-58
340712868 2541 PREDICTED: LOW QUALITY PROTEIN: e3 ubiqu 0.942 0.044 0.938 2e-58
>gi|307197829|gb|EFN78940.1| E3 ubiquitin-protein ligase HECTD1 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  232 bits (592), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 108/114 (94%), Positives = 113/114 (99%)

Query: 8   RQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVN 67
           RQLI+CIRSKDTDALIE IDSGG+EVNFMDDVGQTLLNWASAFGTQEMVEFLC+RGADVN
Sbjct: 358 RQLIDCIRSKDTDALIEAIDSGGIEVNFMDDVGQTLLNWASAFGTQEMVEFLCDRGADVN 417

Query: 68  KGQRSSSLHYAACFGRPSVAKVLLRHGANPDLRDEDGKTPLDKARERVDEGHRE 121
           KGQRSSSLHYAACFGRP++AKVLLRHGANPDLRDEDGKTPLDKARERVDEGHRE
Sbjct: 418 KGQRSSSLHYAACFGRPAIAKVLLRHGANPDLRDEDGKTPLDKARERVDEGHRE 471




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307166390|gb|EFN60527.1| E3 ubiquitin-protein ligase HECTD1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|270005044|gb|EFA01492.1| hypothetical protein TcasGA2_TC007046 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189236840|ref|XP_001813187.1| PREDICTED: similar to hect E3 ubiquitin ligase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242008012|ref|XP_002424807.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis] gi|212508345|gb|EEB12069.1| hect E3 ubiquitin ligase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345495040|ref|XP_003427422.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350419570|ref|XP_003492229.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|345495044|ref|XP_001605880.2| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345495042|ref|XP_003427423.1| PREDICTED: E3 ubiquitin-protein ligase HECTD1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340712868|ref|XP_003394975.1| PREDICTED: LOW QUALITY PROTEIN: e3 ubiquitin-protein ligase HECTD1-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
UNIPROTKB|G3V4V5 926 HECTD1 "E3 ubiquitin-protein l 0.917 0.119 0.885 8.6e-50
UNIPROTKB|E1C1E6 2576 HECTD1 "Uncharacterized protei 0.917 0.043 0.885 7.5e-49
ZFIN|ZDB-GENE-030616-153 2576 hectd1 "HECT domain containing 0.917 0.043 0.885 7.5e-49
UNIPROTKB|F1SHF6 2607 HECTD1 "Uncharacterized protei 0.917 0.042 0.885 7.6e-49
UNIPROTKB|E2RGH9 2609 HECTD1 "Uncharacterized protei 0.917 0.042 0.885 7.6e-49
UNIPROTKB|E1C040 2610 HECTD1 "Uncharacterized protei 0.917 0.042 0.885 7.6e-49
UNIPROTKB|E1BLD1 2610 HECTD1 "Uncharacterized protei 0.917 0.042 0.885 7.6e-49
UNIPROTKB|Q9ULT8 2610 HECTD1 "E3 ubiquitin-protein l 0.917 0.042 0.885 7.6e-49
RGD|1561653 2610 Hectd1 "HECT domain containing 0.917 0.042 0.885 7.6e-49
MGI|MGI:2384768 2618 Hectd1 "HECT domain containing 0.917 0.042 0.878 5.4e-48
UNIPROTKB|G3V4V5 HECTD1 "E3 ubiquitin-protein ligase HECTD1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 526 (190.2 bits), Expect = 8.6e-50, P = 8.6e-50
 Identities = 101/114 (88%), Positives = 105/114 (92%)

Query:     8 RQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVN 67
             RQLI+CIRSKDTDALI+ ID+G  EVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVN
Sbjct:   364 RQLIDCIRSKDTDALIDAIDTGAFEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVN 423

Query:    68 KGQRSSSLHYAACFGRPSVAKVLLRHGANPDLRDEDGKTPLDKARERVDEGHRE 121
             +GQRSSSLHYAACFGRP VAK LLRHGANPDLRDEDGKTPLDKARER   GH E
Sbjct:   424 RGQRSSSLHYAACFGRPQVAKTLLRHGANPDLRDEDGKTPLDKARER---GHSE 474




GO:0001843 "neural tube closure" evidence=IEA
UNIPROTKB|E1C1E6 HECTD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-153 hectd1 "HECT domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SHF6 HECTD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGH9 HECTD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1C040 HECTD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BLD1 HECTD1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULT8 HECTD1 "E3 ubiquitin-protein ligase HECTD1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1561653 Hectd1 "HECT domain containing E3 ubiquitin protein ligase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2384768 Hectd1 "HECT domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ULT8HECD1_HUMAN6, ., 3, ., 2, ., -0.88590.91730.0425yesN/A
Q69ZR2HECD1_MOUSE6, ., 3, ., 2, ., -0.87820.91730.0423yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 4e-23
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-20
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-16
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 9e-12
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-10
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-10
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-10
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-09
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-09
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-08
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-08
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 6e-08
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 9e-08
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-07
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-07
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-07
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-06
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-05
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 1e-05
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 5e-05
smart0024830 smart00248, ANK, ankyrin repeats 1e-04
COG0666 235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-04
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 5e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.002
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.003
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.003
PHA02917 661 PHA02917, PHA02917, ankyrin-like protein; Provisio 0.003
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 0.003
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 86.7 bits (215), Expect = 4e-23
 Identities = 42/114 (36%), Positives = 64/114 (56%), Gaps = 6/114 (5%)

Query: 10  LIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVNK- 68
           L     +   + +++ +   G +VN  D+ G+T L+ A+  G  E+V+ L E+GADVN  
Sbjct: 11  LHLAASNGHLE-VVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVNAR 69

Query: 69  -GQRSSSLHYAACFGRPSVAKVLLRHGANPDLRDEDGKTPLDKARERVDEGHRE 121
               ++ LH AA  G   V K+LL+HGA+ + RD+DG+TPL  A      GH E
Sbjct: 70  DKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLA---AKNGHLE 120


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165231 PHA02917, PHA02917, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 121
KOG4412|consensus226 99.95
KOG4412|consensus226 99.95
KOG0509|consensus 600 99.91
KOG0512|consensus228 99.91
KOG0509|consensus 600 99.91
PHA02791284 ankyrin-like protein; Provisional 99.9
PHA02884 300 ankyrin repeat protein; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.9
PHA02791 284 ankyrin-like protein; Provisional 99.89
PHA02743166 Viral ankyrin protein; Provisional 99.89
PHA02875 413 ankyrin repeat protein; Provisional 99.88
PHA02875 413 ankyrin repeat protein; Provisional 99.87
PHA02874 434 ankyrin repeat protein; Provisional 99.87
PHA02859209 ankyrin repeat protein; Provisional 99.87
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.87
PHA02878 477 ankyrin repeat protein; Provisional 99.86
PHA02874 434 ankyrin repeat protein; Provisional 99.86
KOG0508|consensus 615 99.85
PHA02859209 ankyrin repeat protein; Provisional 99.85
KOG4214|consensus117 99.85
PHA03100 480 ankyrin repeat protein; Provisional 99.85
KOG0502|consensus296 99.85
PHA02878 477 ankyrin repeat protein; Provisional 99.85
KOG0508|consensus 615 99.85
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.85
PHA03100 480 ankyrin repeat protein; Provisional 99.84
PHA03095 471 ankyrin-like protein; Provisional 99.84
PHA03095 471 ankyrin-like protein; Provisional 99.84
PHA02876 682 ankyrin repeat protein; Provisional 99.84
PHA02798 489 ankyrin-like protein; Provisional 99.83
PHA02946 446 ankyin-like protein; Provisional 99.83
PHA02989 494 ankyrin repeat protein; Provisional 99.83
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.83
PHA02736154 Viral ankyrin protein; Provisional 99.83
PHA02795 437 ankyrin-like protein; Provisional 99.82
KOG4177|consensus 1143 99.82
PHA02876 682 ankyrin repeat protein; Provisional 99.81
KOG0510|consensus 929 99.81
PHA02743166 Viral ankyrin protein; Provisional 99.81
KOG0514|consensus452 99.81
PHA02946 446 ankyin-like protein; Provisional 99.81
PHA02917 661 ankyrin-like protein; Provisional 99.8
KOG0195|consensus 448 99.8
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.8
PHA02798 489 ankyrin-like protein; Provisional 99.78
PHA02795 437 ankyrin-like protein; Provisional 99.77
KOG0512|consensus228 99.77
KOG0195|consensus 448 99.77
PHA02989 494 ankyrin repeat protein; Provisional 99.76
KOG0510|consensus 929 99.76
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.75
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.75
PHA02792 631 ankyrin-like protein; Provisional 99.74
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.73
PHA02736154 Viral ankyrin protein; Provisional 99.73
PHA02730 672 ankyrin-like protein; Provisional 99.71
PHA02917 661 ankyrin-like protein; Provisional 99.71
KOG1710|consensus 396 99.7
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.69
KOG0502|consensus296 99.69
KOG4177|consensus 1143 99.69
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.69
KOG0505|consensus 527 99.69
PHA02741169 hypothetical protein; Provisional 99.68
KOG0507|consensus 854 99.67
PHA02730 672 ankyrin-like protein; Provisional 99.67
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.66
PHA02884 300 ankyrin repeat protein; Provisional 99.66
PHA02792 631 ankyrin-like protein; Provisional 99.66
KOG0514|consensus452 99.66
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.65
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.64
KOG0515|consensus752 99.62
KOG0505|consensus 527 99.61
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.59
KOG3676|consensus 782 99.57
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.55
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.54
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.5
KOG0507|consensus 854 99.49
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.48
KOG3676|consensus 782 99.48
KOG4214|consensus117 99.47
KOG0783|consensus 1267 99.41
KOG0515|consensus 752 99.32
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.26
KOG1710|consensus 396 99.24
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.23
PF1360630 Ank_3: Ankyrin repeat 99.18
KOG0506|consensus622 99.17
KOG0782|consensus1004 99.16
KOG0818|consensus 669 99.15
KOG4369|consensus 2131 99.11
KOG0818|consensus 669 99.05
KOG0705|consensus749 99.05
PF1360630 Ank_3: Ankyrin repeat 98.99
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.89
KOG4369|consensus 2131 98.87
KOG0522|consensus 560 98.83
KOG0522|consensus 560 98.76
KOG0506|consensus622 98.75
KOG0783|consensus 1267 98.64
KOG3609|consensus 822 98.63
KOG0705|consensus749 98.59
KOG0521|consensus785 98.47
KOG0511|consensus 516 98.45
KOG0511|consensus 516 98.4
KOG2384|consensus 223 98.33
KOG0521|consensus785 98.08
KOG0782|consensus1004 98.05
KOG2384|consensus 223 98.0
KOG3609|consensus 822 98.0
KOG0520|consensus 975 97.99
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.8
KOG2505|consensus 591 97.8
KOG0520|consensus 975 97.55
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.48
KOG2505|consensus591 97.2
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 92.72
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 89.65
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 88.01
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 87.64
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 80.67
>KOG4412|consensus Back     alignment and domain information
Probab=99.95  E-value=6.5e-28  Score=136.35  Aligned_cols=107  Identities=29%  Similarity=0.401  Sum_probs=61.3

Q ss_pred             CchHHHHHHHHhCChHHHHHHHHhCCCCCccccCCCchHHHHHHHcCCHHHHHHHHHcCCCCCCCC--CccHHHHHHHhC
Q psy15272          5 WPKRQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVNKGQ--RSSSLHYAACFG   82 (121)
Q Consensus         5 ~~~~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~l~~~~~~~~~~~--g~t~l~~a~~~~   82 (121)
                      .+.+|||.|+..|+.+.|+.|+.+.+.+++..+..|.|+||||+..|..+++++|+..|+.++.++  |.||||-|+..|
T Consensus        71 aGWtPlhia~s~g~~evVk~Ll~r~~advna~tn~G~T~LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavG  150 (226)
T KOG4412|consen   71 AGWTPLHIAASNGNDEVVKELLNRSGADVNATTNGGQTCLHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVG  150 (226)
T ss_pred             cCCchhhhhhhcCcHHHHHHHhcCCCCCcceecCCCcceehhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhcc
Confidence            445555555555555555555555555555555555555555555555555555555555544332  555666555555


Q ss_pred             CHHHHHHHHHcCCCCCccCcCCCCHHHHH
Q psy15272         83 RPSVAKVLLRHGANPDLRDEDGKTPLDKA  111 (121)
Q Consensus        83 ~~~~~~~L~~~~~~~~~~~~~g~tpl~~a  111 (121)
                      ..+++++|+..|+.++.+|.+|+||||.|
T Consensus       151 klkvie~Li~~~a~~n~qDk~G~TpL~~a  179 (226)
T KOG4412|consen  151 KLKVIEYLISQGAPLNTQDKYGFTPLHHA  179 (226)
T ss_pred             chhhHHHHHhcCCCCCcccccCccHHHHH
Confidence            55566666655555566666666665555



>KOG4412|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-14
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 5e-14
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-13
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 1e-13
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-13
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-13
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-12
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-12
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-12
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 3e-12
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 6e-12
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 6e-12
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 7e-12
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 8e-12
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 8e-12
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-11
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-11
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-11
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-11
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-11
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-11
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-11
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 4e-11
2xeh_A157 Structural Determinants For Improved Thermal Stabil 4e-11
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 4e-11
2xee_A157 Structural Determinants For Improved Thermal Stabil 4e-11
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 5e-11
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 6e-11
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 1e-10
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-10
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-10
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-10
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-10
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 4e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 9e-10
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-09
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-09
1uoh_A226 Human Gankyrin Length = 226 1e-09
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-09
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-08
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-08
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 3e-08
3uxg_A172 Crystal Structure Of Rfxank Length = 172 3e-08
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 6e-08
3deo_A183 Structural Basis For Specific Substrate Recognition 7e-08
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 7e-08
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 9e-08
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-07
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 2e-07
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 2e-07
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 2e-07
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 3e-07
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 3e-07
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 3e-07
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 3e-07
3utm_A 351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 5e-07
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 6e-07
1s70_B 299 Complex Between Protein Ser/thr Phosphatase-1 (delt 6e-07
3so8_A162 Crystal Structure Of Ankra Length = 162 6e-07
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 7e-07
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-06
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 7e-06
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 7e-06
4b93_B 269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 7e-06
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 1e-05
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 1e-05
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 1e-05
1wdy_A 285 Crystal Structure Of Ribonuclease Length = 285 1e-05
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 1e-05
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 1e-05
4g8k_A 337 Intact Sensor Domain Of Human Rnase L In The Inacti 1e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 2e-05
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 2e-05
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 2e-05
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 3e-05
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 5e-05
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 8e-05
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 9e-05
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-04
1dcq_A278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 2e-04
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-04
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 3e-04
3lvq_E 497 The Crystal Structure Of Asap3 In Complex With Arf6 4e-04
2b0o_E301 Crystal Structure Of Uplc1 Gap Domain Length = 301 5e-04
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 6e-04
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 7e-04
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure

Iteration: 1

Score = 73.6 bits (179), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 43/116 (37%), Positives = 70/116 (60%), Gaps = 6/116 (5%) Query: 8 RQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVN 67 ++LIE + + D + + I++G +VN D G+T L++A+ G +E+V+ L +GADVN Sbjct: 6 KRLIEAAENGNKDRVKDLIENG-ADVNASDSDGRTPLHYAAKEGHKEIVKLLISKGADVN 64 Query: 68 KGQRS--SSLHYAACFGRPSVAKVLLRHGANPDLRDEDGKTPLDKARERVDEGHRE 121 + LHYAA G + K+L+ GA+ + +D DG+TPL A + EGH+E Sbjct: 65 AKDSDGRTPLHYAAKEGHKEIVKLLISKGADVNAKDSDGRTPLHYAAK---EGHKE 117
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Length = 497 Back     alignment and structure
>pdb|2B0O|E Chain E, Crystal Structure Of Uplc1 Gap Domain Length = 301 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-27
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-22
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-14
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-27
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-22
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-10
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-27
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-18
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-27
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-25
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-22
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-19
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-26
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-26
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-20
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-26
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 6e-26
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 7e-18
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-15
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-26
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 3e-17
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-26
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-17
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-12
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-26
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 8e-25
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-21
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-13
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-26
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-21
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-18
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-26
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-21
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-20
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-19
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-25
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-25
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-20
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-19
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-05
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-25
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-25
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-25
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-24
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-24
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-24
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-18
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-25
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-24
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-13
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-25
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-05
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-25
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-19
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-17
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-13
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-25
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-24
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-23
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-12
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-25
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-23
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-22
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-21
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-21
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-25
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 1e-24
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-24
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 3e-21
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-13
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-05
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-25
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-22
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-22
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-11
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-25
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-20
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 7e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-25
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-24
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-21
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 2e-20
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 6e-16
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 9e-16
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-25
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-24
2rfm_A 192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-15
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-25
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-24
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 6e-23
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-22
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 2e-21
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-14
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 9e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-22
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-16
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-24
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-24
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-24
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-22
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-15
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-24
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-20
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-18
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-12
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-24
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-24
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-21
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-17
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-16
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-24
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-23
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-22
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-21
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-24
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-22
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-12
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-24
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-23
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-21
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-14
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-05
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-24
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-22
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-21
3hra_A 201 Ankyrin repeat family protein; structural protein; 6e-23
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-23
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-23
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-13
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-23
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-22
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-22
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-21
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-20
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-16
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-22
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-20
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-20
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-17
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-21
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 2e-21
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-21
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 3e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-21
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-19
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-18
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-17
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-15
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-21
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-21
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-21
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 4e-21
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-18
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-18
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 8e-12
2rfa_A232 Transient receptor potential cation channel subfa 2e-21
2rfa_A232 Transient receptor potential cation channel subfa 5e-19
2rfa_A232 Transient receptor potential cation channel subfa 2e-16
2rfa_A232 Transient receptor potential cation channel subfa 2e-15
2rfa_A 232 Transient receptor potential cation channel subfa 9e-10
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-21
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-18
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-15
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-20
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-19
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 3e-20
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 4e-20
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 8e-17
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-16
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-16
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-11
2pnn_A273 Transient receptor potential cation channel subfa 8e-20
2pnn_A 273 Transient receptor potential cation channel subfa 1e-14
2pnn_A273 Transient receptor potential cation channel subfa 6e-10
2pnn_A273 Transient receptor potential cation channel subfa 1e-06
2pnn_A 273 Transient receptor potential cation channel subfa 1e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-19
3jxi_A 260 Vanilloid receptor-related osmotically activated p 1e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-09
3jxi_A 260 Vanilloid receptor-related osmotically activated p 5e-07
3jxi_A 260 Vanilloid receptor-related osmotically activated p 9e-05
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-16
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-15
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 9e-18
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 4e-17
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 9e-15
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-14
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-16
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-15
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-15
2etb_A256 Transient receptor potential cation channel subfam 6e-14
2etb_A 256 Transient receptor potential cation channel subfam 6e-12
2etb_A256 Transient receptor potential cation channel subfam 1e-10
2etb_A256 Transient receptor potential cation channel subfam 5e-04
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-07
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-04
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
 Score = 96.7 bits (242), Expect = 3e-27
 Identities = 31/96 (32%), Positives = 44/96 (45%), Gaps = 5/96 (5%)

Query: 28  SGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVNKG--QRSSSLHYAACFGRPS 85
             G + N  D  G T L+ A   G  ++VE L +  A VN    Q  S LH AA  G   
Sbjct: 31  QNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGYQNDSPLHDAAKNGHVD 90

Query: 86  VAKVLLRHGANPDLRDEDGKTPLDKARERVDEGHRE 121
           + K+LL +GA+ +  +  G  P+D      DE  + 
Sbjct: 91  IVKLLLSYGASRNAVNIFGLRPVDYT---DDESMKS 123


>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.95
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.95
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.94
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.93
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.93
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.92
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 99.92
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.92
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.92
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.92
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.92
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.92
2rfa_A232 Transient receptor potential cation channel subfa 99.92
3hra_A201 Ankyrin repeat family protein; structural protein; 99.92
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.92
2rfa_A232 Transient receptor potential cation channel subfa 99.92
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.92
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.92
3hra_A201 Ankyrin repeat family protein; structural protein; 99.92
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.92
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.91
2etb_A256 Transient receptor potential cation channel subfam 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.91
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.91
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.91
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.91
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.91
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.91
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.91
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.91
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.91
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.91
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.91
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.91
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.91
2pnn_A273 Transient receptor potential cation channel subfa 99.91
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.91
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.91
2etb_A 256 Transient receptor potential cation channel subfam 99.91
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.9
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.9
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.9
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.9
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.9
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.9
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.9
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.9
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.9
2pnn_A273 Transient receptor potential cation channel subfa 99.9
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.9
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.9
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.9
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.9
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.89
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.89
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.89
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.88
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.88
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.88
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.88
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.88
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.87
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 99.87
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.86
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.86
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.86
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.85
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.85
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.84
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.83
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.82
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.82
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.82
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.82
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.81
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.8
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.8
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.77
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.77
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.77
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 99.75
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.71
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.96  E-value=2.3e-28  Score=140.77  Aligned_cols=109  Identities=36%  Similarity=0.491  Sum_probs=63.3

Q ss_pred             CchHHHHHHHHhCChHHHHHHHHhCCCCCccccCCCchHHHHHHHcCCHHHHHHHHHcCCCCCC--CCCccHHHHHHHhC
Q psy15272          5 WPKRQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVNK--GQRSSSLHYAACFG   82 (121)
Q Consensus         5 ~~~~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~l~~~~~~~~~--~~g~t~l~~a~~~~   82 (121)
                      .+.++++.|+..++.+.+.. +.+.|.+++.+|..|+||||+|+..|+.+++++|++.|++++.  ..|+||||+|+..|
T Consensus        36 ~g~t~l~~a~~~~~~~~~~~-ll~~gad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g  114 (169)
T 4gpm_A           36 DGRTPLHHAAENGHKEVVKL-LISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENG  114 (169)
T ss_dssp             TSCCHHHHHHHTTCHHHHHH-HHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTT
T ss_pred             CCCCHHHHHHHcCCHHHHHH-HHhcccchhhhccCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCCHHHHHHHcC
Confidence            34445555555555533332 2334555555555666666666666666666666666665542  33566666666666


Q ss_pred             CHHHHHHHHHcCCCCCccCcCCCCHHHHHHhh
Q psy15272         83 RPSVAKVLLRHGANPDLRDEDGKTPLDKARER  114 (121)
Q Consensus        83 ~~~~~~~L~~~~~~~~~~~~~g~tpl~~a~~~  114 (121)
                      +.+++++|++.|++++.+|..|.|||++|++.
T Consensus       115 ~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~  146 (169)
T 4gpm_A          115 HKEVVKLLISKGADVNTSDSDGRTPLDLAREH  146 (169)
T ss_dssp             CHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHT
T ss_pred             CHHHHHHHHHcCCCccccCCCCCCHHHHHHHc
Confidence            66666666666666666666666666666655



>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 121
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-17
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-15
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-14
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-13
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-17
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-07
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-16
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-13
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-10
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-06
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-06
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-05
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 8e-15
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-13
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-11
d1uoha_ 223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-13
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-10
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-12
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-06
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-11
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-06
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-11
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-09
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-07
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.003
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-07
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-04
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-06
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-05
d1ihba_ 156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.001
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.002
d1bd8a_ 156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.003
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.004
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 74.6 bits (182), Expect = 1e-17
 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 2/72 (2%)

Query: 42  TLLNWASAFGTQEMVEFLCERGADVNK--GQRSSSLHYAACFGRPSVAKVLLRHGANPDL 99
           T L+ AS  G   +V+ L +RGA  N    +  + LH AA  G   VAK LL++ A  + 
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNA 61

Query: 100 RDEDGKTPLDKA 111
           + +D +TPL  A
Sbjct: 62  KAKDDQTPLHCA 73


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.96
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.94
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.92
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.9
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.9
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.89
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.89
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.89
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.88
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.87
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.87
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.86
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.86
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.85
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.83
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.83
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.83
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.82
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.82
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.81
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.8
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.79
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.73
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.73
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.72
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.69
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.68
d1k1aa_ 228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.6
d1sw6a_ 301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.59
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.96  E-value=2.3e-29  Score=135.95  Aligned_cols=107  Identities=28%  Similarity=0.463  Sum_probs=97.4

Q ss_pred             hHHHHHHHHhCChHHHHHHHHhCCCCCccccCCCchHHHHHHHcCCHHHHHHHHHcCCCCCC--CCCccHHHHHHHhCCH
Q psy15272          7 KRQLIECIRSKDTDALIETIDSGGVEVNFMDDVGQTLLNWASAFGTQEMVEFLCERGADVNK--GQRSSSLHYAACFGRP   84 (121)
Q Consensus         7 ~~~l~~a~~~~~~~~v~~ll~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~l~~~~~~~~~--~~g~t~l~~a~~~~~~   84 (121)
                      .+||++|+.+|+.+.|+.++ +.|.+++..+..|+||+|+|+..++.+++++|++.|++++.  ..|+||||+|+..|+.
T Consensus         3 ~tpL~~A~~~g~~~~v~~Ll-~~g~d~n~~~~~g~t~lh~A~~~~~~~~~~~ll~~g~din~~d~~g~tpLh~A~~~~~~   81 (118)
T d1myoa_           3 DKEFMWALKNGDLDEVKDYV-AKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHV   81 (118)
T ss_dssp             HHHHHHHHHTTCHHHHHHHH-TTTCCCCCCSSSSCCTTHHHHHHSTTTHHHHHHHSSCTTTCCSSSCSCHHHHHHTTTCC
T ss_pred             ChHHHHHHHCCCHHHHHHHH-HhhhccccccccccccccccccccccccccccccccceeeecccccccchhhhhhcCch
Confidence            47899999999997776655 66899999999999999999999999999999999998874  4589999999999999


Q ss_pred             HHHHHHHHcCCCCCccCcCCCCHHHHHHhh
Q psy15272         85 SVAKVLLRHGANPDLRDEDGKTPLDKARER  114 (121)
Q Consensus        85 ~~~~~L~~~~~~~~~~~~~g~tpl~~a~~~  114 (121)
                      +++++|++.|++++.+|..|.|||++|...
T Consensus        82 ~~v~~Ll~~Gad~~~~d~~G~t~l~~a~~~  111 (118)
T d1myoa_          82 SCVKLLLSKGADKTVKGPDGLTALEATDNQ  111 (118)
T ss_dssp             HHHHHHHTTCCCSSSSSSSTCCCCCTCSST
T ss_pred             hhhhhhhcccccceeeCCCCCCHHHHHhHH
Confidence            999999999999999999999999987543



>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure