Psyllid ID: psy15394

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520---
MEDVSSGVKTPQTTLSKKRKAETSPSAWPEAMKVEIEDAVKRVRFSDDDSLHADPTGTSSSQGLSIAEFVEAVRSKGRSGLCLEYEGFKIKPPDGSFEVAKRRENLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYINANFVDGYKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISAKPDLSGFQTSCATSRPGGHLGRAPAGAPNHRPLLGRDRAAALSMLEFLAKARYTQASLLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISAKPDLSGFQTSDSDTE
cccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccHHHHHHHHHHcccccHHHHHcccccccccccHHHHcccccccccccccccccccccEEEEccccccccccccccccccccccccEEEcccccccccHHHHHHHHHccccEEEEEcccccccccccccccccccccEEEEEEEEEEEEEEEEcccEEEEEEEEEEcccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEcccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccc
ccHHHHccccccccccccHHHcccccccccccccccccHHHHcccccccHccccccccccccHHHHHHHHHHcccccccccHHHHHccccccccccccccccHHHHHHcccccccccHHHEEEcccccccccccEEEEEEEEEccEEEEEEEEccccHHHHHHHHHHHHHccccEEEEccccEEccEEcccccccccccccEEEccEEEEEEcccccccEEEEEEEEEEcccccEEEEEEEEEccccccccccccHHHHHHHHHHHHccHHcccccccccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHcEEcHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccEEEHHHHHcccccccEccccccccccccccccccccccccccccHHHHHHHHHHHHHcHHHcccccccHccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHcEEcHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHcccccccccc
medvssgvktpqttlskkrkaetspsawpeAMKVEIEDAVKRvrfsdddslhadptgtsssqglSIAEFVEAVRSkgrsglcleyegfkikppdgsfEVAKRRENLFKNRYSDVLAYDHTRVLlsqqddvpgsdyinanfvdgykqknafistqgpmqntVEDFWRMVWEQQTLVIIMTTRVIERGrnkcaqywpgtegtkmthgdflvttecvtsspdyvlssltlcntkTLETRMVAHYQFTAwldygvpesALSMLEFLAKARHTQAALLADlgdtwaghprgppiivhcsagigrtgtlCTLDICISrledsgtvdvrgtVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGlisakpdlsgfqtscatsrpgghlgrapagapnhrpllgRDRAAALSMLEFLAKARYTQASLLADlgdtwaghprgppiivhcsagigrtgtlCTLDICISrledsgtvdvrgtVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGlisakpdlsgfqtsdsdte
medvssgvktpqttlskkrkaetspsawpeamkVEIEDAVKRVRFSDDDSLhadptgtsssqglsIAEFVEAVRSKGRSGLCLeyegfkikppdgsfEVAKRRENLFKNRYSDVLAYDHTRVLlsqqddvpgSDYINANFVDGYKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISrledsgtvdvrgtvkrirsqrahsiqmrDQYIFCHLALIEYALSRGLISAKPDLSGFQTSCATSRPGGHLGRAPAGAPNHRPLLGRDRAAALSMLEFLAKARYTQASLLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISrledsgtvdvrgtvkrirsqrahsiqmrDQYIFCHLALIEYALSRGLISakpdlsgfqtsdsdte
MEDVSSGVKTPQTTLSKKRKAETSPSAWPEAMKVEIEDAVKRVRFSDDDSLHADPTGTSSSQGLSIAEFVEAVRSKGRSGLCLEYEGFKIKPPDGSFEVAKRRENLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYINANFVDGYKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISAKPDLSGFQTSCATSRPGGHLGRAPAGAPNHRPLLGRDRAAALSMLEFLAKARYTQASLLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISAKPDLSGFQTSDSDTE
*****************************************************************IAEFVEAVRSKGRSGLCLEYEGFKIKPPDGSFEVAKRRENLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYINANFVDGYKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISAKP***********************************RAAALSMLEFLAKARYTQASLLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLIS****************
***************************************VKRVRFSDDDS*************LSIAEFVEAVRSKGRSGLCLEYEGFKIKPPD**F****RRENLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYINANFVDGYKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALL***G***AGHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISAKPDLSGFQTSCATSRPGGHLGRAPAGAPNHRPLLGRDRAAALSMLEFLAKAR***************GHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISA***************
****************************PEAMKVEIEDAVKRVRFSD***************GLSIAEFVEAVRSKGRSGLCLEYEGFKIKPPDGSFEVAKRRENLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYINANFVDGYKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISAKPDLSGFQTSCATSRPGGHLGRAPAGAPNHRPLLGRDRAAALSMLEFLAKARYTQASLLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISAKPDL***********
*************************SAWPEAMKVEIEDAVKRVRFSDDDSLHADPTGTSSSQGLSIAEFVEAVRSKGRSGLCLEYEGFKIKPPDGSFEVAKRRENLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYINANFVDGYKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISAKPDLSGFQTSCATSRPGGHLGRAPAGAPNHRPLLGRDRAAALSMLEFLAKARYTQASLLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISAKPDLSGFQT******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDVSSGVKTPQTTLSKKRKAETSPSAWPEAMKVEIEDAVKRVRFSDDDSLHADPTGTSSSQGLSIAEFVEAVRSKGRSGLCLEYEGFKIKPPDGSFEVAKRRENLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYINANFVDGYKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISAKPDLSGFQTSCATSRPGGHLGRAPAGAPNHRPLLGRDRAAALSMLEFLAKARYTQASLLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISAKPDLSGFQTSDSDTE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query523 2.2.26 [Sep-21-2011]
P43378593 Tyrosine-protein phosphat yes N/A 0.627 0.553 0.445 3e-81
Q641Z2593 Tyrosine-protein phosphat yes N/A 0.609 0.537 0.454 4e-80
O35239593 Tyrosine-protein phosphat yes N/A 0.592 0.522 0.460 7e-80
A2A8L5 1898 Receptor-type tyrosine-pr no N/A 0.504 0.139 0.433 6e-62
A7MBJ4 1898 Receptor-type tyrosine-pr no N/A 0.504 0.139 0.429 1e-61
P10586 1907 Receptor-type tyrosine-pr no N/A 0.502 0.137 0.434 2e-61
Q64604 1898 Receptor-type tyrosine-pr no N/A 0.504 0.139 0.429 2e-61
A4IFW2 1909 Receptor-type tyrosine-pr no N/A 0.521 0.143 0.421 1e-60
P23468 1912 Receptor-type tyrosine-pr no N/A 0.512 0.140 0.404 3e-60
B0V2N1 1907 Receptor-type tyrosine-pr no N/A 0.606 0.166 0.378 4e-60
>sp|P43378|PTN9_HUMAN Tyrosine-protein phosphatase non-receptor type 9 OS=Homo sapiens GN=PTPN9 PE=1 SV=1 Back     alignment and function desciption
 Score =  303 bits (775), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 146/328 (44%), Positives = 212/328 (64%)

Query: 43  VRFSDDDSLHADPTGTSSSQGLSIAEFVEAVRSKGRSGLCLEYEGFKIKPPDGSFEVAKR 102
           + FS   +L  D         ++I E V+ V ++ + G+  EYE  + + P G+F  +  
Sbjct: 265 ILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMS 324

Query: 103 RENLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYINANFVDGYKQKNAFISTQGPMQNTVE 162
             NL KNRY DV   D TRV L+++     +DYINA+F+DGYKQKNA+I TQGP++NT  
Sbjct: 325 PGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYR 384

Query: 163 DFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVL 222
           DFW MVWEQ+ LVI+MTTR  E GR KC QYWP  + +++  G   VT   V +   Y  
Sbjct: 385 DFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKK 444

Query: 223 SSLTLCNTKTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAG 282
           ++L + NT+  + R V H+QF +W DYGVP SA S+++FL   R+ Q+  ++++G    G
Sbjct: 445 TTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSKG 504

Query: 283 HPRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQY 342
               PPI+VHCSAGIGRTGT C+LDIC+++LE+ GT++V  TV R+R+QRA SIQ  +QY
Sbjct: 505 QCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQY 564

Query: 343 IFCHLALIEYALSRGLISAKPDLSGFQT 370
            FC+ A++E+A   G++S+  +L   ++
Sbjct: 565 YFCYKAILEFAEKEGMVSSGQNLLAVES 592
Protein-tyrosine phosphatase that could participate in the transfer of hydrophobic ligands or in functions of the Golgi apparatus.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q641Z2|PTN9_RAT Tyrosine-protein phosphatase non-receptor type 9 OS=Rattus norvegicus GN=Ptpn9 PE=2 SV=1 Back     alignment and function description
>sp|O35239|PTN9_MOUSE Tyrosine-protein phosphatase non-receptor type 9 OS=Mus musculus GN=Ptpn9 PE=2 SV=2 Back     alignment and function description
>sp|A2A8L5|PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus GN=Ptprf PE=1 SV=1 Back     alignment and function description
>sp|A7MBJ4|PTPRF_BOVIN Receptor-type tyrosine-protein phosphatase F OS=Bos taurus GN=PTPRF PE=2 SV=1 Back     alignment and function description
>sp|P10586|PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens GN=PTPRF PE=1 SV=2 Back     alignment and function description
>sp|Q64604|PTPRF_RAT Receptor-type tyrosine-protein phosphatase F OS=Rattus norvegicus GN=Ptprf PE=2 SV=1 Back     alignment and function description
>sp|A4IFW2|PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio GN=ptprf PE=2 SV=1 Back     alignment and function description
>sp|P23468|PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens GN=PTPRD PE=1 SV=2 Back     alignment and function description
>sp|B0V2N1|PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus GN=Ptprs PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query523
270001368 626 hypothetical protein TcasGA2_TC000182 [T 0.606 0.506 0.632 1e-120
332029240 663 Tyrosine-protein phosphatase non-recepto 0.600 0.473 0.647 1e-120
307212646 660 Tyrosine-protein phosphatase non-recepto 0.600 0.475 0.650 1e-120
345479465 658 PREDICTED: tyrosine-protein phosphatase 0.600 0.477 0.638 1e-120
322802958526 hypothetical protein SINV_02788 [Solenop 0.600 0.596 0.647 1e-119
350414191 658 PREDICTED: tyrosine-protein phosphatase 0.600 0.477 0.644 1e-119
110758020 660 PREDICTED: tyrosine-protein phosphatase 0.600 0.475 0.644 1e-119
380023057 659 PREDICTED: tyrosine-protein phosphatase 0.600 0.476 0.644 1e-119
340717815 658 PREDICTED: tyrosine-protein phosphatase 0.600 0.477 0.641 1e-119
383855968 659 PREDICTED: tyrosine-protein phosphatase 0.600 0.476 0.641 1e-119
>gi|270001368|gb|EEZ97815.1| hypothetical protein TcasGA2_TC000182 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  439 bits (1130), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 205/324 (63%), Positives = 250/324 (77%), Gaps = 7/324 (2%)

Query: 45  FSDDDSLHADPTGTSSSQGLSIAEFVEAVRSKGRSGLCLEYEGFKIKPPDGSFEVAKRRE 104
           FSDDDSLH D         L++ + V+ VR +GRSGL  EY   + +PPDG+F VAK + 
Sbjct: 301 FSDDDSLHGD------GAALTMPQLVDYVRDRGRSGLMQEYAEIRSRPPDGTFNVAKMKN 354

Query: 105 NLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYINANFVDGYKQKNAFISTQGPMQNTVEDF 164
           NL KNRY+DVL YDH+RV+LS+ D    SDYI+ANFVDGYKQKNAFI+TQGP+  T  DF
Sbjct: 355 NLPKNRYTDVLCYDHSRVILSEIDCDKDSDYIHANFVDGYKQKNAFINTQGPLPKTTPDF 414

Query: 165 WRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSS 224
           WRM+WEQ +LVI+MTTRV+ERGR KC QYW    G++ ++G F V T  V + PDY +++
Sbjct: 415 WRMIWEQHSLVIVMTTRVMERGRPKCHQYWETEVGSEASYGQFTVKTVAVETDPDYTVTT 474

Query: 225 LTLCNTKTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHP 284
           + L N KT E+R V+H+QFT+W DYGVP SA +MLEFL + R  Q A++  LGDTWAGHP
Sbjct: 475 INLINNKTDESREVSHWQFTSWPDYGVPRSAKAMLEFLERVRRKQNAMVVALGDTWAGHP 534

Query: 285 RGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIF 344
           RGPPI+VHCSAGIGRTGT CTLDICISRLED GT D+RGTV+RIRSQRA+SIQM DQYIF
Sbjct: 535 RGPPIVVHCSAGIGRTGTFCTLDICISRLEDLGTADIRGTVERIRSQRAYSIQMPDQYIF 594

Query: 345 CHLALIEYALSRGLISAKPDLSGF 368
           CHLALIEYAL +G + +  DL+GF
Sbjct: 595 CHLALIEYALMKGHLQSA-DLAGF 617

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332029240|gb|EGI69223.1| Tyrosine-protein phosphatase non-receptor type 9 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307212646|gb|EFN88349.1| Tyrosine-protein phosphatase non-receptor type 9 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345479465|ref|XP_001606932.2| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|322802958|gb|EFZ23095.1| hypothetical protein SINV_02788 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350414191|ref|XP_003490234.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|110758020|ref|XP_394701.3| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380023057|ref|XP_003695346.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like [Apis florea] Back     alignment and taxonomy information
>gi|340717815|ref|XP_003397371.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383855968|ref|XP_003703482.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query523
FB|FBgn0028341827 l(1)G0232 "lethal (1) G0232" [ 0.608 0.384 0.620 7.5e-105
ZFIN|ZDB-GENE-090313-52754 ptpn9b "protein tyrosine phosp 0.567 0.393 0.535 5.6e-84
ZFIN|ZDB-GENE-101027-1571 ptpn9a "protein tyrosine phosp 0.579 0.530 0.513 1.7e-82
UNIPROTKB|P43378593 PTPN9 "Tyrosine-protein phosph 0.617 0.544 0.452 1.5e-74
RGD|628726593 Ptpn9 "protein tyrosine phosph 0.606 0.534 0.457 1.7e-73
UNIPROTKB|E2RE80 1897 PTPRF "Uncharacterized protein 0.608 0.167 0.397 2.2e-73
UNIPROTKB|E2RE81 1906 PTPRF "Uncharacterized protein 0.608 0.166 0.397 2.3e-73
MGI|MGI:1928376593 Ptpn9 "protein tyrosine phosph 0.588 0.519 0.466 2.8e-73
UNIPROTKB|F1SJ71583 PTPN9 "Uncharacterized protein 0.617 0.554 0.445 4.6e-73
UNIPROTKB|F1N6W1625 PTPN9 "Uncharacterized protein 0.617 0.516 0.445 4.6e-73
FB|FBgn0028341 l(1)G0232 "lethal (1) G0232" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1038 (370.5 bits), Expect = 7.5e-105, P = 7.5e-105
 Identities = 201/324 (62%), Positives = 243/324 (75%)

Query:    45 FSDDDSLHADPTGTSSSQGLSIAEFVEAVRSKGRSGLCLEYEGFKIKPPDGSFEVAKRRE 104
             FSDDDSL A   G        I + V+ V+ +GR GL  EY   + + P+G+F  A+ R 
Sbjct:   502 FSDDDSL-AGQEGDPKP----IDQIVQMVKQRGRHGLIKEYADIRNRAPEGTFLHARMRA 556

Query:   105 NLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYINANFVDGYKQKNAFISTQGPMQNTVEDF 164
             NL KNRY+DVL YDH+RV+L+ +D    SDYINANFVDGYKQKNA+ISTQGP+  T +DF
Sbjct:   557 NLTKNRYTDVLCYDHSRVVLAHEDGDEPSDYINANFVDGYKQKNAYISTQGPLPKTSQDF 616

Query:   165 WRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSS 224
             WRM+WEQ  LVI+MTTRV+ERGR KC QYW  TE + +  GD+ V T  V  + DY+++S
Sbjct:   617 WRMIWEQHCLVIVMTTRVMERGRVKCGQYWEPTEESSLEFGDYHVRTISVECNEDYMVAS 676

Query:   225 LTLCNTKTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHP 284
             L L N KT E R V+H+QFT+W DYGVP SA++ML FL K R  QA L+  LGDTWAGHP
Sbjct:   677 LELRNIKTDEIRNVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQAQLVQGLGDTWAGHP 736

Query:   285 RGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIF 344
             RGPPI+VHCSAGIGRTGT  TLDICISRLED GT D+RGTV++IRSQRA+SIQM DQY+F
Sbjct:   737 RGPPIVVHCSAGIGRTGTFITLDICISRLEDVGTADIRGTVEKIRSQRAYSIQMPDQYVF 796

Query:   345 CHLALIEYALSRGLISAKPDLSGF 368
             CHLALIEYA SRG++    DL+GF
Sbjct:   797 CHLALIEYAYSRGMLQTV-DLAGF 819
GO:0004726 "non-membrane spanning protein tyrosine phosphatase activity" evidence=ISS
GO:0006470 "protein dephosphorylation" evidence=IEA;NAS
GO:0004725 "protein tyrosine phosphatase activity" evidence=NAS
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
ZFIN|ZDB-GENE-090313-52 ptpn9b "protein tyrosine phosphatase, non-receptor type 9, b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-101027-1 ptpn9a "protein tyrosine phosphatase, non-receptor type 9, a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P43378 PTPN9 "Tyrosine-protein phosphatase non-receptor type 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|628726 Ptpn9 "protein tyrosine phosphatase, non-receptor type 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE80 PTPRF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE81 PTPRF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1928376 Ptpn9 "protein tyrosine phosphatase, non-receptor type 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SJ71 PTPN9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N6W1 PTPN9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.691
3rd Layer3.1.3.480.737

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query523
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 1e-122
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 1e-120
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 1e-114
PHA02738320 PHA02738, PHA02738, hypothetical protein; Provisio 2e-75
PHA02742303 PHA02742, PHA02742, protein tyrosine phosphatase; 1e-64
PHA02747312 PHA02747, PHA02747, protein tyrosine phosphatase; 1e-60
PHA02746323 PHA02746, PHA02746, protein tyrosine phosphatase; 5e-60
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 3e-49
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 7e-35
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 7e-35
PHA02740298 PHA02740, PHA02740, protein tyrosine phosphatase; 2e-32
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 6e-32
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 4e-31
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 1e-30
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 1e-25
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 1e-25
PHA02738320 PHA02738, PHA02738, hypothetical protein; Provisio 4e-17
PHA02742303 PHA02742, PHA02742, protein tyrosine phosphatase; 4e-17
PHA02746323 PHA02746, PHA02746, protein tyrosine phosphatase; 3e-16
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 2e-14
PHA02747312 PHA02747, PHA02747, protein tyrosine phosphatase; 1e-12
PHA02740298 PHA02740, PHA02740, protein tyrosine phosphatase; 8e-08
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 8e-05
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 0.001
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information 
 Score =  356 bits (917), Expect = e-122
 Identities = 128/244 (52%), Positives = 162/244 (66%), Gaps = 14/244 (5%)

Query: 108 KNRYSDVLAYDHTRVLLSQQDDVPGSDYINANFVDGYKQKNAFISTQGPMQNTVEDFWRM 167
           KNRY D+L YDHTRV L   DD  GSDYINA+++DGY    A+I+TQGP+ NTVEDFWRM
Sbjct: 2   KNRYKDILPYDHTRVKLKP-DDDEGSDYINASYIDGYNPPKAYIATQGPLPNTVEDFWRM 60

Query: 168 VWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTL 227
           VWEQ+  VI+M T ++E+GR KCAQYWP  EG+ +T+GD  VT        DY + +L L
Sbjct: 61  VWEQKVPVIVMLTELVEKGREKCAQYWPEEEGS-LTYGDITVTLVSEEKLDDYTVRTLKL 119

Query: 228 CNTKTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHPRGP 287
            NT T ETR V H+Q+T W D+GVPES  S+L+ L K R +Q              P   
Sbjct: 120 SNTGTGETRTVTHFQYTGWPDHGVPESPDSLLDLLRKVRKSQQ------------QPGSG 167

Query: 288 PIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHL 347
           PI+VHCSAG+GRTGT   +DI + RLE  G VD+  TVK +RSQR   +Q  +QYIF + 
Sbjct: 168 PIVVHCSAGVGRTGTFIAIDILLQRLEAEGVVDIFQTVKELRSQRPGMVQTEEQYIFLYR 227

Query: 348 ALIE 351
           A++E
Sbjct: 228 AILE 231

The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr (pTyr) residues, instead of pSer or pThr. This family has a distinctive active site signature motif, HCSAGxGRxG. Characterized as either transmembrane, receptor-like or non-transmembrane (soluble) PTPs. Receptor-like PTP domains tend to occur in two copies in the cytoplasmic region of the transmembrane proteins, only one copy may be active. Length = 231
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 523
KOG4228|consensus1087 100.0
PHA02742303 protein tyrosine phosphatase; Provisional 100.0
PHA02740298 protein tyrosine phosphatase; Provisional 100.0
PHA02747312 protein tyrosine phosphatase; Provisional 100.0
PHA02746323 protein tyrosine phosphatase; Provisional 100.0
PHA02738320 hypothetical protein; Provisional 100.0
KOG0790|consensus600 100.0
KOG0792|consensus1144 100.0
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 100.0
KOG0791|consensus374 100.0
KOG0793|consensus1004 100.0
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 100.0
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 100.0
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 100.0
KOG4228|consensus1087 100.0
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 100.0
KOG0789|consensus415 100.0
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.9
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.9
PHA02740298 protein tyrosine phosphatase; Provisional 99.87
PHA02742303 protein tyrosine phosphatase; Provisional 99.84
PHA02738320 hypothetical protein; Provisional 99.84
PHA02746323 protein tyrosine phosphatase; Provisional 99.83
PHA02747312 protein tyrosine phosphatase; Provisional 99.81
KOG0790|consensus600 99.79
KOG0792|consensus1144 99.74
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 99.69
KOG0791|consensus374 99.67
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 99.66
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 99.63
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.63
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.63
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 99.61
PTZ00242166 protein tyrosine phosphatase; Provisional 99.61
KOG0793|consensus1004 99.57
KOG0789|consensus415 99.43
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 99.43
PTZ00393241 protein tyrosine phosphatase; Provisional 99.42
KOG1720|consensus225 99.21
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 99.11
PTZ00242166 protein tyrosine phosphatase; Provisional 98.97
KOG2836|consensus173 98.88
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 98.84
KOG1720|consensus225 98.69
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 98.63
PTZ00393241 protein tyrosine phosphatase; Provisional 98.56
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 98.47
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 98.38
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 98.19
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 98.07
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 98.0
PRK12361 547 hypothetical protein; Provisional 97.95
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 97.71
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 97.41
KOG2836|consensus173 97.25
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 97.13
PRK12361 547 hypothetical protein; Provisional 97.07
COG5350172 Predicted protein tyrosine phosphatase [General fu 96.31
KOG2283|consensus434 96.12
KOG1718|consensus198 95.93
KOG1719|consensus183 95.81
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 95.81
KOG1719|consensus183 95.78
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 95.59
KOG1716|consensus285 95.54
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 94.96
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 94.88
KOG1718|consensus198 94.77
COG5350172 Predicted protein tyrosine phosphatase [General fu 94.76
KOG1717|consensus343 94.51
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 94.11
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 93.68
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 93.18
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 93.09
PLN02727 986 NAD kinase 92.95
KOG1716|consensus285 92.45
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 91.84
KOG1717|consensus343 90.92
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 89.88
KOG4471|consensus 717 89.66
PLN02727 986 NAD kinase 84.12
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 83.45
KOG1572|consensus249 82.25
KOG2283|consensus 434 81.37
>KOG4228|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.4e-93  Score=781.75  Aligned_cols=422  Identities=39%  Similarity=0.658  Sum_probs=358.0

Q ss_pred             cccCHHHHHHHHHhcCh---hhHHHHHhhcccCCCCcchhhhccccccCCCCCCCCCCCCCCeeeecCCCCCCCCCceee
Q psy15394         62 QGLSIAEFVEAVRSKGR---SGLCLEYEGFKIKPPDGSFEVAKRRENLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYINA  138 (523)
Q Consensus        62 ~~~~~~~~~~~~~~~~~---~~~~~Ef~~l~~~~~~~~~~~a~~~~N~~KNRy~~i~p~D~sRV~L~~~~~~~~sdYINA  138 (523)
                      .+|++++|++++..+..   -+|.+||+.|...  ..++.++.+.+|+.||||.||++|||+||+|...+|++++|||||
T Consensus       521 ~pI~v~dl~~~i~~~~~~~~~~F~~Eyesl~~~--~~~~~~s~~~en~~KNRY~nilayD~sRV~L~~i~Gd~~sDYINA  598 (1087)
T KOG4228|consen  521 GPIPVADLLEHIERRKADDGYGFKQEYESLPEG--QFTWEHSNKKENKQKNRYENILAYDHSRVILPPIEGDPNSDYINA  598 (1087)
T ss_pred             CCccHHHHHHHHHHhhcccccchHHHHhhcccc--CCccccCccccccccccCCcchhhhcceeeecccCCCccccceee
Confidence            38999999999987643   4699999999766  667889999999999999999999999999999999999999999


Q ss_pred             eccCCcccccceeecCCCCCCCHHHHHHHHHhcCCcEEEEcCCcccCCccccccccCCCCCCeeEecceeEEEeEEEeCC
Q psy15394        139 NFVDGYKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSP  218 (523)
Q Consensus       139 s~I~g~~~~~~yIatQ~Pl~~T~~dFW~MVwe~~v~~IVmLt~~~E~~~~kc~~YwP~~~~~~~~~g~~~V~~~~~~~~~  218 (523)
                      |||+||+.+++|||||||+++|+.||||||||+++.+|||+|++.|.++.||.+|||   .++.+||++.|++.+.....
T Consensus       599 nyIdGy~e~n~yIaaQgP~~eTv~DFWRMVWEq~S~~IVMvTnl~E~~r~kC~qYWP---~~t~~yGdi~V~~~~~~~~a  675 (1087)
T KOG4228|consen  599 NYIDGYKEPNAYIAAQGPRPETVGDFWRMVWEQKSAGIVMVTNLEEFSRVKCAQYWP---EGTETYGDIKVTLVQTKPLA  675 (1087)
T ss_pred             eeeecccccccceeccCCcccchHHHHHHheeccCCcEEEEecccccccccccccCC---CCccccccccccceeeeeec
Confidence            999999999999999999999999999999999999999999999999999999999   35789999999999999999


Q ss_pred             CceEEEeeeeccCCCceeEEEEEEEeeeccCCCCCChHHHHHHHHHHHHHHHHHHhhcCCCCCCCCCCCCEEEEcCCCCc
Q psy15394        219 DYVLSSLTLCNTKTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHPRGPPIIVHCSAGIG  298 (523)
Q Consensus       219 ~~~~r~l~l~~~~~~~~r~V~h~~y~~Wpd~gvP~~~~~ll~fi~~v~~~~~~~~~~~~~~~~~~~~~~PivVHCsaGvG  298 (523)
                      +|.+|+|.|...+....|.|+||||++|||||+|..+..+|.|++.|+..+             .+..||||||||||+|
T Consensus       676 ~y~iRtf~l~~~g~~~~R~v~qfhFt~Wpd~gvPe~~t~lL~f~rrvk~~~-------------p~~aGPiVVHCSAGvG  742 (1087)
T KOG4228|consen  676 EYGIRTFALKKQGENPKREVRQFHFTAWPDHGVPETPTGLLKFRRRVKTFN-------------PPDAGPIVVHCSAGVG  742 (1087)
T ss_pred             cceEEeeeccccCCCCCceeeeeeeccCCCCCCcccchHHHHHHHHhccCC-------------CcCCCCEEEECCCCCC
Confidence            999999999988888899999999999999999999999999999998753             3456899999999999


Q ss_pred             hhhHHHHHHHHHHhccCCCccCHHHHHHHHHhccccCccChhHHHHHHHHHHHHHHHc----------------CCCCCC
Q psy15394        299 RTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSR----------------GLISAK  362 (523)
Q Consensus       299 RTGtfiaid~~l~~l~~~~~vdv~~~v~~lR~qR~~~Vqt~~QY~Fiy~alle~~~~~----------------~~~~~~  362 (523)
                      |||+|++||.++++++.++.+||++.|+.||.||.+||||.+||.|||+||+|+..+-                .-+++.
T Consensus       743 RTG~fi~iDaml~~~~~e~~vdiy~~v~~lR~QR~~mVQt~eQYiFi~~AllE~~~~G~T~i~~~~~~~~~~~l~~~~p~  822 (1087)
T KOG4228|consen  743 RTGCFIVIDAMLDRLECEGKVDIYGHVKTLRRQRNNMVQTEEQYIFIHEALLEACLCGDTEVPASTLAPYSQKLKRIDPP  822 (1087)
T ss_pred             CcceEEEeHHHHHHHHhhCccceechhHHHHhccccccccHHHHHHHHHHHHHHHhcCCccccHHHHHHHHHHhccCCCC
Confidence            9999999999999999999999999999999999999999999999999999998741                112333


Q ss_pred             CCcchhhhhhccCC---CC---CCCCCCCCCCCCCC-----------ccccc----------------------------
Q psy15394        363 PDLSGFQTSCATSR---PG---GHLGRAPAGAPNHR-----------PLLGR----------------------------  397 (523)
Q Consensus       363 ~~~~~~~~~~~~~~---~~---~~~~~~~~~~~~~~-----------~~~~~----------------------------  397 (523)
                      ...++++++|+...   +.   ...+..|.|..|||           |++..                            
T Consensus       823 ~~~t~le~EF~~L~~~~~~~~~~~~~~l~~N~~KNR~~~i~P~d~~rv~L~~~~G~~sdYINAs~idgy~~~~~fivtq~  902 (1087)
T KOG4228|consen  823 ENKTGLEEEFKTLNSCKPRTRMMICGNLPENKSKNRQVNILPYDRNRVILIPTHGESSDYINASFIDGYRQPKAFIVTQG  902 (1087)
T ss_pred             CCCcchHHHHHHHhhccccchhhhccccchhcccccccccCCchhcccceeccCCCcccccchhhhcccCCcceEEEecC
Confidence            45566777765321   11   11133344433332           22210                            


Q ss_pred             ---------------CCcCchhhhhhHHHHH----Hhh-------------------------hhhhhh-----------
Q psy15394        398 ---------------DRAAALSMLEFLAKAR----YTQ-------------------------ASLLAD-----------  422 (523)
Q Consensus       398 ---------------~~~~~i~~l~~~~~~~----~~~-------------------------~~~~~~-----------  422 (523)
                                     ..+.+|+||+.+...+    |+.                         +.|...           
T Consensus       903 PL~~T~~DFWrmi~d~~~tsiVmL~~l~~~~~C~qyw~~~g~~~yg~i~Ve~~~~~~~~~~t~r~f~i~n~~~~~~r~v~  982 (1087)
T KOG4228|consen  903 PLAETVEDFWRMIWDQNVTSIVMLTELKHPEKCPQYWPPEGSQRYGPIEVEDMNEHINPQYTAREFGVTNEREKQSRTVR  982 (1087)
T ss_pred             CcccchHHHHHHhhccceeEEEEecccCcccccccccCCcCceecCcEEEEecccccchhhhhhhheeeeccccCceEEE
Confidence                           1356789998775431    111                         111100           


Q ss_pred             --ccccCCCC-----------------------CCCCCeEEecCCCCCccchhhHHHHHHHHHhhcCCCCHHHHHHHHHh
Q psy15394        423 --LGDTWAGH-----------------------PRGPPIIVHCSAGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRS  477 (523)
Q Consensus       423 --~~~~~~~~-----------------------~~~~pivVHCs~G~gRtg~f~~~~~~~~~~~~~~~v~v~~~v~~lR~  477 (523)
                        ...+|+..                       ...+|++|||++|+||+|+||++.+++++++.++.||||++||.||.
T Consensus       983 qfq~~~WP~~~~~p~~~~~~~~i~~~~~~~q~~~~~~P~~Vhc~nG~~rsg~f~ai~~l~e~~~~e~~vDVfq~vk~Lr~ 1062 (1087)
T KOG4228|consen  983 QFQFTGWPEYGKPPQSKGPISKIPSVASKWQQLGADGPIIVHCLNGVGRTGTFCAISILLERMRKEGVVDVFQTVKTLRF 1062 (1087)
T ss_pred             EEEecCCcccCcCCCCcchhhhHHHHHHHHHhhcCCCCEEEEEcCCCcceeehHHHHHHHHHHhhcCceeeehhhhhhhh
Confidence              01245531                       23689999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCHHHHHHHHHHHHHHHH
Q psy15394        478 QRAHSIQMRDQYIFCHLALIEYAL  501 (523)
Q Consensus       478 qR~~~v~t~~Qy~f~~~~i~~~~~  501 (523)
                      +|++||++.+||.|||+++++|+.
T Consensus      1063 ~rp~mv~t~~QY~fcYdv~~~y~~ 1086 (1087)
T KOG4228|consen 1063 QRPGMVDTSDQYQFCYDVALEYLG 1086 (1087)
T ss_pred             cCccccCcHHHHHHHHHHHHHhhc
Confidence            999999999999999999999973

>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>KOG2283|consensus Back     alignment and domain information
>KOG1718|consensus Back     alignment and domain information
>KOG1719|consensus Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG1719|consensus Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>KOG1716|consensus Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>KOG1718|consensus Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>KOG1717|consensus Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>KOG1716|consensus Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1717|consensus Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4471|consensus Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>KOG1572|consensus Back     alignment and domain information
>KOG2283|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query523
2pa5_A314 Crystal Structure Of Human Protein Tyrosine Phospha 1e-81
2pa5_A314 Crystal Structure Of Human Protein Tyrosine Phospha 9e-27
1lar_A 575 Crystal Structure Of The Tandem Phosphatase Domains 3e-61
1lar_A 575 Crystal Structure Of The Tandem Phosphatase Domains 8e-14
2nv5_A299 Crystal Structure Of A C-Terminal Phosphatase Domai 1e-60
2nv5_A299 Crystal Structure Of A C-Terminal Phosphatase Domai 6e-14
2c7s_A313 Crystal Structure Of Human Protein Tyrosine Phospha 2e-60
2c7s_A313 Crystal Structure Of Human Protein Tyrosine Phospha 7e-13
3qcl_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-60
3qcl_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 4e-15
3sr9_A 583 Crystal Structure Of Mouse Ptpsigma Length = 583 3e-60
3sr9_A 583 Crystal Structure Of Mouse Ptpsigma Length = 583 7e-14
3qcm_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 4e-60
3qcm_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 5e-15
2fh7_A 595 Crystal Structure Of The Phosphatase Domains Of Hum 1e-59
2fh7_A 595 Crystal Structure Of The Phosphatase Domains Of Hum 5e-14
3qcb_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 2e-59
3qcb_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 4e-15
2h4v_A320 Crystal Structure Of The Human Tyrosine Receptor Ph 2e-59
2h4v_A320 Crystal Structure Of The Human Tyrosine Receptor Ph 4e-15
2nlk_A 627 Crystal Structure Of D1 And D2 Catalytic Domains Of 3e-59
2nlk_A 627 Crystal Structure Of D1 And D2 Catalytic Domains Of 4e-15
2pbn_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 3e-59
2pbn_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 5e-15
2jjd_A 599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 2e-58
2jjd_A 599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 1e-12
1yfo_A302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 8e-58
1yfo_A302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 2e-12
2hy3_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 3e-57
2hy3_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 6e-15
2ooq_A286 Crystal Structure Of The Human Receptor Phosphatase 2e-55
2ooq_A286 Crystal Structure Of The Human Receptor Phosphatase 8e-13
1ygr_A 610 Crystal Structure Of The Tandem Phosphatase Domain 1e-54
1ygr_A 610 Crystal Structure Of The Tandem Phosphatase Domain 3e-12
1rpm_A278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 4e-54
1rpm_A278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 2e-12
2h02_A313 Structural Studies Of Protein Tyrosine Phosphatase 1e-53
2h02_A313 Structural Studies Of Protein Tyrosine Phosphatase 8e-11
2ahs_A295 Crystal Structure Of The Catalytic Domain Of Human 2e-53
2ahs_A295 Crystal Structure Of The Catalytic Domain Of Human 1e-10
3i36_A342 Crystal Structure Of Rat Protein Tyrosine Phosphata 1e-52
3i36_A342 Crystal Structure Of Rat Protein Tyrosine Phosphata 2e-12
2nz6_A316 Crystal Structure Of The Ptprj Inactivating Mutant 3e-52
2nz6_A316 Crystal Structure Of The Ptprj Inactivating Mutant 3e-11
2cfv_A316 Crystal Structure Of Human Protein Tyrosine Phospha 1e-51
2cfv_A316 Crystal Structure Of Human Protein Tyrosine Phospha 2e-12
1nwl_A298 Crystal Structure Of The Ptp1b Complexed With Sp734 4e-51
1nwl_A298 Crystal Structure Of The Ptp1b Complexed With Sp734 7e-11
4i8n_A354 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-50
4i8n_A354 Crystal Structure Of Protein Tyrosine Phosphatase 1 9e-11
2h03_A291 Structural Studies Of Protein Tyrosine Phosphatase 1e-50
2h03_A291 Structural Studies Of Protein Tyrosine Phosphatase 1e-10
1p15_A253 Crystal Structure Of The D2 Domain Of Rptpa Length 1e-50
1p15_A253 Crystal Structure Of The D2 Domain Of Rptpa Length 1e-13
2cma_A327 Structural Basis For Inhibition Of Protein Tyrosine 1e-50
2cma_A327 Structural Basis For Inhibition Of Protein Tyrosine 8e-11
1nl9_A321 Potent, Selective Protein Tyrosine Phosphatase 1b I 1e-50
1nl9_A321 Potent, Selective Protein Tyrosine Phosphatase 1b I 8e-11
2fjm_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 1e-50
2fjm_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 9e-11
3cwe_A290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 1e-50
3cwe_A290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 9e-11
2azr_A299 Crystal Structure Of Ptp1b With Bicyclic Thiophene 2e-50
2azr_A299 Crystal Structure Of Ptp1b With Bicyclic Thiophene 8e-11
1q6j_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 2e-50
1q6j_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 8e-11
3sme_A300 Structure Of Ptp1b Inactivated By H2o2BICARBONATE L 2e-50
3sme_A300 Structure Of Ptp1b Inactivated By H2o2BICARBONATE L 8e-11
1g7g_A298 Human Ptp1b Catalytic Domain Complexes With Pnu1793 2e-50
1g7g_A298 Human Ptp1b Catalytic Domain Complexes With Pnu1793 8e-11
2cm2_A304 Structure Of Protein Tyrosine Phosphatase 1b (P2121 2e-50
2cm2_A304 Structure Of Protein Tyrosine Phosphatase 1b (P2121 8e-11
1bzj_A297 Human Ptp1b Complexed With Tpicooh Length = 297 2e-50
1bzj_A297 Human Ptp1b Complexed With Tpicooh Length = 297 9e-11
2f6f_A302 The Structure Of The S295f Mutant Of Human Ptp1b Le 2e-50
2f6f_A302 The Structure Of The S295f Mutant Of Human Ptp1b Le 1e-10
1lqf_A295 Structure Of Ptp1b In Complex With A Peptidic Bisph 2e-50
1lqf_A295 Structure Of Ptp1b In Complex With A Peptidic Bisph 1e-10
2nt7_A299 Crystal Structure Of Ptp1b-inhibitor Complex Length 3e-50
2nt7_A299 Crystal Structure Of Ptp1b-inhibitor Complex Length 1e-10
1g7f_A298 Human Ptp1b Catalytic Domain Complexed With Pnu1774 3e-50
1g7f_A298 Human Ptp1b Catalytic Domain Complexed With Pnu1774 1e-10
1l8g_A321 Crystal Structure Of Ptp1b Complexed With 7-(1,1-di 3e-50
1l8g_A321 Crystal Structure Of Ptp1b Complexed With 7-(1,1-di 1e-10
1ecv_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 4e-50
1ecv_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-10
1gfy_A298 Residue 259 Is A Key Determinant Of Substrate Speci 6e-50
1gfy_A298 Residue 259 Is A Key Determinant Of Substrate Speci 6e-11
2b3o_A532 Crystal Structure Of Human Tyrosine Phosphatase Shp 7e-50
2b3o_A532 Crystal Structure Of Human Tyrosine Phosphatase Shp 1e-11
1bzc_A321 Human Ptp1b Catalytic Domain Complexed With Tpi Len 7e-50
1bzc_A321 Human Ptp1b Catalytic Domain Complexed With Tpi Len 4e-10
1bzh_A298 Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 9e-50
1bzh_A298 Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 4e-10
1gwz_A299 Crystal Structure Of The Catalytic Domain Of The Pr 1e-49
1gwz_A299 Crystal Structure Of The Catalytic Domain Of The Pr 1e-11
4gs0_A308 Crystal Structure Of Shp1 Catalytic Domain With Jak 1e-49
4gs0_A308 Crystal Structure Of Shp1 Catalytic Domain With Jak 1e-11
1c86_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-49
1c86_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-10
1g1f_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-49
1g1f_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 9e-10
3ps5_A595 Crystal Structure Of The Full-Length Human Protein 2e-49
3ps5_A595 Crystal Structure Of The Full-Length Human Protein 1e-10
3s3e_A307 Crystal Structure Of The Catalytic Domain Of Ptp10d 2e-49
3s3e_A307 Crystal Structure Of The Catalytic Domain Of Ptp10d 7e-10
1een_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-49
1een_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-09
1aax_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-49
1aax_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-09
3qkp_A321 Protein Tyrosine Phosphatase 1b - Apo W179f Mutant 2e-49
3qkp_A321 Protein Tyrosine Phosphatase 1b - Apo W179f Mutant 8e-11
1i57_A310 Crystal Structure Of Apo Human Ptp1b (C215s) Mutant 2e-49
1i57_A310 Crystal Structure Of Apo Human Ptp1b (C215s) Mutant 1e-09
1ptu_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-49
1ptu_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 1e-09
1oeo_X321 Ptp1b With The Catalytic Cysteine Oxidized To Sulfo 3e-49
1oeo_X321 Ptp1b With The Catalytic Cysteine Oxidized To Sulfo 1e-09
3eu0_A327 Crystal Structure Of The S-Nitrosylated Cys215 Of P 3e-49
3eu0_A327 Crystal Structure Of The S-Nitrosylated Cys215 Of P 1e-09
3a5k_A304 Crystal Structure Of Protein-Tyrosine Phosphatase 1 3e-49
3a5k_A304 Crystal Structure Of Protein-Tyrosine Phosphatase 1 8e-11
3zv2_A320 Human Protein-Tyrosine Phosphatase 1b C215a, S216a 3e-49
3zv2_A320 Human Protein-Tyrosine Phosphatase 1b C215a, S216a 2e-09
1pa1_A310 Crystal Structure Of The C215d Mutant Of Protein Ty 4e-49
1pa1_A310 Crystal Structure Of The C215d Mutant Of Protein Ty 2e-09
1ptv_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 5e-49
1ptv_A321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-09
4gry_A288 Crystal Structure Of Shp1 Catalytic Domain With Jak 1e-48
4gry_A288 Crystal Structure Of Shp1 Catalytic Domain With Jak 2e-10
1fpr_A284 Crystal Structure Of The Complex Formed Between The 2e-48
1fpr_A284 Crystal Structure Of The Complex Formed Between The 2e-10
1a5y_A330 Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate 9e-48
1a5y_A330 Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate 5e-08
3o5x_A276 Crystal Structure Of The Oncogenic Tyrosine Phospha 1e-47
3o5x_A276 Crystal Structure Of The Oncogenic Tyrosine Phospha 2e-09
3b7o_A316 Crystal Structure Of The Human Tyrosine Phosphatase 1e-47
3b7o_A316 Crystal Structure Of The Human Tyrosine Phosphatase 2e-09
2shp_A525 Tyrosine Phosphatase Shp-2 Length = 525 8e-47
2shp_A525 Tyrosine Phosphatase Shp-2 Length = 525 2e-08
1l8k_A314 T Cell Protein-Tyrosine Phosphatase Structure Lengt 9e-47
1l8k_A314 T Cell Protein-Tyrosine Phosphatase Structure Lengt 7e-10
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 8e-46
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 3e-11
2b49_A287 Crystal Structure Of The Catalytic Domain Of Protei 2e-45
2b49_A287 Crystal Structure Of The Catalytic Domain Of Protei 3e-07
2qep_A304 Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be 9e-45
2qep_A304 Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be 2e-07
2g59_A297 Crystal Structure Of The Catalytic Domain Of Protei 1e-44
2g59_A297 Crystal Structure Of The Catalytic Domain Of Protei 4e-11
2gjt_A295 Crystal Structure Of The Human Receptor Phosphatase 1e-44
2gjt_A295 Crystal Structure Of The Human Receptor Phosphatase 4e-11
2i75_A320 Crystal Structure Of Human Protein Tyrosine Phospha 7e-44
2i75_A320 Crystal Structure Of Human Protein Tyrosine Phospha 2e-07
1wch_A315 Crystal Structure Of Ptpl1 Human Tyrosine Phosphata 1e-43
1wch_A315 Crystal Structure Of Ptpl1 Human Tyrosine Phosphata 5e-11
1zc0_A309 Crystal Structure Of Human Hematopoietic Tyrosine P 3e-43
1zc0_A309 Crystal Structure Of Human Hematopoietic Tyrosine P 7e-10
2a3k_A296 Crystal Structure Of The Human Protein Tyrosine Pho 3e-43
2a3k_A296 Crystal Structure Of The Human Protein Tyrosine Pho 7e-10
3o4s_A308 Crystal Structure Of Heptp With A Closed Wpd Loop A 3e-43
3o4s_A308 Crystal Structure Of Heptp With A Closed Wpd Loop A 7e-10
3d42_A308 Crystal Structure Of Heptp In Complex With A Monoph 4e-43
3d42_A308 Crystal Structure Of Heptp In Complex With A Monoph 1e-08
2gp0_A309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 5e-43
2gp0_A309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 7e-10
2qdc_A309 Crystal Structure Of The Heptp Catalytic Domain D23 2e-42
2qdc_A309 Crystal Structure Of The Heptp Catalytic Domain D23 7e-10
2hvl_A309 Crystal Structure Of The Heptp Catalytic Domain C27 3e-42
2hvl_A309 Crystal Structure Of The Heptp Catalytic Domain C27 1e-08
2qcj_A313 Native Structure Of Lyp Length = 313 1e-41
2qcj_A313 Native Structure Of Lyp Length = 313 9e-07
2p6x_A309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 2e-41
2p6x_A309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 1e-06
3h2x_A302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 2e-41
3h2x_A302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 1e-06
2oc3_A303 Crystal Structure Of The Catalytic Domain Of Human 2e-41
2oc3_A303 Crystal Structure Of The Catalytic Domain Of Human 7e-06
2bij_A305 Crystal Structure Of The Human Protein Tyrosine Pho 7e-41
2bij_A305 Crystal Structure Of The Human Protein Tyrosine Pho 1e-10
2bzl_A325 Crystal Structure Of The Human Protein Tyrosine Pho 1e-40
2bzl_A325 Crystal Structure Of The Human Protein Tyrosine Pho 2e-11
3olr_A313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 1e-40
3olr_A313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 1e-05
2qdm_A309 Crystal Structure Of The Heptp Catalytic Domain C27 1e-40
2qdm_A309 Crystal Structure Of The Heptp Catalytic Domain C27 5e-08
2cjz_A305 Crystal Structure Of The C472s Mutant Of Human Prot 1e-39
2cjz_A305 Crystal Structure Of The C472s Mutant Of Human Prot 2e-09
2bv5_A282 Crystal Structure Of The Human Protein Tyrosine Pho 1e-39
2bv5_A282 Crystal Structure Of The Human Protein Tyrosine Pho 3e-09
1jln_A297 Crystal Structure Of The Catalytic Domain Of Protei 2e-39
1jln_A297 Crystal Structure Of The Catalytic Domain Of Protei 6e-09
3brh_A310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 2e-39
3brh_A310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 1e-05
2a8b_A283 Crystal Structure Of The Catalytic Domain Of Human 2e-39
2a8b_A283 Crystal Structure Of The Catalytic Domain Of Human 3e-09
2i1y_A301 Crystal Structure Of The Phosphatase Domain Of Huma 3e-38
2i1y_A301 Crystal Structure Of The Phosphatase Domain Of Huma 1e-07
4az1_A302 Crystal Structure Of The Trypanosoma Cruzi Protein 2e-26
4az1_A302 Crystal Structure Of The Trypanosoma Cruzi Protein 8e-07
3m4u_A306 Crystal Structure Of Trypanosoma Brucei Protein Tyr 5e-20
3m4u_A306 Crystal Structure Of Trypanosoma Brucei Protein Tyr 3e-04
3u96_A306 Crystal Structure Of Yophq357f(Catalytic Domain, Re 9e-04
>pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 Back     alignment and structure 
Iteration: 1

 Score =  300 bits (768), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 142/300 (47%), Positives = 202/300 (67%)
Query: 62  QGLSIAEFVEAVRSKGRSGLCLEYEGFKIKPPDGSFEVAKRRENLFKNRYSDVLAYDHTR 121
             ++I E V+ V ++ + G+  EYE  + + P G+F  +    NL KNRY DV   D TR
Sbjct: 9   HAMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTR 68
Query: 122 VLLSQQDDVPGSDYINANFVDGYKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTR 181
           V L+++     +DYINA+F+DGYKQKNA+I TQGP++NT  DFW MVWEQ+ LVI+MTTR
Sbjct: 69  VKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTR 128
Query: 182 VIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKTLETRMVAHY 241
             E GR KC QYWP  + +++  G   VT   V +   Y  ++L + NT+  + R V H+
Sbjct: 129 FEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHF 188
Query: 242 QFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHPRGPPIIVHCSAGIGRTG 301
           QF +W DYGVP SA S+++FL   R+ Q+  ++++G    G    PPI+VHCSAGIGRTG
Sbjct: 189 QFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTG 248
Query: 302 TLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISA 361
           T C+LDIC+++LE+ GT++V  TV R+R+QRA SIQ  +QY FC+ A++E+A   G++SA
Sbjct: 249 TFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSA 308
>pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 Back     alignment and structure
>pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 Back     alignment and structure
>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 Back     alignment and structure
>pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 Back     alignment and structure
>pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 Back     alignment and structure
>pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 Back     alignment and structure
>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 Back     alignment and structure
>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 Back     alignment and structure
>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 Back     alignment and structure
>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 Back     alignment and structure
>pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 Back     alignment and structure
>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 Back     alignment and structure
>pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 Back     alignment and structure
>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 Back     alignment and structure
>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 Back     alignment and structure
>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 Back     alignment and structure
>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 Back     alignment and structure
>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 Back     alignment and structure
>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 Back     alignment and structure
>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 Back     alignment and structure
>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 Back     alignment and structure
>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 Back     alignment and structure
>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 Back     alignment and structure
>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 Back     alignment and structure
>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 Back     alignment and structure
>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 Back     alignment and structure
>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 Back     alignment and structure
>pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 Back     alignment and structure
>pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 Back     alignment and structure
>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 Back     alignment and structure
>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 Back     alignment and structure
>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 Back     alignment and structure
>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 Back     alignment and structure
>pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 Back     alignment and structure
>pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 Back     alignment and structure
>pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 Back     alignment and structure
>pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 Back     alignment and structure
>pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 Back     alignment and structure
>pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 Back     alignment and structure
>pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 Back     alignment and structure
>pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 Back     alignment and structure
>pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 Back     alignment and structure
>pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 Back     alignment and structure
>pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 Back     alignment and structure
>pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 Back     alignment and structure
>pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 Back     alignment and structure
>pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 Back     alignment and structure
>pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 Back     alignment and structure
>pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 Back     alignment and structure
>pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 Back     alignment and structure
>pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 Back     alignment and structure
>pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 Back     alignment and structure
>pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 Back     alignment and structure
>pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 Back     alignment and structure
>pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 Back     alignment and structure
>pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 Back     alignment and structure
>pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 Back     alignment and structure
>pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 Back     alignment and structure
>pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 Back     alignment and structure
>pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 Back     alignment and structure
>pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure
>pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 Back     alignment and structure
>pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 Back     alignment and structure
>pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 Back     alignment and structure
>pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 Back     alignment and structure
>pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 Back     alignment and structure
>pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 Back     alignment and structure
>pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 Back     alignment and structure
>pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 Back     alignment and structure
>pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 Back     alignment and structure
>pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 Back     alignment and structure
>pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 Back     alignment and structure
>pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 Back     alignment and structure
>pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 Back     alignment and structure
>pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 Back     alignment and structure
>pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 Back     alignment and structure
>pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 Back     alignment and structure
>pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 Back     alignment and structure
>pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 Back     alignment and structure
>pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 Back     alignment and structure
>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 Back     alignment and structure
>pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 Back     alignment and structure
>pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 Back     alignment and structure
>pdb|4AZ1|A Chain A, Crystal Structure Of The Trypanosoma Cruzi Protein Tyrosine Phosphatase Tcptp1, A Potential Therapeutic Target For Chagas' Disease Length = 302 Back     alignment and structure
>pdb|4AZ1|A Chain A, Crystal Structure Of The Trypanosoma Cruzi Protein Tyrosine Phosphatase Tcptp1, A Potential Therapeutic Target For Chagas' Disease Length = 302 Back     alignment and structure
>pdb|3M4U|A Chain A, Crystal Structure Of Trypanosoma Brucei Protein Tyrosine Phosphatase Tbptp1 Length = 306 Back     alignment and structure
>pdb|3M4U|A Chain A, Crystal Structure Of Trypanosoma Brucei Protein Tyrosine Phosphatase Tbptp1 Length = 306 Back     alignment and structure
>pdb|3U96|A Chain A, Crystal Structure Of Yophq357f(Catalytic Domain, Residues 163-468) In Complex With Pncs Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query523
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 1e-166
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 1e-45
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 1e-153
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 1e-41
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 1e-147
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 6e-37
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 1e-147
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 8e-37
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 1e-146
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 1e-35
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 1e-145
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 3e-36
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 1e-145
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 2e-37
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 1e-144
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 4e-38
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 1e-144
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 6e-35
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 1e-144
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 5e-36
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 1e-143
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 1e-36
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 1e-142
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 3e-37
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 1e-141
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 5e-34
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-141
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-123
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-32
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 6e-31
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 1e-141
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 1e-35
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 1e-140
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 2e-35
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 1e-140
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 1e-34
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 1e-140
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 1e-127
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 2e-32
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 1e-31
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 1e-139
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 2e-33
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 1e-138
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 4e-34
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-136
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-126
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 1e-31
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 2e-29
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 1e-136
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 3e-34
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 1e-135
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 6e-36
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 1e-134
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 1e-119
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 9e-32
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 9e-31
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 1e-133
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 1e-34
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 1e-132
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 8e-36
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 1e-130
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 6e-34
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 1e-130
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 1e-35
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 1e-127
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 1e-32
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 2e-25
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 8e-12
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 1e-126
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 7e-33
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 4e-25
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 2e-11
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 1e-126
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 1e-32
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 5e-08
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 5e-08
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 1e-111
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 2e-30
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 6e-98
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 7e-28
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 3e-16
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 4e-13
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 3e-08
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 4e-06
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 2e-04
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 1e-05
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 7e-05
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 4e-05
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 8e-05
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 4e-05
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 7e-04
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 5e-05
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 4e-04
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 1e-04
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 3e-04
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 3e-04
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 3e-04
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 6e-04
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
 Score =  472 bits (1218), Expect = e-166
 Identities = 142/300 (47%), Positives = 202/300 (67%)

Query: 62  QGLSIAEFVEAVRSKGRSGLCLEYEGFKIKPPDGSFEVAKRRENLFKNRYSDVLAYDHTR 121
             ++I E V+ V ++ + G+  EYE  + + P G+F  +    NL KNRY DV   D TR
Sbjct: 9   HAMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTR 68

Query: 122 VLLSQQDDVPGSDYINANFVDGYKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTR 181
           V L+++     +DYINA+F+DGYKQKNA+I TQGP++NT  DFW MVWEQ+ LVI+MTTR
Sbjct: 69  VKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTR 128

Query: 182 VIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSPDYVLSSLTLCNTKTLETRMVAHY 241
             E GR KC QYWP  + +++  G   VT   V +   Y  ++L + NT+  + R V H+
Sbjct: 129 FEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHF 188

Query: 242 QFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHPRGPPIIVHCSAGIGRTG 301
           QF +W DYGVP SA S+++FL   R+ Q+  ++++G    G    PPI+VHCSAGIGRTG
Sbjct: 189 QFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTG 248

Query: 302 TLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLISA 361
           T C+LDIC+++LE+ GT++V  TV R+R+QRA SIQ  +QY FC+ A++E+A   G++SA
Sbjct: 249 TFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSA 308
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query523
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 100.0
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 100.0
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 100.0
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 100.0
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 100.0
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 100.0
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 100.0
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 100.0
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 100.0
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 100.0
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 100.0
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 100.0
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 100.0
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 100.0
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 100.0
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 100.0
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 100.0
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 100.0
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 100.0
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 100.0
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 100.0
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 100.0
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 100.0
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 100.0
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 100.0
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 100.0
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 100.0
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 100.0
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 100.0
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 100.0
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 100.0
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 100.0
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 100.0
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 100.0
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.96
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.9
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 99.9
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.88
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 99.84
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 99.82
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 99.81
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 99.81
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 99.8
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 99.8
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 99.79
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 99.79
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 99.78
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 99.78
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 99.78
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 99.78
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 99.78
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 99.78
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 99.77
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 99.77
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 99.77
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 99.77
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 99.77
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 99.77
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 99.77
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 99.77
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 99.77
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 99.77
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 99.76
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.76
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 99.76
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 99.75
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 99.74
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.74
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 99.73
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.65
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 99.62
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.46
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.43
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.41
2q05_A195 Late protein H1, dual specificity protein phosphat 99.39
1d5r_A324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.38
3cm3_A176 Late protein H1, dual specificity protein phosphat 99.31
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.25
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.22
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 99.19
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.12
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.09
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 99.07
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.07
3n0a_A361 Tyrosine-protein phosphatase auxilin; phosphatase- 99.06
3v0d_A339 Voltage-sensor containing phosphatase; PTP, hydrol 99.04
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.02
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 98.98
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 98.93
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 98.91
1xri_A151 AT1G05000; structural genomics, protein structure 98.87
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 98.87
2q05_A195 Late protein H1, dual specificity protein phosphat 98.85
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 98.82
2hcm_A164 Dual specificity protein phosphatase; structural g 98.8
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 98.79
3cm3_A176 Late protein H1, dual specificity protein phosphat 98.79
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 98.76
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 98.75
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 98.74
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 98.72
2oud_A177 Dual specificity protein phosphatase 10; A central 98.71
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 98.71
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 98.65
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 98.65
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 98.6
2hxp_A155 Dual specificity protein phosphatase 9; human phos 98.6
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 98.54
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 98.54
1xri_A151 AT1G05000; structural genomics, protein structure 98.53
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 98.52
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 98.51
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 98.49
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 98.48
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 98.48
2hcm_A164 Dual specificity protein phosphatase; structural g 98.33
3emu_A161 Leucine rich repeat and phosphatase domain contain 98.32
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 98.31
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 98.29
2oud_A177 Dual specificity protein phosphatase 10; A central 98.29
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 98.26
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 98.22
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 98.21
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 98.2
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 98.2
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 98.18
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 98.18
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 98.17
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 98.17
2hxp_A155 Dual specificity protein phosphatase 9; human phos 98.15
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 98.13
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 98.08
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 98.07
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 98.05
3nme_A294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 98.04
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 97.94
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 97.93
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 97.9
3emu_A161 Leucine rich repeat and phosphatase domain contain 97.85
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 97.83
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 97.76
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 97.58
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 97.45
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 97.29
2f46_A156 Hypothetical protein; structural genomics, joint c 96.74
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 95.55
2f46_A156 Hypothetical protein; structural genomics, joint c 95.24
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 94.66
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 92.83
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 86.54
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
Probab=100.00  E-value=3.5e-91  Score=770.80  Aligned_cols=428  Identities=32%  Similarity=0.530  Sum_probs=346.4

Q ss_pred             CcccCHHHHHHHHHhcC---hhhHHHHHhhcccCCCCcchhhhccccccCCCCCCCCCCCCCCeeeecCCCCCCCCCcee
Q psy15394         61 SQGLSIAEFVEAVRSKG---RSGLCLEYEGFKIKPPDGSFEVAKRRENLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYIN  137 (523)
Q Consensus        61 ~~~~~~~~~~~~~~~~~---~~~~~~Ef~~l~~~~~~~~~~~a~~~~N~~KNRy~~i~p~D~sRV~L~~~~~~~~sdYIN  137 (523)
                      ..||++++|++++.++.   ..+|.+||+.|.......++..+..++|..||||.||+|||||||+|+..++++++||||
T Consensus         7 ~~pi~~~~~~~~~~~~~~~~~~~~~~Ef~~l~~~~~~~~~~~~~~~~N~~kNRy~~i~p~D~tRV~L~~~~~~~~~dYIn   86 (610)
T 1ygr_A            7 VEPIHADILLETYKRKIADEGRPFLAEFQSIPRVFSKFPIKEARKPFNQNKNRYVDILPYDYNRVELSEINGDAGSNYIN   86 (610)
T ss_dssp             CCCEETTTHHHHHHHHHHHHHHHHHHHHHSSCSSCSSSCCTTTSSGGGGGGCSCTTCCCCTTTEEECCCCSSSTTTTEEE
T ss_pred             CCCccHHHHHHHHHHHhhcCCchHHHHHHHHhcccCCCChhhhhChhhhhcCCCCCcCCCCcceeEeecCCCCCCCCccc
Confidence            45788899999887653   346899999998776677888899999999999999999999999999887777899999


Q ss_pred             eeccCCcccccceeecCCCCCCCHHHHHHHHHhcCCcEEEEcCCcccCCccccccccCCCCCCeeEecceeEEEeEEEeC
Q psy15394        138 ANFVDGYKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSS  217 (523)
Q Consensus       138 As~I~g~~~~~~yIatQ~Pl~~T~~dFW~MVwe~~v~~IVmLt~~~E~~~~kc~~YwP~~~~~~~~~g~~~V~~~~~~~~  217 (523)
                      ||||+|+..+++|||||||+++|+.|||+||||+++.+|||||.+.|.|+.||++|||...++...||+|+|++.+....
T Consensus        87 An~i~g~~~~~~yIatQgPl~~T~~dFW~MVwe~~~~~IVMLt~~~E~~~~kc~~YwP~~~~~~~~~g~~~V~~~~~~~~  166 (610)
T 1ygr_A           87 ASYIDGFKEPRKYIAAQGPRDETVDDFWRMIWEQKATVIVMVTRCEEGNRNKCAEYWPSMEEGTRAFGDVVVKINQHKRC  166 (610)
T ss_dssp             EEEECCSSSTTCEEEECCCCTTTHHHHHHHHHHTTCCEEEECSCSEETTEESCCCCSCCTTTCEEEETTEEEEEEEEEEC
T ss_pred             ccccccCCCcceEEEeCCCchhHHHHHHHHHhcccCcEEEeCCccccCCccccceecccCCCCceeeccEEEEEEEEEec
Confidence            99999999999999999999999999999999999999999999999999999999999888899999999999999999


Q ss_pred             CCceEEEeeeeccC-CCceeEEEEEEEeeeccCCCCCChHHHHHHHHHHHHHHHHHHhhcCCCCCCCCCCCCEEEEcCCC
Q psy15394        218 PDYVLSSLTLCNTK-TLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHPRGPPIIVHCSAG  296 (523)
Q Consensus       218 ~~~~~r~l~l~~~~-~~~~r~V~h~~y~~Wpd~gvP~~~~~ll~fi~~v~~~~~~~~~~~~~~~~~~~~~~PivVHCsaG  296 (523)
                      .+|++|.|.|++.+ ...+|.|+||||++|||+|+|.++..+++|++.++...             ....+|||||||||
T Consensus       167 ~~~~~r~l~l~~~~~~~~~r~V~h~~y~~WPD~gvP~~~~~~l~~~~~v~~~~-------------~~~~~PivVHCsaG  233 (610)
T 1ygr_A          167 PDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVPEDPHLLLKLRRRVNAFS-------------NFFSGPIVVHSSAG  233 (610)
T ss_dssp             SSEEEEEEEEEESSSCCCCEEEEEEEECSCCTTSCCSCHHHHHHHHHHHTTSC-------------CTTCCCEEEECSSS
T ss_pred             CCcEEEEEEEEeccCCCCCcEEEEEEeCCCCCCCCCCCHHHHHHHHHHHHHhh-------------ccCCCCeEEEcCCC
Confidence            99999999998764 34689999999999999999999999999998776421             12457999999999


Q ss_pred             CchhhHHHHHHHHHHhccCCCccCHHHHHHHHHhccccCccChhHHHHHHHHHHHHHHHcCCC----------------C
Q psy15394        297 IGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYALSRGLI----------------S  360 (523)
Q Consensus       297 vGRTGtfiaid~~l~~l~~~~~vdv~~~v~~lR~qR~~~Vqt~~QY~Fiy~alle~~~~~~~~----------------~  360 (523)
                      +||||||||+|+++++++.++.+|++++|+.||+||++||||.+||.|||.+|++|+......                .
T Consensus       234 vGRTGtfiaid~~l~~l~~~~~v~v~~~v~~lR~qR~~~Vqt~~Qy~fi~~~l~~~~~~~~t~v~~s~L~~~l~~L~~~~  313 (610)
T 1ygr_A          234 VGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVEAQYILIHQALVEYNQFGETEVNLSELHPYLHNMKKRD  313 (610)
T ss_dssp             SHHHHHHHHHHHHHHTHHHHSEECHHHHHHHHHTTSTTSSCCHHHHHHHHHHHHHHHHHCCCCCBGGGHHHHHHHHTCCS
T ss_pred             CCchhhHHHHHHHHHHHhcCCCCCHHHHHHHHHhhhcCCcCcHHHHHHHHHHHHHHhhcCCcccchhhHHHHHHHHhhcc
Confidence            999999999999999999999999999999999999999999999999999999998753220                1


Q ss_pred             CCCCcchhhhhhccCCC-----CCCCCCCCCCCCCC-----------Cccccc---------------------------
Q psy15394        361 AKPDLSGFQTSCATSRP-----GGHLGRAPAGAPNH-----------RPLLGR---------------------------  397 (523)
Q Consensus       361 ~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~-----------~~~~~~---------------------------  397 (523)
                      +....+.++.+|+....     ....+..+.|..||           |+.|..                           
T Consensus       314 ~~~~~~~l~~Ef~~l~~~~~~~~~~~~~~~~N~~KNRy~~i~p~D~sRV~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~d  393 (610)
T 1ygr_A          314 PPSEPSPLEAEFQRLPSYRSWRTQHIGNQEENKSKNRNSNVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSK  393 (610)
T ss_dssp             STTSCCHHHHHHHHSCCCTTCSCCCGGGSTTGGGSCSSTTCCCCTTTBCCCC--------------------------CC
T ss_pred             ccccccchhhhhhccccccccchhhhhccchhccccCCCcCCccccceeeeccccccccccccccccccccccccccccc
Confidence            11223445555442110     00111122222222           222210                           


Q ss_pred             ------------------------------------CCcCchhhhhhHHH------HHHhhh------------------
Q psy15394        398 ------------------------------------DRAAALSMLEFLAK------ARYTQA------------------  417 (523)
Q Consensus       398 ------------------------------------~~~~~i~~l~~~~~------~~~~~~------------------  417 (523)
                                                          ..+..|+||+-+.+      .+|+..                  
T Consensus       394 YINAn~I~g~~~~~~yIatQ~Pl~~T~~dFW~MVwe~~~~~IVMLt~~~E~g~~kc~~Ywp~~~~~~g~~~V~~~~~~~~  473 (610)
T 1ygr_A          394 YINASFIMSYWKPEVMIAAQGPLKETIGDFWQMIFQRKVKVIVMLTELKHGDQEICAQYWGEGKQTYGDIEVDLKDTDKS  473 (610)
T ss_dssp             CCCEEEEECSSTTCEEEEEECCCTTTHHHHHHHHHHTTCCEEEECSCSEETTEESSCCCCCSSCCEETTEECCEEEEEEC
T ss_pred             ceeeEeeccCCCcccEEEeCCCChhhHHHHHHHHHHcCcCeEEeccccccCCceeccccCCCCCcEeeeEEEEEEEEEec
Confidence                                                12244566653321      112210                  


Q ss_pred             ------hhhh-h--c----------cccCCCC-------------------------------CCCCCeEEecCCCCCcc
Q psy15394        418 ------SLLA-D--L----------GDTWAGH-------------------------------PRGPPIIVHCSAGIGRT  447 (523)
Q Consensus       418 ------~~~~-~--~----------~~~~~~~-------------------------------~~~~pivVHCs~G~gRt  447 (523)
                            .+.. .  .          -..|+++                               ...+|||||||+|+|||
T Consensus       474 ~~~~~r~l~l~~~~~~~~r~V~h~~y~~WPd~gvP~~~~~ll~~i~~v~~~~~~~~~~~~~~~~~~~PivVHCsaGvGRT  553 (610)
T 1ygr_A          474 STYTLRVFELRHSKRKDSRTVYQYQYTNWSVEQLPAEPKELISMIQVVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQT  553 (610)
T ss_dssp             SSEEEEEEEEBCSSCSCCEEEEEEEECSCCSSSCCSCHHHHHHHHHHHHTTSCCCC-------CCCCCEEEEESSSSTTH
T ss_pred             CCeEEEEEEEEECCCCCcEEEEEeeeCCCCCCCCCCCHHHHHHHHHHHHHHhhhhccccccccCCCCCEEEEeCCCCcch
Confidence                  0000 0  0          0246643                               12479999999999999


Q ss_pred             chhhHHHHHHHHHhhcCCCCHHHHHHHHHhccccCCCCHHHHHHHHHHHHHHHH
Q psy15394        448 GTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYAL  501 (523)
Q Consensus       448 g~f~~~~~~~~~~~~~~~v~v~~~v~~lR~qR~~~v~t~~Qy~f~~~~i~~~~~  501 (523)
                      |+|||+++++++++.++.+||+++|+.||.||++||||.+||.|||++|++|+.
T Consensus       554 Gtf~ai~~~l~~~~~~~~vdv~~~V~~lR~qR~~~Vqt~~QY~F~y~~~~~~~~  607 (610)
T 1ygr_A          554 GIFCALLNLLESAETEEVVDIFQVVKALRKARLGMVSTFEQYQFLYDVIASTYP  607 (610)
T ss_dssp             HHHHHHHHHHHHHHHSSBCCHHHHHHHHHHHSTTTTCSHHHHHHHHHHHHHTCC
T ss_pred             hHHHHHHHHHHHHhhCCccCHHHHHHHHHHhCccccCCHHHHHHHHHHHHHHHh
Confidence            999999999999999999999999999999999999999999999999999864
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 523
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 2e-93
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 1e-20
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 6e-93
d1lara1317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 1e-21
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 2e-92
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 2e-25
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 5e-92
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 1e-24
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 6e-92
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 4e-25
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 3e-90
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 1e-23
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 2e-88
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 1e-22
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 7e-88
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 1e-24
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 6e-86
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 3e-24
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 4e-80
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 2e-22
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 4e-80
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 1e-23
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 8e-80
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 7e-22
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 4e-78
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 3e-21
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 1e-35
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 2e-06
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 4e-17
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 1e-07
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 6e-12
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 3e-09
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 2e-09
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 2e-09
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 2e-06
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 5e-06
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 3e-05
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: Tyrosine phosphatase
species: Human (Homo sapiens), 1B [TaxId: 9606]

 Score =  284 bits (728), Expect = 2e-93
 Identities = 105/275 (38%), Positives = 151/275 (54%), Gaps = 20/275 (7%)

Query: 84  EYEGFKIKPPDGSFEVAKRRENLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYINANFVDG 143
            Y+  + +  D    VAK  +N  +NRY DV  +DH+R+ L Q+D    +DYINA+ +  
Sbjct: 18  IYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQED----NDYINASLIKM 73

Query: 144 YKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMT 203
            + + ++I TQGP+ NT   FW MVWEQ++  ++M  RV+E+G  KCAQYWP  E  +M 
Sbjct: 74  EEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMI 133

Query: 204 HGDFLVTTECV--TSSPDYVLSSLTLCNTKTLETRMVAHYQFTAWLDYGVPESALSMLEF 261
             D  +    +       Y +  L L N  T ETR + H+ +T W D+GVPES  S L F
Sbjct: 134 FEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNF 193

Query: 262 LAKARHTQAALLADLGDTWAGHPRGPPIIVHCSAGIGRTGTLCTLDICIS---RLEDSGT 318
           L K R + +             P   P++VHCSAGIGR+GT C  D C+    + +D  +
Sbjct: 194 LFKVRESGSL-----------SPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSS 242

Query: 319 VDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYA 353
           VD++  +  +R  R   IQ  DQ  F +LA+IE A
Sbjct: 243 VDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGA 277
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query523
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 100.0
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 100.0
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 100.0
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 100.0
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 100.0
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 100.0
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 100.0
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 100.0
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 100.0
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 100.0
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 100.0
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.91
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.88
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 99.82
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 99.81
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 99.81
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 99.81
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 99.81
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 99.8
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 99.8
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 99.79
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.78
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 99.78
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 99.76
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 99.73
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.58
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.51
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.42
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.16
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.12
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 98.96
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 98.88
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 98.81
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 98.38
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 98.29
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 98.15
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 98.07
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 97.91
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 97.82
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 97.72
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 97.5
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 97.42
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 97.11
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 94.08
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 92.53
d1zsqa2387 Myotubularin-related protein 2, C-terminal domain 80.22
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: Tyrosine phosphatase
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=2.2e-73  Score=571.79  Aligned_cols=278  Identities=40%  Similarity=0.713  Sum_probs=254.3

Q ss_pred             cccCHHHHHHHHHhcC---hhhHHHHHhhcccCCCCcchhhhccccccCCCCCCCCCCCCCCeeeecCCCCCCCCCceee
Q psy15394         62 QGLSIAEFVEAVRSKG---RSGLCLEYEGFKIKPPDGSFEVAKRRENLFKNRYSDVLAYDHTRVLLSQQDDVPGSDYINA  138 (523)
Q Consensus        62 ~~~~~~~~~~~~~~~~---~~~~~~Ef~~l~~~~~~~~~~~a~~~~N~~KNRy~~i~p~D~sRV~L~~~~~~~~sdYINA  138 (523)
                      .|+++++|.+++.++.   ..+|.+||+.|.......++.++..++|..||||.||+|||+|||+|++.++.+++|||||
T Consensus         3 ~pi~~~~~~~~~~~~~~~~~~~~~~Ef~~l~~~~~~~~~~~~~~~~N~~KNR~~~i~p~D~sRV~L~~~~~~~~~~YINA   82 (288)
T d1yfoa_           3 PPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINA   82 (288)
T ss_dssp             CCEEHHHHHHHHHHHHHHHHHHHHHHHHHSCSCSSCCCCHHHHCGGGGGGCSCTTCCCCTTTBCCCCCCTTCTTTTCCSE
T ss_pred             CCEeHHHHHHHHHHHhhCccHHHHHHHHHhhccCCCCchhhhcChhhhhcCCCCCcccCCCcEEEeCCCCCCCcccccce
Confidence            3789999999887653   3579999999987777788999999999999999999999999999998888888999999


Q ss_pred             eccCCcccccceeecCCCCCCCHHHHHHHHHhcCCcEEEEcCCcccCCccccccccCCCCCCeeEecceeEEEeEEEeCC
Q psy15394        139 NFVDGYKQKNAFISTQGPMQNTVEDFWRMVWEQQTLVIIMTTRVIERGRNKCAQYWPGTEGTKMTHGDFLVTTECVTSSP  218 (523)
Q Consensus       139 s~I~g~~~~~~yIatQ~Pl~~T~~dFW~MVwe~~v~~IVmLt~~~E~~~~kc~~YwP~~~~~~~~~g~~~V~~~~~~~~~  218 (523)
                      |||+|+..+++|||||+|+++|++|||+||||+++.+|||||.+.|.+..+|.+|||.+  +...+|.|+|++.++....
T Consensus        83 s~v~g~~~~~~~I~tQ~Pl~~T~~dFW~MV~~~~~~~IVmL~~~~e~~~~~~~~y~p~~--~~~~~g~~~V~~~~~~~~~  160 (288)
T d1yfoa_          83 SFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQ--GCWTYGNVRVSVEDVTVLV  160 (288)
T ss_dssp             EEEEETTEEEEEEEECCCCGGGHHHHHHHHHHTTCCEEEECSCSEETTEECSCCCSCSS--SEEEETTEEEEEEEEEECS
T ss_pred             EEeecCCCcceEEEecCCCccchhHHHHHHHhccCceEEEeeeeeeCCcccccccCCCC--CCeEecceEEEEEEEEEcC
Confidence            99999998899999999999999999999999999999999999999999999999975  4688999999999999999


Q ss_pred             CceEEEeeeecc----CCCceeEEEEEEEeeeccCCCCCChHHHHHHHHHHHHHHHHHHhhcCCCCCCCCCCCCEEEEcC
Q psy15394        219 DYVLSSLTLCNT----KTLETRMVAHYQFTAWLDYGVPESALSMLEFLAKARHTQAALLADLGDTWAGHPRGPPIIVHCS  294 (523)
Q Consensus       219 ~~~~r~l~l~~~----~~~~~r~V~h~~y~~Wpd~gvP~~~~~ll~fi~~v~~~~~~~~~~~~~~~~~~~~~~PivVHCs  294 (523)
                      +++.|+|.|...    ...++|.|+||||++|||+|+|.++..+++|++.|+..+             ....+||||||+
T Consensus       161 ~~~~r~~~v~~~~~~~~~~~~r~V~h~~y~~Wpd~~~P~~~~~~l~l~~~v~~~~-------------~~~~~PivVHCs  227 (288)
T d1yfoa_         161 DYTVRKFCIQQVGDVTNRKPQRLITQFHFTSWPDFGVPFTPIGMLKFLKKVKACN-------------PQYAGAIVVHCS  227 (288)
T ss_dssp             SEEEEEEEEEC---------CEEEEEEEECCCCSSSCCSCSHHHHHHHHHHHHHS-------------CTTSCCEEEECS
T ss_pred             CEEEEEEEEEecccccCCCccEEEEEEEeCCCCCCCCCCCHHHHHHHHHHHHHhc-------------cccCCcEEEEeC
Confidence            999999998653    234679999999999999999999999999999998653             224579999999


Q ss_pred             CCCchhhHHHHHHHHHHhccCCCccCHHHHHHHHHhccccCccChhHHHHHHHHHHHHHH
Q psy15394        295 AGIGRTGTLCTLDICISRLEDSGTVDVRGTVKRIRSQRAHSIQMRDQYIFCHLALIEYAL  354 (523)
Q Consensus       295 aGvGRTGtfiaid~~l~~l~~~~~vdv~~~v~~lR~qR~~~Vqt~~QY~Fiy~alle~~~  354 (523)
                      +|+||||+|||+++++++++.++.+||+++|+.||+||++||||.+||.|||++|++|++
T Consensus       228 ~G~gRtG~f~al~~~~~~l~~~~~vdv~~~v~~lR~qR~~~V~t~~QY~f~y~~l~~y~l  287 (288)
T d1yfoa_         228 AGVGRTGTFVVIDAMLDMMHSERKVDVYGFVSRIRAQRCQMVQTDMQYVFIYQALLEHYL  287 (288)
T ss_dssp             SSSHHHHHHHHHHHHHHHHHHSSEECHHHHHHHHTTTSTTSSCSHHHHHHHHHHHHHHHH
T ss_pred             CCCcccHHHHHHHHHHHHHHhCCCCCHHHHHHHHHhhccccCCCHHHHHHHHHHHHHHHh
Confidence            999999999999999999999999999999999999999999999999999999999975
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure