Psyllid ID: psy15328


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70------
MELWSKGWNSGAKGWNSGTKLERGREGRDGRRDAEIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYGDASKYSKD
cccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccccc
ccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHccccEEcHHHHHHHHHHHccccccHHHHHc
melwskgwnsgakgwnsgtklergregrdgrrDAEIQEWYKGflkdcptghlsVEEFKKIYgnffpygdaskyskd
melwskgwnsgakgwnsgtklergregrdgrrDAEIQEWYKGFLKDCPTGHLSVEEFKKIYGnffpygdaskyskd
MELWSKGWNSGAKGWNSGTKLergregrdgrrdAEIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYGDASKYSKD
**********************************EIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYG********
*****************************GRRDAEIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYGD*******
*************GWNSG*************RDAEIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYGDASKYSKD
******************TKLERGREGRDGRRDAEIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYGDASKY**D
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELWSKGWNSGAKGWNSGTKLERGREGRDGRRDAEIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYGDASKYSKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query76 2.2.26 [Sep-21-2011]
P42325 190 Neurocalcin homolog OS=Dr yes N/A 0.565 0.226 0.906 2e-18
B5FZ84 193 Hippocalcin-like protein yes N/A 0.565 0.222 0.837 3e-17
P42324 193 Hippocalcin-like protein yes N/A 0.565 0.222 0.837 3e-17
Q28IM6 193 Hippocalcin-like protein yes N/A 0.789 0.310 0.645 3e-17
Q6DCM9 193 Hippocalcin-like protein N/A N/A 0.565 0.222 0.837 3e-17
P62749 193 Hippocalcin-like protein yes N/A 0.565 0.222 0.813 7e-17
P62748 193 Hippocalcin-like protein yes N/A 0.565 0.222 0.813 7e-17
P37235 193 Hippocalcin-like protein yes N/A 0.565 0.222 0.813 7e-17
B3VSB7 193 Hippocalcin-like protein N/A N/A 0.789 0.310 0.629 7e-17
Q06AT0 193 Hippocalcin-like protein yes N/A 0.789 0.310 0.629 7e-17
>sp|P42325|NCAH_DROME Neurocalcin homolog OS=Drosophila melanogaster GN=Nca PE=1 SV=2 Back     alignment and function desciption
 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/43 (90%), Positives = 43/43 (100%)

Query: 33 DAEIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYGDASKYSK 75
          DAEIQEWYKGFLKDCP+GHLSVEEFKKIYGNFFPYGDASK+++
Sbjct: 24 DAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAE 66




Inhibits the phosphorylation of rhodopsin in a calcium-dependent manner. Probably binds two or three calcium ions.
Drosophila melanogaster (taxid: 7227)
>sp|B5FZ84|HPCL1_TAEGU Hippocalcin-like protein 1 OS=Taeniopygia guttata GN=HPCAL1 PE=2 SV=1 Back     alignment and function description
>sp|P42324|HPCL1_CHICK Hippocalcin-like protein 1 OS=Gallus gallus GN=HPCAL1 PE=1 SV=2 Back     alignment and function description
>sp|Q28IM6|HPCL1_XENTR Hippocalcin-like protein 1 OS=Xenopus tropicalis GN=hpcal1 PE=2 SV=1 Back     alignment and function description
>sp|Q6DCM9|HPCL1_XENLA Hippocalcin-like protein 1 OS=Xenopus laevis GN=hpcal1 PE=2 SV=1 Back     alignment and function description
>sp|P62749|HPCL1_RAT Hippocalcin-like protein 1 OS=Rattus norvegicus GN=Hpcal1 PE=1 SV=2 Back     alignment and function description
>sp|P62748|HPCL1_MOUSE Hippocalcin-like protein 1 OS=Mus musculus GN=Hpcal1 PE=2 SV=2 Back     alignment and function description
>sp|P37235|HPCL1_HUMAN Hippocalcin-like protein 1 OS=Homo sapiens GN=HPCAL1 PE=1 SV=3 Back     alignment and function description
>sp|B3VSB7|HPCL1_SHEEP Hippocalcin-like protein 1 OS=Ovis aries GN=HPCAL1 PE=2 SV=1 Back     alignment and function description
>sp|Q06AT0|HPCL1_PIG Hippocalcin-like protein 1 OS=Sus scrofa GN=HPCAL1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
321453980 192 hypothetical protein DAPPUDRAFT_65663 [D 0.565 0.223 0.906 7e-17
156538104 192 PREDICTED: neurocalcin homolog [Nasonia 0.565 0.223 0.906 7e-17
66513911 192 PREDICTED: neurocalcin homolog [Apis mel 0.565 0.223 0.906 7e-17
357603458 190 hippocalcin [Danaus plexippus] 0.565 0.226 0.906 8e-17
157105260 190 hippocalcin [Aedes aegypti] gi|158285991 0.565 0.226 0.906 8e-17
28574621 190 neurocalcin, isoform A [Drosophila melan 0.565 0.226 0.906 8e-17
195435708 190 GK20284 [Drosophila willistoni] gi|19416 0.565 0.226 0.906 8e-17
194751899 233 GF23611 [Drosophila ananassae] gi|190625 0.565 0.184 0.906 9e-17
195022822 190 GH14390 [Drosophila grimshawi] gi|195129 0.565 0.226 0.906 9e-17
195378472 190 GJ11590 [Drosophila virilis] gi|19415516 0.565 0.226 0.906 9e-17
>gi|321453980|gb|EFX65172.1| hypothetical protein DAPPUDRAFT_65663 [Daphnia pulex] Back     alignment and taxonomy information
 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 39/43 (90%), Positives = 43/43 (100%)

Query: 33 DAEIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYGDASKYSK 75
          DAEIQEWYKGFLKDCP+GHLSVEEFKKIYGNFFPYGDASK+++
Sbjct: 24 DAEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAE 66




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156538104|ref|XP_001608176.1| PREDICTED: neurocalcin homolog [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|66513911|ref|XP_392256.2| PREDICTED: neurocalcin homolog [Apis mellifera] gi|340729152|ref|XP_003402872.1| PREDICTED: neurocalcin homolog [Bombus terrestris] gi|350401556|ref|XP_003486190.1| PREDICTED: neurocalcin homolog [Bombus impatiens] gi|380013863|ref|XP_003690965.1| PREDICTED: neurocalcin homolog [Apis florea] gi|307170868|gb|EFN62979.1| Neurocalcin-like protein [Camponotus floridanus] gi|307196596|gb|EFN78102.1| Neurocalcin-like protein [Harpegnathos saltator] gi|332025022|gb|EGI65209.1| Neurocalcin-like protein [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357603458|gb|EHJ63787.1| hippocalcin [Danaus plexippus] Back     alignment and taxonomy information
>gi|157105260|ref|XP_001648788.1| hippocalcin [Aedes aegypti] gi|158285991|ref|XP_001687984.1| AGAP007247-PC [Anopheles gambiae str. PEST] gi|158285993|ref|XP_001687985.1| AGAP007247-PA [Anopheles gambiae str. PEST] gi|158285995|ref|XP_308553.4| AGAP007247-PB [Anopheles gambiae str. PEST] gi|170043833|ref|XP_001849575.1| hippocalcin [Culex quinquefasciatus] gi|108880132|gb|EAT44357.1| AAEL004269-PA [Aedes aegypti] gi|157020256|gb|EDO64633.1| AGAP007247-PC [Anopheles gambiae str. PEST] gi|157020257|gb|EDO64634.1| AGAP007247-PA [Anopheles gambiae str. PEST] gi|157020258|gb|EAA04175.4| AGAP007247-PB [Anopheles gambiae str. PEST] gi|167867127|gb|EDS30510.1| hippocalcin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|28574621|ref|NP_788543.1| neurocalcin, isoform A [Drosophila melanogaster] gi|281366490|ref|NP_001163478.1| neurocalcin, isoform B [Drosophila melanogaster] gi|194874550|ref|XP_001973419.1| GG16076 [Drosophila erecta] gi|195175122|ref|XP_002028309.1| GL11894 [Drosophila persimilis] gi|195354330|ref|XP_002043651.1| GM19732 [Drosophila sechellia] gi|195479807|ref|XP_002086603.1| GE23224 [Drosophila yakuba] gi|195496057|ref|XP_002095531.1| GE19642 [Drosophila yakuba] gi|195591695|ref|XP_002085574.1| GD14847 [Drosophila simulans] gi|1171668|sp|P42325.2|NCAH_DROME RecName: Full=Neurocalcin homolog; Short=DrosNCa gi|604300|gb|AAA62152.1| DrosNCa [Drosophila melanogaster] gi|7293713|gb|AAF49082.1| neurocalcin, isoform A [Drosophila melanogaster] gi|17946402|gb|AAL49234.1| RE66104p [Drosophila melanogaster] gi|190655202|gb|EDV52445.1| GG16076 [Drosophila erecta] gi|194117481|gb|EDW39524.1| GL11894 [Drosophila persimilis] gi|194127819|gb|EDW49862.1| GM19732 [Drosophila sechellia] gi|194181632|gb|EDW95243.1| GE19642 [Drosophila yakuba] gi|194186393|gb|EDX00005.1| GE23224 [Drosophila yakuba] gi|194197583|gb|EDX11159.1| GD14847 [Drosophila simulans] gi|220948796|gb|ACL86941.1| Nca-PA [synthetic construct] gi|272455251|gb|ACZ94749.1| neurocalcin, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195435708|ref|XP_002065821.1| GK20284 [Drosophila willistoni] gi|194161906|gb|EDW76807.1| GK20284 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|194751899|ref|XP_001958261.1| GF23611 [Drosophila ananassae] gi|190625543|gb|EDV41067.1| GF23611 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195022822|ref|XP_001985646.1| GH14390 [Drosophila grimshawi] gi|195129669|ref|XP_002009278.1| GI11334 [Drosophila mojavensis] gi|193899128|gb|EDV97994.1| GH14390 [Drosophila grimshawi] gi|193920887|gb|EDW19754.1| GI11334 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195378472|ref|XP_002048008.1| GJ11590 [Drosophila virilis] gi|194155166|gb|EDW70350.1| GJ11590 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query76
FB|FBgn0013303 190 Nca "Neurocalcin" [Drosophila 0.552 0.221 0.904 2.8e-18
UNIPROTKB|F1NBP9 190 NCALD "Neurocalcin-delta" [Gal 0.539 0.215 0.853 3.2e-17
UNIPROTKB|P62758 193 NCALD "Neurocalcin-delta" [Gal 0.539 0.212 0.853 3.2e-17
UNIPROTKB|P61602 193 NCALD "Neurocalcin-delta" [Bos 0.539 0.212 0.853 3.2e-17
UNIPROTKB|J9P564 193 NCALD "Uncharacterized protein 0.539 0.212 0.853 3.2e-17
UNIPROTKB|E5RFL978 NCALD "Neurocalcin-delta" [Hom 0.539 0.525 0.853 3.2e-17
UNIPROTKB|E5RGA9 194 NCALD "Neurocalcin-delta" [Hom 0.539 0.211 0.853 3.2e-17
UNIPROTKB|E5RGZ087 NCALD "Neurocalcin-delta" [Hom 0.539 0.471 0.853 3.2e-17
UNIPROTKB|E5RHC8120 NCALD "Neurocalcin-delta" [Hom 0.539 0.341 0.853 3.2e-17
UNIPROTKB|E5RHE8112 NCALD "Neurocalcin-delta" [Hom 0.539 0.366 0.853 3.2e-17
FB|FBgn0013303 Nca "Neurocalcin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 221 (82.9 bits), Expect = 2.8e-18, P = 2.8e-18
 Identities = 38/42 (90%), Positives = 42/42 (100%)

Query:    34 AEIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYGDASKYSK 75
             AEIQEWYKGFLKDCP+GHLSVEEFKKIYGNFFPYGDASK+++
Sbjct:    25 AEIQEWYKGFLKDCPSGHLSVEEFKKIYGNFFPYGDASKFAE 66




GO:0005509 "calcium ion binding" evidence=ISS;NAS;IDA
GO:0042326 "negative regulation of phosphorylation" evidence=NAS
UNIPROTKB|F1NBP9 NCALD "Neurocalcin-delta" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P62758 NCALD "Neurocalcin-delta" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P61602 NCALD "Neurocalcin-delta" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P564 NCALD "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E5RFL9 NCALD "Neurocalcin-delta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E5RGA9 NCALD "Neurocalcin-delta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E5RGZ0 NCALD "Neurocalcin-delta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E5RHC8 NCALD "Neurocalcin-delta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E5RHE8 NCALD "Neurocalcin-delta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q06AT0HPCL1_PIGNo assigned EC number0.62900.78940.3108yesN/A
P42325NCAH_DROMENo assigned EC number0.90690.56570.2263yesN/A
P42324HPCL1_CHICKNo assigned EC number0.83720.56570.2227yesN/A
P29105HPCL1_BOVINNo assigned EC number0.62900.78940.3108yesN/A
Q28IM6HPCL1_XENTRNo assigned EC number0.64510.78940.3108yesN/A
B5FZ84HPCL1_TAEGUNo assigned EC number0.83720.56570.2227yesN/A
Q5RAH1NCALD_PONABNo assigned EC number0.85360.53940.2124yesN/A
P62749HPCL1_RATNo assigned EC number0.81390.56570.2227yesN/A
P62748HPCL1_MOUSENo assigned EC number0.81390.56570.2227yesN/A
P37235HPCL1_HUMANNo assigned EC number0.81390.56570.2227yesN/A
Q09711NCS1_SCHPONo assigned EC number0.60970.53940.2157yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 0.001
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
 Score = 35.0 bits (81), Expect = 0.001
 Identities = 8/36 (22%), Positives = 12/36 (33%), Gaps = 3/36 (8%)

Query: 35 EIQEWYKGFLKDCP--TGHLSVEEFKKIYGNFFPYG 68
          +IQE  + F        G +   E  KI      + 
Sbjct: 18 QIQELKEAFQLFDRDSDGLIDRNELGKIL-RSLGFN 52


Length = 160

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 76
KOG0044|consensus 193 99.73
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.37
KOG0034|consensus 187 96.56
cd0021388 S-100 S-100: S-100 domain, which represents the la 93.6
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 92.85
PTZ00183158 centrin; Provisional 92.36
PTZ00184149 calmodulin; Provisional 91.72
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 91.36
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 91.3
KOG0038|consensus 189 89.64
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 89.57
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 88.4
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 87.93
PF1465866 EF-hand_9: EF-hand domain 87.89
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 87.72
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 86.62
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 86.6
KOG0041|consensus 244 86.02
cd0503088 calgranulins Calgranulins: S-100 domain found in p 84.39
cd0005267 EH Eps15 homology domain; found in proteins implic 84.26
cd0503088 calgranulins Calgranulins: S-100 domain found in p 81.02
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 80.29
>KOG0044|consensus Back     alignment and domain information
Probab=99.73  E-value=2.9e-18  Score=122.66  Aligned_cols=58  Identities=43%  Similarity=0.878  Sum_probs=55.0

Q ss_pred             hhHHHhhhhhcCCCCHHHHHHHHHHHhhhCCCCCCCHHHHHHHHhhcCCCCCCCCccc
Q psy15328         18 GTKLERGREGRDGRRDAEIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYGDASKYSK   75 (76)
Q Consensus        18 ~~~~~~~l~~~T~Fs~~EI~~wYr~FkkecPsG~it~~eFk~iy~~~FP~Gda~~fa~   75 (76)
                      ++...+++.+.|+|+++||++|||+|+++||+|.++.++|+.||+++||.|+++.|++
T Consensus        10 ~~~~~e~l~~~t~f~~~ei~~~Yr~Fk~~cP~G~~~~~~F~~i~~~~fp~gd~~~y~~   67 (193)
T KOG0044|consen   10 QPESLEQLVQQTKFSKKEIQQWYRGFKNECPSGRLTLEEFREIYASFFPDGDASKYAE   67 (193)
T ss_pred             CcHHHHHHHHhcCCCHHHHHHHHHHhcccCCCCccCHHHHHHHHHHHCCCCCHHHHHH
Confidence            4667889999999999999999999999999999999999999999999999999875



>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
1bjf_A 193 Crystal Structure Of Recombinant Bovine Neurocalcin 9e-18
2l2e_A 190 Solution Nmr Structure Of Myristoylated Ncs1p In Ap 1e-11
1g8i_A 190 Crystal Structure Of Human Frequenin (Neuronal Calc 7e-11
1fpw_A 190 Structure Of Yeast Frequenin Length = 190 9e-10
1s1e_A 224 Crystal Structure Of Kv Channel-Interacting Protein 3e-08
2i2r_E 180 Crystal Structure Of The Kchip1KV4.3 T1 COMPLEX Len 8e-08
2nz0_A 180 Crystal Structure Of Potassium Channel Kv4.3 In Com 8e-08
2d8n_A 207 Crystal Structure Of Human Recoverin At 2.2 A Resol 1e-07
1la3_A 201 Solution Structure Of Recoverin Mutant, E85q Length 2e-07
1jsa_A 201 Myristoylated Recoverin With Two Calciums Bound, Nm 2e-07
2i94_A 202 Nmr Structure Of Recoverin Bound To Rhodopsin Kinas 2e-07
1omv_A 201 Non-Myristoylated Bovine Recoverin (E85q Mutant) Wi 2e-07
2het_A 189 Non-Myristoylated Bovine Recoverin (Truncated At C- 2e-07
1omr_A 201 Non-Myristoylated Wild-Type Bovine Recoverin With C 2e-07
3dd4_A 229 Structural Basis Of Kchip4a Modulation Of Kv4.3 Slo 2e-07
2jul_A 256 Nmr Structure Of Dream Length = 256 2e-07
1s6c_A 183 Crystal Structure Of The Complex Between Kchip1 And 7e-07
1jba_A 204 Unmyristoylated Gcap-2 With Three Calcium Ions Boun 2e-04
>pdb|1BJF|A Chain A, Crystal Structure Of Recombinant Bovine Neurocalcin Delta At 2.4 Angstroms Length = 193 Back     alignment and structure

Iteration: 1

Score = 85.1 bits (209), Expect = 9e-18, Method: Compositional matrix adjust. Identities = 35/41 (85%), Positives = 41/41 (100%) Query: 35 EIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYGDASKYSK 75 EIQEWYKGFL+DCP+GHLS+EEFKKIYGNFFPYGDASK+++ Sbjct: 26 EIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAE 66
>pdb|2L2E|A Chain A, Solution Nmr Structure Of Myristoylated Ncs1p In Apo Form Length = 190 Back     alignment and structure
>pdb|1G8I|A Chain A, Crystal Structure Of Human Frequenin (Neuronal Calcium Sensor 1) Length = 190 Back     alignment and structure
>pdb|1FPW|A Chain A, Structure Of Yeast Frequenin Length = 190 Back     alignment and structure
>pdb|1S1E|A Chain A, Crystal Structure Of Kv Channel-Interacting Protein 1 (Kchip-1) Length = 224 Back     alignment and structure
>pdb|2I2R|E Chain E, Crystal Structure Of The Kchip1KV4.3 T1 COMPLEX Length = 180 Back     alignment and structure
>pdb|2NZ0|A Chain A, Crystal Structure Of Potassium Channel Kv4.3 In Complex With Its Regulatory Subunit Kchip1 (Casp Target) Length = 180 Back     alignment and structure
>pdb|2D8N|A Chain A, Crystal Structure Of Human Recoverin At 2.2 A Resolution Length = 207 Back     alignment and structure
>pdb|1LA3|A Chain A, Solution Structure Of Recoverin Mutant, E85q Length = 201 Back     alignment and structure
>pdb|1JSA|A Chain A, Myristoylated Recoverin With Two Calciums Bound, Nmr, 24 Structures Length = 201 Back     alignment and structure
>pdb|2I94|A Chain A, Nmr Structure Of Recoverin Bound To Rhodopsin Kinase Length = 202 Back     alignment and structure
>pdb|1OMV|A Chain A, Non-Myristoylated Bovine Recoverin (E85q Mutant) With Calcium Bound To Ef-Hand 3 Length = 201 Back     alignment and structure
>pdb|2HET|A Chain A, Non-Myristoylated Bovine Recoverin (Truncated At C-Terminus) With Calcium Bound To Ef-Hand 3 Length = 189 Back     alignment and structure
>pdb|1OMR|A Chain A, Non-Myristoylated Wild-Type Bovine Recoverin With Calcium Bound To Ef- Hand 3 Length = 201 Back     alignment and structure
>pdb|3DD4|A Chain A, Structural Basis Of Kchip4a Modulation Of Kv4.3 Slow Inactivation Length = 229 Back     alignment and structure
>pdb|2JUL|A Chain A, Nmr Structure Of Dream Length = 256 Back     alignment and structure
>pdb|1S6C|A Chain A, Crystal Structure Of The Complex Between Kchip1 And Kv4.2 N1-30 Length = 183 Back     alignment and structure
>pdb|1JBA|A Chain A, Unmyristoylated Gcap-2 With Three Calcium Ions Bound Length = 204 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query76
2ggz_A 211 Guanylyl cyclase-activating protein 3; EF hand, gu 1e-14
2r2i_A 198 Guanylyl cyclase-activating protein 1; EF hand, GC 4e-14
3dd4_A 229 KV channel-interacting protein 4; EF-hands protein 8e-14
1fpw_A 190 Yeast frequenin, calcium-binding protein NCS-1; EF 1e-13
1bjf_A 193 Neurocalcin delta; calcium-binding, myristoylation 2e-13
2d8n_A 207 Recoverin; structural genomics, NPPSFA, national p 2e-13
2l2e_A 190 Calcium-binding protein NCS-1; NCS1P, myristoylate 5e-13
1g8i_A 190 Frequenin, neuronal calcium sensor 1; calcium bind 1e-12
1s6c_A 183 KV4 potassium channel-interacting protein kchip1B; 3e-12
1jba_A 204 GCAP-2, protein (guanylate cyclase activating prot 5e-12
1s1e_A 224 KV channel interacting protein 1; kchip, calcium-b 5e-11
2jul_A 256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 1e-10
1dgu_A 183 Calcium-saturated CIB; helical, EF-hands, blood cl 1e-07
2ehb_A 207 Calcineurin B-like protein 4; protein complex, Ca( 4e-07
2zfd_A 226 Calcineurin B-like protein 2; calcium binding prot 2e-06
2l4h_A 214 Calcium and integrin-binding protein 1; metal bind 7e-06
2ct9_A 208 Calcium-binding protein P22; EF-hand, metal bindin 2e-05
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
 Score = 64.4 bits (157), Expect = 1e-14
 Identities = 12/42 (28%), Positives = 21/42 (50%)

Query: 35 EIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYGDASKYSKD 76
          E   WY+ F+ + P+G  ++ EFK + G       A+K+   
Sbjct: 20 ETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQ 61


>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 99.62
3dd4_A 229 KV channel-interacting protein 4; EF-hands protein 98.45
2jul_A 256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.09
1s1e_A 224 KV channel interacting protein 1; kchip, calcium-b 98.08
1bjf_A 193 Neurocalcin delta; calcium-binding, myristoylation 98.08
1g8i_A 190 Frequenin, neuronal calcium sensor 1; calcium bind 98.07
1fpw_A 190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.02
1s6c_A 183 KV4 potassium channel-interacting protein kchip1B; 97.76
2l2e_A 190 Calcium-binding protein NCS-1; NCS1P, myristoylate 97.6
2l4h_A 214 Calcium and integrin-binding protein 1; metal bind 97.53
1jba_A 204 GCAP-2, protein (guanylate cyclase activating prot 97.51
2d8n_A 207 Recoverin; structural genomics, NPPSFA, national p 97.35
1dgu_A 183 Calcium-saturated CIB; helical, EF-hands, blood cl 97.06
2r2i_A 198 Guanylyl cyclase-activating protein 1; EF hand, GC 96.78
2ehb_A 207 Calcineurin B-like protein 4; protein complex, Ca( 96.72
2ggz_A 211 Guanylyl cyclase-activating protein 3; EF hand, gu 96.65
2zfd_A 226 Calcineurin B-like protein 2; calcium binding prot 96.42
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 96.18
2bec_A 202 Calcineurin B homologous protein 2; calcineurin-ho 96.02
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 95.76
2lhi_A 176 Calmodulin, serine/threonine-protein phosphatase c 95.74
1wdc_C 156 Scallop myosin; calcium binding protein, muscle pr 95.71
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 95.58
1dtl_A 161 Cardiac troponin C; helix-turn-helix, structural p 95.57
2ct9_A 208 Calcium-binding protein P22; EF-hand, metal bindin 95.4
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 95.26
2ovk_C 159 Myosin catalytic light chain LC-1, mantle muscle, 95.09
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 95.05
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 95.04
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 94.95
2jnf_A 158 Troponin C; stretch activated muscle contraction, 94.92
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 94.79
3ox6_A 153 Calcium-binding protein 1; EF-hand, calcium-sensor 94.71
3fwb_A161 Cell division control protein 31; gene gating, com 94.59
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 94.3
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 94.23
1avs_A90 Troponin C; muscle contraction, calcium-activated, 94.14
1qv0_A 195 Obelin, OBL; photoprotein, bioluminescence, atomic 94.12
2lv7_A100 Calcium-binding protein 7; metal binding protein; 94.0
1exr_A148 Calmodulin; high resolution, disorder, metal trans 93.89
2f2o_A 179 Calmodulin fused with calmodulin-binding domain of 93.82
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 93.75
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 93.74
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 93.74
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 93.64
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 93.61
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 93.59
1top_A 162 Troponin C; contractIle system protein; 1.78A {Gal 93.58
3a8r_A 179 Putative uncharacterized protein; EF-hand, membran 93.29
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 93.29
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 93.25
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 93.23
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 93.1
3cs1_A 219 Flagellar calcium-binding protein; myristoylated, 93.01
2hpk_A 208 Photoprotein berovin; structural genomics, PSI, pr 92.98
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 92.9
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 92.74
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 92.65
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 92.27
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 92.26
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 92.23
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 92.19
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 92.1
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 91.98
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 91.98
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 91.91
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 91.76
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 91.71
1c07_A95 Protein (epidermal growth factor receptor pathway 91.51
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 91.5
1q80_A 174 SCP, sarcoplasmic calcium-binding protein; all-alp 91.33
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 91.26
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 90.89
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 90.87
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 90.78
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 90.73
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 90.63
3sjs_A 220 URE3-BP sequence specific DNA binding protein; EF- 90.63
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 90.57
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 90.48
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 90.44
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 90.42
3i5g_C 159 Myosin catalytic light chain LC-1, mantle muscle; 90.37
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 90.06
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 90.01
2f33_A 263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 89.94
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 89.88
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 89.88
1s6i_A 188 CDPK, calcium-dependent protein kinase SK5; EF-han 89.7
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 89.56
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 89.53
3khe_A 191 Calmodulin-like domain protein kinase isoform 3; c 89.28
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 89.19
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 89.14
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 89.04
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 89.02
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 88.98
2hps_A 186 Coelenterazine-binding protein with bound coelent; 88.97
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 88.93
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 88.76
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 88.7
3ll8_B 155 Calcineurin subunit B type 1; protein-peptide dock 88.64
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 88.4
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 87.94
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 87.82
1ij5_A 323 Plasmodial specific LAV1-2 protein; fourty kDa cal 87.65
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 87.61
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 87.59
1nya_A 176 Calerythrin; EF-hand, metal binding protein; NMR { 87.43
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 87.38
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 87.38
2hps_A186 Coelenterazine-binding protein with bound coelent; 87.34
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 87.3
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 87.3
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 87.26
3li6_A66 Calcium-binding protein; calcium signaling protein 87.02
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 87.0
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 86.97
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 86.96
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 86.92
2lvv_A 226 Flagellar calcium-binding protein TB-24; EF-hand, 86.9
3akb_A166 Putative calcium binding protein; EF-hand, metal b 86.89
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 86.86
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 86.84
2ccm_A 191 Calexcitin; EF hand, calcium, signaling protein; 1 86.82
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 86.82
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 86.8
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 86.78
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 86.58
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 86.41
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 86.21
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 86.16
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 86.0
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 85.86
1uhk_A 191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 85.69
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 85.61
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 85.47
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 85.28
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 85.18
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 85.15
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 85.14
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 85.1
1avs_A90 Troponin C; muscle contraction, calcium-activated, 85.06
3e3r_A 204 Calcyphosin, calcyphosine; human calcyphosine, EF- 85.03
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 84.98
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 84.78
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 84.73
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 84.67
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 84.62
2sas_A 185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 84.43
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 84.35
2dii_A61 TFIIH basal transcription factor complex P62 subun 84.29
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 84.16
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 84.08
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 84.08
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 83.99
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 83.96
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 83.84
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 83.82
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 83.81
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 83.54
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 83.39
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 83.32
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 83.17
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 82.94
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 82.92
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 82.72
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 82.67
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 82.49
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 82.35
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 82.3
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 82.23
2lv7_A100 Calcium-binding protein 7; metal binding protein; 82.1
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 81.68
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 81.67
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 81.57
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 81.53
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 81.37
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 81.17
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 80.76
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 80.49
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 80.42
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 80.39
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 80.26
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 80.21
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 80.1
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
Probab=99.62  E-value=2.9e-17  Score=108.69  Aligned_cols=60  Identities=10%  Similarity=0.001  Sum_probs=55.1

Q ss_pred             cchhHHHhhhhhcCCCCHHHHHHHHHHH-----hhhCCCCCCCHHHHHHHHhhcCCCC-CCCCccc
Q psy15328         16 NSGTKLERGREGRDGRRDAEIQEWYKGF-----LKDCPTGHLSVEEFKKIYGNFFPYG-DASKYSK   75 (76)
Q Consensus        16 ~~~~~~~~~l~~~T~Fs~~EI~~wYr~F-----kkecPsG~it~~eFk~iy~~~FP~G-da~~fa~   75 (76)
                      .-.+.-.++|.+.|+||++||+.||++|     +++||+|.|+.++|+.||++|||.| +++.||+
T Consensus         7 ~lspe~l~~L~~~t~fs~~elk~~y~~F~~g~~~k~cp~G~i~~e~F~~i~~~ffp~~~~p~~~~~   72 (118)
T 1tuz_A            7 LISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSL   72 (118)
T ss_dssp             CSCHHHHHHHHHHHHHCCCCHHHHHHHHHTSGGGGGEETTEECHHHHHHHHHHHTTCSSCCHHHHH
T ss_pred             cCCHHHHHHHHHHcccCHHHHHHHHHHHccccccccCCCCCCCHHHHHHHHHHhCcCCCCHHHHHH
Confidence            3467778899999999999999999999     6899999999999999999999998 9988875



>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2dii_A TFIIH basal transcription factor complex P62 subunit; BTF2-P62, general transcription factor IIH polypeptide 1, nuclear protein; NMR {Homo sapiens} SCOP: a.240.1.1 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 76
d1jbaa_ 189 a.39.1.5 (A:) Guanylate cyclase activating protein 1e-09
d1fpwa_ 190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 3e-09
d1omra_ 201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 3e-09
d1g8ia_ 187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 5e-09
d1s6ca_ 178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 5e-09
d1bjfa_ 181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 3e-08
d1tuza_118 a.39.1.7 (A:) Diacylglycerol kinase alpha, N-termi 5e-08
d1xo5a_ 180 a.39.1.5 (A:) Calcium- and integrin-binding protei 3e-04
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Guanylate cyclase activating protein 2, GCAP-2
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 49.5 bits (117), Expect = 1e-09
 Identities = 17/43 (39%), Positives = 29/43 (67%), Gaps = 1/43 (2%)

Query: 34 AEIQEWYKGFLKDCPTGHLSVEEFKKIYGNFFPYGDASKYSKD 76
          A++QEWYK FL++CP+G L + EFK+ +       +A++Y + 
Sbjct: 21 AQLQEWYKKFLEECPSGTLFMHEFKRFFK-VPDNEEATQYVEA 62


>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query76
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 99.34
d1omra_ 201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.2
d1fpwa_ 190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.17
d1s6ca_ 178 Kchip1, Kv4 potassium channel-interacting protein 99.13
d1jbaa_ 189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.94
d1bjfa_ 181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.94
d1g8ia_ 187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.91
d1xo5a_ 180 Calcium- and integrin-binding protein, CIB {Human 98.04
d2zfda1 183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.0
d1auib_ 165 Calcineurin regulatory subunit (B-chain) {Human (H 97.56
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 96.61
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 96.36
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 96.17
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.0
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 95.88
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 95.84
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 95.81
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 95.56
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.13
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 94.49
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 94.46
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 93.97
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 93.54
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 92.74
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 92.56
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 92.56
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 92.41
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 91.96
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 91.86
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 91.77
d2sasa_ 185 Sarcoplasmic calcium-binding protein {Amphioxus (B 91.6
d1topa_ 162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 91.48
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 91.46
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 91.26
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 91.21
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 91.03
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 90.98
d1nyaa_ 176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 90.64
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 90.46
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 90.3
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 90.28
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 90.27
d1qv0a_ 189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 90.26
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 89.91
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 89.87
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 89.54
d1wdcc_ 152 Myosin Regulatory Chain {Bay scallop (Aequipecten 89.29
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 88.61
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 88.43
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 88.34
d1s6ia_ 182 Calcium-dependent protein kinase sk5 CLD {Soybean 88.13
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 87.87
d1juoa_ 172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 87.65
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 87.51
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 87.5
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 87.25
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 87.03
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 86.89
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 86.85
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 86.67
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 86.61
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 86.28
d2scpa_ 174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 86.25
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 86.07
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 85.77
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 85.44
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 84.99
d1alva_ 173 Calpain small (regulatory) subunit (domain VI) {Pi 84.7
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 84.62
d1hqva_ 181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 84.56
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 84.31
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 84.27
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 84.25
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 84.11
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 84.0
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 83.04
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 82.73
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 82.66
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 82.56
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 82.26
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 82.17
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 81.77
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 81.71
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 81.15
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 80.53
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 80.45
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 80.24
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 80.13
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: EF-hand modules in multidomain proteins
domain: Diacylglycerol kinase alpha, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.34  E-value=3.9e-14  Score=91.00  Aligned_cols=60  Identities=10%  Similarity=0.009  Sum_probs=52.1

Q ss_pred             ccchhHHHhhhhhcCCCCHHHHHHHHHHHh-----hhCCCCCCCHHHHHHHHhhcCCCCCC-CCcc
Q psy15328         15 WNSGTKLERGREGRDGRRDAEIQEWYKGFL-----KDCPTGHLSVEEFKKIYGNFFPYGDA-SKYS   74 (76)
Q Consensus        15 ~~~~~~~~~~l~~~T~Fs~~EI~~wYr~Fk-----kecPsG~it~~eFk~iy~~~FP~Gda-~~fa   74 (76)
                      +---|.-.++|...|+||++||+.||++|+     +.||+|.|+.++|+.||..+||.|++ +.|+
T Consensus         6 s~l~p~~l~~L~~~T~fs~~ei~~l~~~Fk~~~~~~~~p~g~i~~~~F~~~~~~~f~~~~~~~~l~   71 (118)
T d1tuza_           6 GLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLS   71 (118)
T ss_dssp             SCSCHHHHHHHHHHHHHCCCCHHHHHHHHHTSGGGGGEETTEECHHHHHHHHHHHTTCSSCCHHHH
T ss_pred             CCCCHHHHHHHHHHcCCCHHHHHHHHHHHhccccccCCcccccCHHHHHHHHHHhCCCCCchHHHH
Confidence            334566778999999999999999999996     46999999999999999999999975 4554



>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure