Psyllid ID: psy15323

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPLAMRHLAMRPLAMRKDGIQTRKRKPKKQGGGGGGGSGG
cccccccccEEccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccc
cccccccccEEEcccccccccccccccccHHHcccccHHcccccccccccccccccHHHHcccEEcccccccEEEEEEccccccccccccEEEEcccccccHHHHHHccccccccHccccccccccccccccccccccc
mdfqfgegrecvncgaistplwrrdgtghylcnacglyhkmngmnrplvkpskrltatrrlglcctncgtrmttlwrrnndgepvcnacGLYYKLHNVNRPLAMRHLAMRPLamrkdgiqtrkrkpkkqgggggggsgg
mdfqfgegrecVNCGAistplwrrdgTGHYLCNACGLYHKMNGMNRPLVkpskrltatrrlglcctncgtrmttlwrrnndgePVCNACGLYYKLHNVNRPLAMRHLAMRPLAMrkdgiqtrkrkpkkqgggggggsgg
MDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPLAMRHLAMRPLAMRKDGIQTRKRKPKKQgggggggsgg
*******GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPLAMRHLAM******************************
***********VNCGAISTPLWRRDGTGHYLC***********************TATRRLGLCCTNCGTRMT*************NACGLYYKLHNVNR***************************************
********RECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPLAMRHLAMRPLAMRKDG*********************
****FGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPLAMRHLAMRPL***************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPLAMRHLAMRPLAMRKDGIQTRKRKPKKQGGGGGGGSGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query139 2.2.26 [Sep-21-2011]
P52168 540 GATA-binding factor A OS= yes N/A 0.892 0.229 0.846 1e-64
P43695390 GATA-binding factor 5-A O N/A N/A 0.841 0.3 0.755 2e-52
P43696388 GATA-binding factor 5-B O N/A N/A 0.841 0.301 0.748 5e-52
Q0Q0E4 442 Transcription factor GATA yes N/A 0.841 0.264 0.740 1e-51
P43694 442 Transcription factor GATA yes N/A 0.841 0.264 0.740 1e-51
P46152 440 Transcription factor GATA yes N/A 0.841 0.265 0.740 1e-51
Q91677392 Transcription factor GATA N/A N/A 0.812 0.288 0.747 1e-51
P97489404 Transcription factor GATA no N/A 0.805 0.277 0.754 2e-51
Q08369 440 Transcription factor GATA yes N/A 0.841 0.265 0.740 2e-51
P43691 380 Transcription factor GATA yes N/A 0.812 0.297 0.747 4e-51
>sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 Back     alignment and function desciption
 Score =  244 bits (623), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 116/137 (84%), Positives = 118/137 (86%), Gaps = 13/137 (9%)

Query: 1   MDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRL---TA 57
           MDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPL+KPSKRL   TA
Sbjct: 159 MDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPSKRLVSATA 218

Query: 58  TRRLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPLAMRHLAMRPLAMRKD 117
           TRR+GLCCTNCGTR TTLWRRNNDGEPVCNACGLYYKLH VN          RPLAMRKD
Sbjct: 219 TRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVN----------RPLAMRKD 268

Query: 118 GIQTRKRKPKKQGGGGG 134
           GIQTRKRKPKK G G  
Sbjct: 269 GIQTRKRKPKKTGSGSA 285
Transcriptional regulator involved in several developmental processes during embryonic and imaginal disks development. Involved in determining dorsal cell fate. Acts as an essential transcriptional regulator of proneural achaete-scute complex (AS-C) and is required for its spatial regulation during development of the adult peripheral nervous system, and hence for the positioning of neural precursors. It is the only factor to directly activate AS-C genes.
Drosophila melanogaster (taxid: 7227)
>sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 Back     alignment and function description
>sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 Back     alignment and function description
>sp|Q0Q0E4|GATA4_CANFA Transcription factor GATA-4 OS=Canis familiaris GN=GATA4 PE=2 SV=1 Back     alignment and function description
>sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 Back     alignment and function description
>sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 Back     alignment and function description
>sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 Back     alignment and function description
>sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=2 SV=2 Back     alignment and function description
>sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=3 Back     alignment and function description
>sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
442619350 537 pannier, isoform C [Drosophila melanogas 0.892 0.230 0.865 2e-64
194767723 551 GF11891 [Drosophila ananassae] gi|190619 0.928 0.234 0.848 8e-64
195452164 550 GK13255 [Drosophila willistoni] gi|19416 0.870 0.22 0.885 2e-63
198454786 532 GA17817, isoform A [Drosophila pseudoobs 0.848 0.221 0.898 3e-63
195157146 532 GL12215 [Drosophila persimilis] gi|19411 0.848 0.221 0.898 3e-63
119112909 537 AGAP002235-PA [Anopheles gambiae str. PE 0.892 0.230 0.861 3e-63
195328561 494 GM24279 [Drosophila sechellia] gi|194119 0.848 0.238 0.890 5e-63
19554935 540 achaete and scute repressor/zinc finger 0.892 0.229 0.846 7e-63
17136408 540 pannier, isoform A [Drosophila melanogas 0.892 0.229 0.846 8e-63
194901188 535 GG16973 [Drosophila erecta] gi|190651837 0.848 0.220 0.890 8e-63
>gi|442619350|ref|NP_001262620.1| pannier, isoform C [Drosophila melanogaster] gi|440217479|gb|AGB96000.1| pannier, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 116/134 (86%), Positives = 118/134 (88%), Gaps = 10/134 (7%)

Query: 1   MDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRR 60
           MDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPL+KPSKRLTATRR
Sbjct: 159 MDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPSKRLTATRR 218

Query: 61  LGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPLAMRHLAMRPLAMRKDGIQ 120
           +GLCCTNCGTR TTLWRRNNDGEPVCNACGLYYKLH VN          RPLAMRKDGIQ
Sbjct: 219 MGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVN----------RPLAMRKDGIQ 268

Query: 121 TRKRKPKKQGGGGG 134
           TRKRKPKK G G  
Sbjct: 269 TRKRKPKKTGSGSA 282

Source: Drosophila melanogaster

Species: Drosophila melanogaster

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|194767723|ref|XP_001965964.1| GF11891 [Drosophila ananassae] gi|190619807|gb|EDV35331.1| GF11891 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195452164|ref|XP_002073240.1| GK13255 [Drosophila willistoni] gi|194169325|gb|EDW84226.1| GK13255 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|198454786|ref|XP_001359720.2| GA17817, isoform A [Drosophila pseudoobscura pseudoobscura] gi|198132953|gb|EAL28872.2| GA17817, isoform A [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195157146|ref|XP_002019457.1| GL12215 [Drosophila persimilis] gi|194116048|gb|EDW38091.1| GL12215 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|119112909|ref|XP_307949.3| AGAP002235-PA [Anopheles gambiae str. PEST] gi|15420800|gb|AAK97462.1|AF395080_1 zinc finger transcription factor pannier [Anopheles gambiae] gi|116132794|gb|EAA03705.3| AGAP002235-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195328561|ref|XP_002030983.1| GM24279 [Drosophila sechellia] gi|194119926|gb|EDW41969.1| GM24279 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|19554935|gb|AAB29876.2| achaete and scute repressor/zinc finger protein [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|17136408|ref|NP_476685.1| pannier, isoform A [Drosophila melanogaster] gi|1709699|sp|P52168.1|PNR_DROME RecName: Full=GATA-binding factor A; AltName: Full=Protein pannier; AltName: Full=Transcription factor GATA-A; AltName: Full=dGATA-A gi|545347|gb|AAB29874.1| C4 zinc finger DNA-binding protein/GATA transcription factor [Drosophila melanogaster] gi|23171432|gb|AAN13693.1| pannier, isoform A [Drosophila melanogaster] gi|159884201|gb|ABX00779.1| RE33290p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194901188|ref|XP_001980134.1| GG16973 [Drosophila erecta] gi|190651837|gb|EDV49092.1| GG16973 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query139
FB|FBgn0003117 540 pnr "pannier" [Drosophila mela 0.848 0.218 0.870 3.9e-60
UNIPROTKB|P43695390 gata5-a "GATA-binding factor 5 0.805 0.287 0.778 1.7e-50
UNIPROTKB|E2RBT4400 GATA5 "Uncharacterized protein 0.805 0.28 0.778 4.6e-50
UNIPROTKB|Q3SZJ5403 GATA5 "Transcription factor GA 0.805 0.277 0.778 5.8e-50
UNIPROTKB|F1RIZ4424 GATA5 "Uncharacterized protein 0.805 0.264 0.778 5.8e-50
UNIPROTKB|Q9BWX5397 GATA5 "Transcription factor GA 0.805 0.282 0.770 7.4e-50
ZFIN|ZDB-GENE-980526-476352 gata4 "GATA-binding protein 4" 0.805 0.318 0.778 1.2e-49
MGI|MGI:109497404 Gata5 "GATA binding protein 5" 0.805 0.277 0.762 2e-49
RGD|2665 440 Gata4 "GATA binding protein 4" 0.812 0.256 0.764 2.5e-49
UNIPROTKB|D4A2N9 438 Gata4 "Transcription factor GA 0.812 0.257 0.764 2.5e-49
FB|FBgn0003117 pnr "pannier" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 616 (221.9 bits), Expect = 3.9e-60, P = 3.9e-60
 Identities = 114/131 (87%), Positives = 116/131 (88%)

Query:     1 MDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRL---TA 57
             MDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPL+KPSKRL   TA
Sbjct:   159 MDFQFGEGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLIKPSKRLVSATA 218

Query:    58 TRRLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPLAMRHLAMRPLAMRKD 117
             TRR+GLCCTNCGTR TTLWRRNNDGEPVCNACGLYYKLH VNRPLAMR          KD
Sbjct:   219 TRRMGLCCTNCGTRTTTLWRRNNDGEPVCNACGLYYKLHGVNRPLAMR----------KD 268

Query:   118 GIQTRKRKPKK 128
             GIQTRKRKPKK
Sbjct:   269 GIQTRKRKPKK 279
GO:0000981 "sequence-specific DNA binding RNA polymerase II transcription factor activity" evidence=IDA
GO:0000983 "RNA polymerase II core promoter sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0005634 "nucleus" evidence=IC;ISS;IDA
GO:0001103 "RNA polymerase II repressing transcription factor binding" evidence=IPI
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:0007391 "dorsal closure" evidence=IMP;TAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;TAS
GO:0007350 "blastoderm segmentation" evidence=IMP
GO:0007507 "heart development" evidence=TAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0030154 "cell differentiation" evidence=NAS
GO:0007179 "transforming growth factor beta receptor signaling pathway" evidence=TAS
GO:0007389 "pattern specification process" evidence=NAS
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=NAS
GO:0042440 "pigment metabolic process" evidence=IMP
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=TAS
GO:0008407 "chaeta morphogenesis" evidence=TAS
GO:0007498 "mesoderm development" evidence=NAS
GO:0010002 "cardioblast differentiation" evidence=IMP
GO:0061320 "pericardial nephrocyte differentiation" evidence=IMP
GO:0007510 "cardioblast cell fate determination" evidence=IMP
GO:0007398 "ectoderm development" evidence=TAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0048542 "lymph gland development" evidence=IMP
GO:0035050 "embryonic heart tube development" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0001085 "RNA polymerase II transcription factor binding" evidence=IPI
GO:0035051 "cardiocyte differentiation" evidence=IMP
GO:0022416 "chaeta development" evidence=IGI
GO:0060047 "heart contraction" evidence=IMP
GO:0002805 "regulation of antimicrobial peptide biosynthetic process" evidence=IMP
UNIPROTKB|P43695 gata5-a "GATA-binding factor 5-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBT4 GATA5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZJ5 GATA5 "Transcription factor GATA-5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIZ4 GATA5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BWX5 GATA5 "Transcription factor GATA-5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-476 gata4 "GATA-binding protein 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:109497 Gata5 "GATA binding protein 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2665 Gata4 "GATA binding protein 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A2N9 Gata4 "Transcription factor GATA-4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P46152GATA4_RATNo assigned EC number0.74010.84170.2659yesN/A
P52168PNR_DROMENo assigned EC number0.84670.89200.2296yesN/A
Q08369GATA4_MOUSENo assigned EC number0.74010.84170.2659yesN/A
P43694GATA4_HUMANNo assigned EC number0.74010.84170.2647yesN/A
Q0Q0E4GATA4_CANFANo assigned EC number0.74010.84170.2647yesN/A
P43691GATA4_CHICKNo assigned EC number0.74790.81290.2973yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
cd0020254 cd00202, ZnF_GATA, Zinc finger DNA binding domain; 4e-16
cd0020254 cd00202, ZnF_GATA, Zinc finger DNA binding domain; 3e-14
smart0040152 smart00401, ZnF_GATA, zinc finger binding to DNA c 2e-12
smart0040152 smart00401, ZnF_GATA, zinc finger binding to DNA c 4e-11
pfam0032036 pfam00320, GATA, GATA zinc finger 5e-11
pfam0032036 pfam00320, GATA, GATA zinc finger 1e-10
COG5641 498 COG5641, GAT1, GATA Zn-finger-containing transcrip 6e-09
COG5641498 COG5641, GAT1, GATA Zn-finger-containing transcrip 2e-08
COG5641 498 COG5641, GAT1, GATA Zn-finger-containing transcrip 5e-08
>gnl|CDD|238123 cd00202, ZnF_GATA, Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information 
 Score = 67.0 bits (164), Expect = 4e-16
 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 10/62 (16%)

Query: 65  CTNCGTRMTTLWRRN-NDGEPVCNACGLYYKLHNVNRPLAMRHLAMRPLAMRKDGIQTRK 123
           C+NCGT  T LWRR  + G  +CNACGLY+K H V RPL+ R         +KD I+ R 
Sbjct: 2   CSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSKR---------KKDQIKRRN 52

Query: 124 RK 125
           RK
Sbjct: 53  RK 54

Length = 54
>gnl|CDD|238123 cd00202, ZnF_GATA, Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information
>gnl|CDD|214648 smart00401, ZnF_GATA, zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>gnl|CDD|214648 smart00401, ZnF_GATA, zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>gnl|CDD|109380 pfam00320, GATA, GATA zinc finger Back     alignment and domain information
>gnl|CDD|109380 pfam00320, GATA, GATA zinc finger Back     alignment and domain information
>gnl|CDD|227928 COG5641, GAT1, GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|227928 COG5641, GAT1, GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|227928 COG5641, GAT1, GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 139
cd0020254 ZnF_GATA Zinc finger DNA binding domain; binds spe 99.62
cd0020254 ZnF_GATA Zinc finger DNA binding domain; binds spe 99.52
smart0040152 ZnF_GATA zinc finger binding to DNA consensus sequ 99.51
smart0040152 ZnF_GATA zinc finger binding to DNA consensus sequ 99.5
PF0032036 GATA: GATA zinc finger; InterPro: IPR000679 Zinc f 99.45
PF0032036 GATA: GATA zinc finger; InterPro: IPR000679 Zinc f 99.39
COG5641 498 GAT1 GATA Zn-finger-containing transcription facto 99.29
KOG1601|consensus340 99.11
COG5641 498 GAT1 GATA Zn-finger-containing transcription facto 98.75
KOG1601|consensus340 98.35
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 90.96
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 89.66
PF0667741 Auto_anti-p27: Sjogren's syndrome/scleroderma auto 89.25
KOG3554|consensus 693 88.22
PF1178136 RRN7: RNA polymerase I-specific transcription init 85.86
KOG3554|consensus 693 84.76
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 81.02
smart00105112 ArfGap Putative GTP-ase activating proteins for th 81.01
PRK14559 645 putative protein serine/threonine phosphatase; Pro 80.85
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information 
Probab=99.62  E-value=2.5e-16  Score=99.81  Aligned_cols=41  Identities=59%  Similarity=1.237  Sum_probs=37.7

Q ss_pred             ccccCCCCCCcceecCCCC-CcccchhhhhHHhhCCCCCchh
Q psy15323         64 CCTNCGTRMTTLWRRNNDG-EPVCNACGLYYKLHNVNRPLAM  104 (139)
Q Consensus        64 ~C~~C~t~~t~~Wr~~~~g-~~lCnaCgly~~~~~~~Rp~~~  104 (139)
                      +|+||++++||+||+++++ .+|||||||||++++..||++.
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~~rp~~~   42 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGVMRPLSK   42 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCCCCCccc
Confidence            5999999999999999955 5999999999999999999953

>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C Back     alignment and domain information
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG] Back     alignment and domain information
>PF00320 GATA: GATA zinc finger; InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00320 GATA: GATA zinc finger; InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>KOG1601|consensus Back     alignment and domain information
>COG5641 GAT1 GATA Zn-finger-containing transcription factor [Transcription] Back     alignment and domain information
>KOG1601|consensus Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) Back     alignment and domain information
>KOG3554|consensus Back     alignment and domain information
>PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] Back     alignment and domain information
>KOG3554|consensus Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
4hc7_A115 Crystal Structure Of The Full Dna Binding Domain Of 5e-46
3vd6_C119 Both Zn Fingers Of Gata1 Bound To Palindromic Dna R 4e-39
3dfv_D63 Adjacent Gata Dna Binding Length = 63 2e-18
1y0j_A46 Zinc Fingers As Protein Recognition Motifs: Structu 1e-17
1y0j_A46 Zinc Fingers As Protein Recognition Motifs: Structu 2e-07
1gnf_A46 Solution Structure Of The N-Terminal Zinc Finger Of 2e-17
1gnf_A46 Solution Structure Of The N-Terminal Zinc Finger Of 2e-07
1gat_A60 Solution Structure Of The Specific Dna Complex Of T 6e-17
3gat_A66 Solution Nmr Structure Of The C-Terminal Domain Of 7e-17
2l6y_A39 Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 3e-15
2l6y_A39 Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 2e-05
4gat_A66 Solution Nmr Structure Of The Wild Type Dna Binding 5e-11
2vus_I43 Crystal Structure Of Unliganded Nmra-Area Zinc Fing 1e-10
7gat_A66 Solution Nmr Structure Of The L22v Mutant Dna Bindi 1e-10
>pdb|4HC7|A Chain A, Crystal Structure Of The Full Dna Binding Domain Of Gata3-Complex 2 Length = 115 Back     alignment and structure 
Iteration: 1

 Score =  179 bits (454), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 86/118 (72%), Positives = 94/118 (79%), Gaps = 10/118 (8%)
Query: 8   GRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTN 67
           GRECVNCGA STPLWRRDGTGHYLCNACGLYHKMNG NRPL+KP +RL+A RR G  C N
Sbjct: 5   GRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCAN 64
Query: 68  CGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPLAMRHLAMRPLAMRKDGIQTRKRK 125
           C T  TTLWRRN +G+PVCNACGLYYKLHN+N          RPL M+K+GIQTR RK
Sbjct: 65  CQTTTTTLWRRNANGDPVCNACGLYYKLHNIN----------RPLTMKKEGIQTRNRK 112
>pdb|3VD6|C Chain C, Both Zn Fingers Of Gata1 Bound To Palindromic Dna Recognition Site, P21 Crystal Form Length = 119 Back     alignment and structure
>pdb|3DFV|D Chain D, Adjacent Gata Dna Binding Length = 63 Back     alignment and structure
>pdb|1Y0J|A Chain A, Zinc Fingers As Protein Recognition Motifs: Structural Basis For The Gata-1FRIEND OF GATA INTERACTION Length = 46 Back     alignment and structure
>pdb|1Y0J|A Chain A, Zinc Fingers As Protein Recognition Motifs: Structural Basis For The Gata-1FRIEND OF GATA INTERACTION Length = 46 Back     alignment and structure
>pdb|1GNF|A Chain A, Solution Structure Of The N-Terminal Zinc Finger Of Murine Gata-1, Nmr, 25 Structures Length = 46 Back     alignment and structure
>pdb|1GNF|A Chain A, Solution Structure Of The N-Terminal Zinc Finger Of Murine Gata-1, Nmr, 25 Structures Length = 46 Back     alignment and structure
>pdb|1GAT|A Chain A, Solution Structure Of The Specific Dna Complex Of The Zinc Containing Dna Binding Domain Of The Erythroid Transcription Factor Gata-1 By Multidimensional Nmr Length = 60 Back     alignment and structure
>pdb|3GAT|A Chain A, Solution Nmr Structure Of The C-Terminal Domain Of Chicken Gata-1 Bound To Dna, 34 Structures Length = 66 Back     alignment and structure
>pdb|2L6Y|A Chain A, Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 39 Back     alignment and structure
>pdb|2L6Y|A Chain A, Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 39 Back     alignment and structure
>pdb|4GAT|A Chain A, Solution Nmr Structure Of The Wild Type Dna Binding Domain Of Area Complexed To A 13bp Dna Containing A Cgata Site, Regularized Mean Structure Length = 66 Back     alignment and structure
>pdb|2VUS|I Chain I, Crystal Structure Of Unliganded Nmra-Area Zinc Finger Complex Length = 43 Back     alignment and structure
>pdb|7GAT|A Chain A, Solution Nmr Structure Of The L22v Mutant Dna Binding Domain Of Area Complexed To A 13 Bp Dna Containing A Tgata Site, 34 Structures Length = 66 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query139
3dfx_A63 Trans-acting T-cell-specific transcription factor 5e-21
3dfx_A63 Trans-acting T-cell-specific transcription factor 1e-12
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 9e-20
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 5e-12
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 1e-19
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 9e-17
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 5e-18
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 3e-14
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 6e-16
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 3e-14
3k1f_M197 Transcription initiation factor IIB; RNA polymeras 1e-05
3k7a_M 345 Transcription initiation factor IIB; RNA polymeras 8e-04
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Length = 63 Back     alignment and structure
 Score = 79.3 bits (195), Expect = 5e-21
 Identities = 43/72 (59%), Positives = 49/72 (68%), Gaps = 10/72 (13%)

Query: 56  TATRRLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPLAMRHLAMRPLAMR 115
           +A RR G  C NC T  TTLWRRN +G+PVCNACGLYYKLHN+N          RPL M+
Sbjct: 1   SAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNIN----------RPLTMK 50

Query: 116 KDGIQTRKRKPK 127
           K+GIQTR RK  
Sbjct: 51  KEGIQTRNRKMS 62
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Length = 63 Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Length = 66 Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Length = 66 Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Length = 46 Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Length = 46 Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Length = 43 Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Length = 43 Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Length = 71 Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Length = 71 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Length = 345 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
4hc9_A115 Trans-acting T-cell-specific transcription factor; 100.0
3dfx_A63 Trans-acting T-cell-specific transcription factor 99.84
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 99.82
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 99.76
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 99.76
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 99.75
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 99.73
4gat_A66 Nitrogen regulatory protein AREA; DNA binding prot 99.72
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 99.69
3dfx_A63 Trans-acting T-cell-specific transcription factor 99.69
2kae_A71 GATA-type transcription factor; zinc finger, GATA- 99.58
4hc9_A115 Trans-acting T-cell-specific transcription factor; 99.52
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 85.42
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 84.77
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 81.04
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 80.63
>4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
Probab=100.00  E-value=4.9e-41  Score=241.41  Aligned_cols=110  Identities=78%  Similarity=1.471  Sum_probs=100.7

Q ss_pred             CCCccccCCCCCCCceeecCCCCcccccccccccccCCCCCCCCCccchhhccccCcccccCCCCCCcceecCCCCCccc
Q psy15323          7 EGRECVNCGAISTPLWRRDGTGHYLCNACGLYHKMNGMNRPLVKPSKRLTATRRLGLCCTNCGTRMTTLWRRNNDGEPVC   86 (139)
Q Consensus         7 ~~~~C~nC~~~~tp~WRr~~~g~~lCnaCgly~k~hg~nRP~~kpsKR~~atk~~~~~C~~C~t~~t~~Wr~~~~g~~lC   86 (139)
                      .+++|+||++++||+||++++|++||||||||+++|++++|+.+++++..+.......|+||+|++||+||++++|++||
T Consensus         4 ~~~~C~~Cg~~~Tp~WRr~~~g~~lCnaCgl~~Kl~G~nRP~~KpKKR~~~~~~~~~~C~~C~t~~tp~WRr~~~g~~lC   83 (115)
T 4hc9_A            4 MGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVC   83 (115)
T ss_dssp             --CCCTTTCCSCCSSCEECTTSCEECHHHHHHHHHHSSCCCCSSCCCCCCCCCCTTCCCTTTCCSCCSSCEECTTSCEEC
T ss_pred             CCCCCCCCCCccCCcceECCCCCCcCcchhhhhhhcccccccccccccccccccccccCCCcCCCCcceeEECCCCCCcc
Confidence            47899999999999999999999999999999999999999999888887777888999999999999999999999999


Q ss_pred             chhhhhHHhhCCCCCchhhhcccCcccccccccccccCCC
Q psy15323         87 NACGLYYKLHNVNRPLAMRHLAMRPLAMRKDGIQTRKRKP  126 (139)
Q Consensus        87 naCgly~~~~~~~Rp~~~~~~~~~~~~~~~~~i~~~~r~~  126 (139)
                      |||||||++|++.||+          +|+++.|++|+|+-
T Consensus        84 NaCgl~~~~~~~~rp~----------~~~~~~i~~r~r~~  113 (115)
T 4hc9_A           84 NACGLYYKLHNINRPL----------TMKKEGIQTRNRKM  113 (115)
T ss_dssp             HHHHHHHHHHSSCCCG----------GGCCSSCCCCC---
T ss_pred             hHHHHHHHHhCCCCCc----------cccccchhhccccc
Confidence            9999999999999999          68899999998863
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Back     alignment and structure
>4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Back     alignment and structure
>3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* Back     alignment and structure
>2kae_A GATA-type transcription factor; zinc finger, GATA-type, DNA; NMR {Caenorhabditis elegans} Back     alignment and structure
>4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 139
d3gata_66 g.39.1.1 (A:) Erythroid transcription factor GATA- 1e-19
d3gata_66 g.39.1.1 (A:) Erythroid transcription factor GATA- 5e-14
d1y0ja139 g.39.1.1 (A:200-238) Erythroid transcription facto 3e-16
d1y0ja139 g.39.1.1 (A:200-238) Erythroid transcription facto 2e-14
d2vuti142 g.39.1.1 (I:671-712) Erythroid transcription facto 4e-16
d2vuti142 g.39.1.1 (I:671-712) Erythroid transcription facto 4e-14
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 66 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Erythroid transcription factor GATA-1
domain: Erythroid transcription factor GATA-1
species: Chicken (Gallus gallus) [TaxId: 9031]

 Score = 75.0 bits (184), Expect = 1e-19
 Identities = 43/72 (59%), Positives = 48/72 (66%), Gaps = 10/72 (13%)

Query: 59  RRLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPLAMRHLAMRPLAMRKDG 118
           +R G  C+NC T  TTLWRR+  G+PVCNACGLYYKLH VN          RPL MRKDG
Sbjct: 1   KRAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVN----------RPLTMRKDG 50

Query: 119 IQTRKRKPKKQG 130
           IQTR RK   +G
Sbjct: 51  IQTRNRKVSSKG 62
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 66 Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 39 Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 39 Back     information, alignment and structure
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Length = 42 Back     information, alignment and structure
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Length = 42 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query139
d3gata_66 Erythroid transcription factor GATA-1 {Chicken (Ga 99.86
d2vuti142 Erythroid transcription factor GATA-1 {Emericella 99.83
d2vuti142 Erythroid transcription factor GATA-1 {Emericella 99.79
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 99.78
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 99.73
d3gata_66 Erythroid transcription factor GATA-1 {Chicken (Ga 99.73
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 92.96
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 92.46
d1neea237 Zinc-binding domain of translation initiation fact 89.09
d1wfka_88 Zinc finger FYVE domain containing protein 19 {Mou 88.35
d1neea237 Zinc-binding domain of translation initiation fact 85.98
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 84.0
d1dcqa2122 Pyk2-associated protein beta ARF-GAP domain {Mouse 81.09
d1k81a_36 Zinc-binding domain of translation initiation fact 80.52
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: Erythroid transcription factor GATA-1
domain: Erythroid transcription factor GATA-1
species: Chicken (Gallus gallus) [TaxId: 9031]

Probab=99.86  E-value=1.2e-22  Score=130.77  Aligned_cols=62  Identities=69%  Similarity=1.249  Sum_probs=55.8

Q ss_pred             ccCcccccCCCCCCcceecCCCCCcccchhhhhHHhhCCCCCchhhhcccCcccccccccccccCCCCCCCC
Q psy15323         60 RLGLCCTNCGTRMTTLWRRNNDGEPVCNACGLYYKLHNVNRPLAMRHLAMRPLAMRKDGIQTRKRKPKKQGG  131 (139)
Q Consensus        60 ~~~~~C~~C~t~~t~~Wr~~~~g~~lCnaCgly~~~~~~~Rp~~~~~~~~~~~~~~~~~i~~~~r~~~~~~~  131 (139)
                      +.+.+|+||+|++||+||++++|.+|||||||||++|++.||+          .++++.|+.+++++..+..
T Consensus         2 r~g~~C~nCgt~~Tp~WRr~~~G~~lCNACGl~~~~~~~~RP~----------~~~~~~i~~r~r~~~~~~~   63 (66)
T d3gata_           2 RAGTVCSNCQTSTTTLWRRSPMGDPVCNACGLYYKLHQVNRPL----------TMRKDGIQTRNRKVSSKGK   63 (66)
T ss_dssp             CTTCCCTTTCCCCCSSEEECTTSCEEEHHHHHHHHHHCSCCCG----------GGCCSSCCCCSCCCCCCCC
T ss_pred             CCCCCCCCCCCCCCcccccCCCCCcccchhHHHHHHhCCcCCc----------cccccccccccCCCCCccc
Confidence            3467899999999999999999999999999999999999998          5788999999998776653
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wfka_ g.50.1.1 (A:) Zinc finger FYVE domain containing protein 19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure