Psyllid ID: psy15457

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-
MGEDGDSHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHVLSIIPSTIM
ccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccccccccc
ccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHccccccccc
mgedgdshgrfapgahfsrdcvnrpgfakFFFTSASEEREHAIKFISYLTmrgnltdyhHHVLsiipstim
mgedgdshgrfapgahfsrdcvnRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHVlsiipstim
MGEDGDSHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHVLSIIPSTIM
***************HFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHVLSII*****
MGEDGDSHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHVLSIIPSTI*
MGEDGDSHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHVLSIIPSTIM
*GEDGDSHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHVLSIIP****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGEDGDSHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHVLSIIPSTIM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query71 2.2.26 [Sep-21-2011]
P41822209 Ferritin subunit OS=Aedes N/A N/A 0.577 0.196 0.585 5e-08
P25319173 Ferritin-1 heavy chain OS N/A N/A 0.535 0.219 0.552 7e-06
O46119173 Ferritin heavy chain OS=E N/A N/A 0.690 0.283 0.469 2e-05
Q94FY2250 Ferritin, chloroplastic O N/A N/A 0.633 0.18 0.511 5e-05
P19976250 Ferritin-1, chloroplastic yes N/A 0.633 0.18 0.511 6e-05
Q96540254 Ferritin-1, chloroplastic N/A N/A 0.633 0.177 0.511 6e-05
P29036254 Ferritin-1, chloroplastic N/A N/A 0.549 0.153 0.564 8e-05
O65100256 Ferritin-3, chloroplastic N/A N/A 0.633 0.175 0.488 0.0001
P29390252 Ferritin-2, chloroplastic N/A N/A 0.549 0.154 0.564 0.0001
P49947176 Ferritin, middle subunit N/A N/A 0.535 0.215 0.552 0.0001
>sp|P41822|FRI_AEDAE Ferritin subunit OS=Aedes aegypti GN=FERH PE=1 SV=2 Back     alignment and function desciption
 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 30/41 (73%)

Query: 14  GAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGN 54
            A+F+++ +N PGF KFFF SA+EEREH IK I Y  MRG 
Sbjct: 68  AAYFAQEKINLPGFEKFFFHSAAEEREHGIKLIEYALMRGK 108
Protection against toxic levels of iron. Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation.
Aedes aegypti (taxid: 7159)
EC: 1EC: .EC: 1EC: 6EC: .EC: 3EC: .EC: 1
>sp|P25319|FRIH1_SCHMA Ferritin-1 heavy chain OS=Schistosoma mansoni GN=SCM-1 PE=2 SV=1 Back     alignment and function description
>sp|O46119|FRIH_ECHGR Ferritin heavy chain OS=Echinococcus granulosus PE=2 SV=1 Back     alignment and function description
>sp|Q94FY2|FRI_MALXI Ferritin, chloroplastic OS=Malus xiaojinensis PE=3 SV=1 Back     alignment and function description
>sp|P19976|FRI1_SOYBN Ferritin-1, chloroplastic OS=Glycine max PE=1 SV=4 Back     alignment and function description
>sp|Q96540|FRI1_BRANA Ferritin-1, chloroplastic OS=Brassica napus GN=LSC30 PE=2 SV=1 Back     alignment and function description
>sp|P29036|FRI1_MAIZE Ferritin-1, chloroplastic OS=Zea mays GN=FER1 PE=1 SV=2 Back     alignment and function description
>sp|O65100|FRI3_VIGUN Ferritin-3, chloroplastic OS=Vigna unguiculata PE=2 SV=1 Back     alignment and function description
>sp|P29390|FRI2_MAIZE Ferritin-2, chloroplastic OS=Zea mays GN=FER2 PE=1 SV=2 Back     alignment and function description
>sp|P49947|FRIM_SALSA Ferritin, middle subunit OS=Salmo salar PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
350401074 217 PREDICTED: ferritin subunit-like [Bombus 0.774 0.253 0.709 9e-15
157704373 217 ferritin [Bombus ignitus] 0.774 0.253 0.709 1e-14
332027165 227 Ferritin subunit [Acromyrmex echinatior] 0.661 0.207 0.744 7e-14
67463961 191 Chain M, Crystal Structure Of Trichoplus 0.943 0.350 0.582 8e-14
62722854134 ferritin heavy chain [Trichoplusia ni] 0.943 0.5 0.582 8e-14
31745714 212 ferritin [Leptinotarsa decemlineata] 0.816 0.273 0.655 1e-13
240848575 219 ferritin-like precursor [Acyrthosiphon p 0.647 0.210 0.782 1e-13
322794695 233 hypothetical protein SINV_05488 [Solenop 0.647 0.197 0.739 4e-13
383865759 215 PREDICTED: ferritin subunit-like [Megach 0.647 0.213 0.739 5e-13
21218346 212 ferritin 1 [Apriona germari] 0.633 0.212 0.777 8e-13
>gi|350401074|ref|XP_003486043.1| PREDICTED: ferritin subunit-like [Bombus impatiens] Back     alignment and taxonomy information
 Score = 84.3 bits (207), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 39/55 (70%), Positives = 43/55 (78%)

Query: 11  FAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHVLSI 65
            A GAHF+RD VNRPGF+KFFF SASEEREHAIK I YL MRG+LTD    +L I
Sbjct: 62  LAMGAHFARDTVNRPGFSKFFFDSASEEREHAIKIIEYLLMRGHLTDDVSKLLDI 116

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|157704373|gb|ABV68875.1| ferritin [Bombus ignitus] Back     alignment and taxonomy information
>gi|332027165|gb|EGI67258.1| Ferritin subunit [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|67463961|pdb|1Z6O|M Chain M, Crystal Structure Of Trichoplusia Ni Secreted Ferritin gi|67463962|pdb|1Z6O|N Chain N, Crystal Structure Of Trichoplusia Ni Secreted Ferritin gi|67463963|pdb|1Z6O|O Chain O, Crystal Structure Of Trichoplusia Ni Secreted Ferritin gi|67463964|pdb|1Z6O|P Chain P, Crystal Structure Of Trichoplusia Ni Secreted Ferritin gi|67463965|pdb|1Z6O|Q Chain Q, Crystal Structure Of Trichoplusia Ni Secreted Ferritin gi|67463966|pdb|1Z6O|R Chain R, Crystal Structure Of Trichoplusia Ni Secreted Ferritin gi|67463967|pdb|1Z6O|S Chain S, Crystal Structure Of Trichoplusia Ni Secreted Ferritin gi|67463968|pdb|1Z6O|T Chain T, Crystal Structure Of Trichoplusia Ni Secreted Ferritin gi|67463969|pdb|1Z6O|U Chain U, Crystal Structure Of Trichoplusia Ni Secreted Ferritin gi|67463970|pdb|1Z6O|V Chain V, Crystal Structure Of Trichoplusia Ni Secreted Ferritin gi|67463971|pdb|1Z6O|W Chain W, Crystal Structure Of Trichoplusia Ni Secreted Ferritin gi|67463972|pdb|1Z6O|X Chain X, Crystal Structure Of Trichoplusia Ni Secreted Ferritin Back     alignment and taxonomy information
>gi|62722854|gb|AAX94728.1| ferritin heavy chain [Trichoplusia ni] Back     alignment and taxonomy information
>gi|31745714|gb|AAP57194.1| ferritin [Leptinotarsa decemlineata] Back     alignment and taxonomy information
>gi|240848575|ref|NP_001155797.1| ferritin-like precursor [Acyrthosiphon pisum] gi|239788704|dbj|BAH71020.1| ACYPI009403 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|322794695|gb|EFZ17668.1| hypothetical protein SINV_05488 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383865759|ref|XP_003708340.1| PREDICTED: ferritin subunit-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|21218346|gb|AAM44043.1|AF509878_1 ferritin 1 [Apriona germari] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query71
FB|FBgn0015222205 Fer1HCH "Ferritin 1 heavy chai 0.718 0.248 0.607 3.9e-12
FB|FBgn0030449186 Fer3HCH "Ferritin 3 heavy chai 0.830 0.317 0.375 1e-06
ZFIN|ZDB-GENE-080722-16175 zgc:194125 "zgc:194125" [Danio 0.549 0.222 0.575 2.6e-06
ZFIN|ZDB-GENE-050522-428175 zgc:109934 "zgc:109934" [Danio 0.549 0.222 0.575 3.4e-06
ZFIN|ZDB-GENE-071004-86175 zgc:173594 "zgc:173594" [Danio 0.549 0.222 0.575 3.4e-06
ZFIN|ZDB-GENE-040718-72226 zgc:92066 "zgc:92066" [Danio r 0.535 0.168 0.552 1.1e-05
ZFIN|ZDB-GENE-030131-7540175 zgc:198419 "zgc:198419" [Danio 0.549 0.222 0.55 3.8e-05
TAIR|locus:2149755255 FER1 "ferretin 1" [Arabidopsis 0.633 0.176 0.488 4e-05
ZFIN|ZDB-GENE-040912-30177 fth1b "ferritin, heavy polypep 0.563 0.225 0.5 9.1e-05
ZFIN|ZDB-GENE-071004-57175 zgc:173593 "zgc:173593" [Danio 0.549 0.222 0.525 0.00015
FB|FBgn0015222 Fer1HCH "Ferritin 1 heavy chain homologue" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 163 (62.4 bits), Expect = 3.9e-12, P = 3.9e-12
 Identities = 31/51 (60%), Positives = 38/51 (74%)

Query:     7 SHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTD 57
             S+   A GA+FSRD VNRPGFA+ FF +A EEREH  K + YL+MRG LT+
Sbjct:    56 SYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTE 106
GO:0008043 "intracellular ferritin complex" evidence=ISS;NAS;IDA
GO:0006879 "cellular iron ion homeostasis" evidence=ISS;NAS;IDA
GO:0008198 "ferrous iron binding" evidence=ISS;NAS;IDA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0008199 "ferric iron binding" evidence=IEA
GO:0006826 "iron ion transport" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005576 "extracellular region" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
GO:0045169 "fusome" evidence=IDA
GO:0009791 "post-embryonic development" evidence=IMP
GO:0008283 "cell proliferation" evidence=IDA
FB|FBgn0030449 Fer3HCH "Ferritin 3 heavy chain homologue" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080722-16 zgc:194125 "zgc:194125" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-428 zgc:109934 "zgc:109934" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-86 zgc:173594 "zgc:173594" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-72 zgc:92066 "zgc:92066" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7540 zgc:198419 "zgc:198419" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2149755 FER1 "ferretin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040912-30 fth1b "ferritin, heavy polypeptide 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-57 zgc:173593 "zgc:173593" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P19976FRI1_SOYBN1, ., 1, 6, ., 3, ., 10.51110.63380.18yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
cd01056161 cd01056, Euk_Ferritin, eukaryotic ferritins 3e-20
pfam00210142 pfam00210, Ferritin, Ferritin-like domain 2e-08
cd01055156 cd01055, Nonheme_Ferritin, nonheme-containing ferr 4e-08
COG1528167 COG1528, Ftn, Ferritin-like protein [Inorganic ion 5e-07
cd00904160 cd00904, Ferritin, Ferritin iron storage proteins 1e-06
>gnl|CDD|153114 cd01056, Euk_Ferritin, eukaryotic ferritins Back     alignment and domain information 
 Score = 78.0 bits (193), Expect = 3e-20
 Identities = 23/45 (51%), Positives = 25/45 (55%)

Query: 14 GAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDY 58
           A+F RD V  PGFAKFF   + EEREHA K I Y   RG     
Sbjct: 26 AAYFDRDDVALPGFAKFFRKLSDEEREHAEKLIKYQNKRGGRVVL 70

Eukaryotic Ferritin (Euk_Ferritin) domain. Ferritins are the primary iron storage proteins of most living organisms and members of a broad superfamily of ferritin-like diiron-carboxylate proteins. The iron-free (apoferritin) ferritin molecule is a protein shell composed of 24 protein chains arranged in 432 symmetry. Iron storage involves the uptake of iron (II) at the protein shell, its oxidation by molecular oxygen at the dinuclear ferroxidase centers, and the movement of iron (III) into the cavity for deposition as ferrihydrite; the protein shell can hold up to 4500 iron atoms. In vertebrates, two types of chains (subunits) have been characterized, H or M (fast) and L (slow), which differ in rates of iron uptake and mineralization. Fe(II) oxidation in the H/M subunits take place initially at the ferroxidase center, a carboxylate-bridged diiron center, located within the subunit four-helix bundle. In a complementary role, negatively charged residues on the protein shell inner surface of the L subunits promote ferrihydrite nucleation. Most plant ferritins combine both oxidase and nucleation functions in one chain: they have four interior glutamate residues as well as seven ferroxidase center residues. Length = 161
>gnl|CDD|215791 pfam00210, Ferritin, Ferritin-like domain Back     alignment and domain information
>gnl|CDD|153113 cd01055, Nonheme_Ferritin, nonheme-containing ferritins Back     alignment and domain information
>gnl|CDD|224445 COG1528, Ftn, Ferritin-like protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|153098 cd00904, Ferritin, Ferritin iron storage proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 71
PRK15022167 ferritin-like protein; Provisional 99.87
cd00904160 Ferritin Ferritin iron storage proteins. Ferritins 99.83
KOG2332|consensus178 99.8
cd01056161 Euk_Ferritin eukaryotic ferritins. Eukaryotic Ferr 99.8
PRK10304165 ferritin; Provisional 99.79
COG1528167 Ftn Ferritin-like protein [Inorganic ion transport 99.78
cd01055156 Nonheme_Ferritin nonheme-containing ferritins. Non 99.63
cd01041134 Rubrerythrin Rubrerythrin, ferritin-like diiron-bi 99.37
PF00210142 Ferritin: Ferritin-like domain; InterPro: IPR00833 99.19
TIGR00754157 bfr bacterioferritin. Bacterioferritin is a homomu 99.14
cd00907153 Bacterioferritin Bacterioferritin, ferritin-like d 99.12
PRK10635158 bacterioferritin; Provisional 99.04
cd01046123 Rubrerythrin_like rubrerythrin-like, diiron-bindin 98.93
cd01052148 DPSL DPS-like protein, ferritin-like diiron-bindin 98.78
cd00657130 Ferritin_like Ferritin-like superfamily of diiron- 97.87
PF02915137 Rubrerythrin: Rubrerythrin; InterPro: IPR003251 Ru 97.22
cd07908154 Mn_catalase_like Manganese catalase-like protein, 97.04
PRK13456186 DNA protection protein DPS; Provisional 96.77
cd01045139 Ferritin_like_AB Uncharacterized family of ferriti 96.6
COG1592166 Rubrerythrin [Energy production and conversion] 96.47
cd01044125 Ferritin_CCC1_N Ferritin-CCC1, N-terminal ferritin 96.34
COG2193157 Bfr Bacterioferritin (cytochrome b1) [Inorganic io 95.26
COG1633176 Uncharacterized conserved protein [Function unknow 93.38
cd01043139 DPS DPS protein, ferritin-like diiron-binding doma 92.74
cd01042165 DMQH Demethoxyubiquinone hydroxylase, ferritin-lik 92.56
cd01051156 Mn_catalase Manganese catalase, ferritin-like diir 91.17
PF09537111 DUF2383: Domain of unknown function (DUF2383); Int 89.17
PF03232172 COQ7: Ubiquinone biosynthesis protein COQ7; InterP 87.88
PF0787564 Coat_F: Coat F domain; InterPro: IPR012851 The Coa 87.18
TIGR02284139 conserved hypothetical protein. Members of this pr 86.8
cd01046123 Rubrerythrin_like rubrerythrin-like, diiron-bindin 82.61
>PRK15022 ferritin-like protein; Provisional Back     alignment and domain information 
Probab=99.87  E-value=7.2e-23  Score=137.18  Aligned_cols=54  Identities=15%  Similarity=0.100  Sum_probs=52.0

Q ss_pred             chhHHhhHhhhhhccccccccCChhHHHHHHHHHHHHHHHHHHHHHHHHHhCCccc
Q psy15457          2 GEDGDSHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTD   57 (71)
Q Consensus         2 ~El~aS~~YLsma~~f~~~~~~l~Gfa~fF~~qs~eE~ehA~~l~~yl~~RGg~v~   57 (71)
                      .|++|||+|||||+||++  .+||||++||+.||+|||+||+||++|+++|||+|.
T Consensus        16 ~E~~aSy~YLsMa~~~~~--~~L~GfA~ff~~qa~EEreHA~k~~~yl~~rGg~v~   69 (167)
T PRK15022         16 LEFYASNLYLHLSEWCSE--QSLNGTATFLRAQAQSNVTQMMRMFNFMKSAGATPI   69 (167)
T ss_pred             HHHHHHHHHHHHHHHHHh--CCChhHHHHHHHHHHHHHHHHHHHHHHHHHcCCcee
Confidence            589999999999999986  599999999999999999999999999999999998

>cd00904 Ferritin Ferritin iron storage proteins Back     alignment and domain information
>KOG2332|consensus Back     alignment and domain information
>cd01056 Euk_Ferritin eukaryotic ferritins Back     alignment and domain information
>PRK10304 ferritin; Provisional Back     alignment and domain information
>COG1528 Ftn Ferritin-like protein [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01055 Nonheme_Ferritin nonheme-containing ferritins Back     alignment and domain information
>cd01041 Rubrerythrin Rubrerythrin, ferritin-like diiron-binding domain Back     alignment and domain information
>PF00210 Ferritin: Ferritin-like domain; InterPro: IPR008331 Ferritin is one of the major non-haem iron storage proteins in animals, plants, and microorganisms [] Back     alignment and domain information
>TIGR00754 bfr bacterioferritin Back     alignment and domain information
>cd00907 Bacterioferritin Bacterioferritin, ferritin-like diiron-binding domain Back     alignment and domain information
>PRK10635 bacterioferritin; Provisional Back     alignment and domain information
>cd01046 Rubrerythrin_like rubrerythrin-like, diiron-binding domain Back     alignment and domain information
>cd01052 DPSL DPS-like protein, ferritin-like diiron-binding domain Back     alignment and domain information
>cd00657 Ferritin_like Ferritin-like superfamily of diiron-containing four-helix-bundle proteins Back     alignment and domain information
>PF02915 Rubrerythrin: Rubrerythrin; InterPro: IPR003251 Rubrerythrin (Rr), found in anaerobic sulphate-reducing bacteria [], is a fusion protein containing an N-terminal diiron-binding domain and a C-terminal domain homologous to rubredoxin [] Back     alignment and domain information
>cd07908 Mn_catalase_like Manganese catalase-like protein, ferritin-like diiron-binding domain Back     alignment and domain information
>PRK13456 DNA protection protein DPS; Provisional Back     alignment and domain information
>cd01045 Ferritin_like_AB Uncharacterized family of ferritin-like proteins found in archaea and bacteria Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>cd01044 Ferritin_CCC1_N Ferritin-CCC1, N-terminal ferritin-like diiron-binding domain Back     alignment and domain information
>COG2193 Bfr Bacterioferritin (cytochrome b1) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1633 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01043 DPS DPS protein, ferritin-like diiron-binding domain Back     alignment and domain information
>cd01042 DMQH Demethoxyubiquinone hydroxylase, ferritin-like diiron-binding domain Back     alignment and domain information
>cd01051 Mn_catalase Manganese catalase, ferritin-like diiron-binding domain Back     alignment and domain information
>PF09537 DUF2383: Domain of unknown function (DUF2383); InterPro: IPR019052 This entry represents a functionally uncharacterised ferritin like domain Back     alignment and domain information
>PF03232 COQ7: Ubiquinone biosynthesis protein COQ7; InterPro: IPR011566 Coq7 (also known as Clk-1) is a di-iron carboxylate protein occuring in both prokaryotes and eukaryotes that is essential for ubiquinone biosynthesis [, ] Back     alignment and domain information
>PF07875 Coat_F: Coat F domain; InterPro: IPR012851 The Coat F proteins contribute to the Bacillales spore coat Back     alignment and domain information
>TIGR02284 conserved hypothetical protein Back     alignment and domain information
>cd01046 Rubrerythrin_like rubrerythrin-like, diiron-binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
1z6o_M191 Crystal Structure Of Trichoplusia Ni Secreted Ferri 2e-16
3vnx_A204 Crystal Structure Of Ferritin From Multicellular Gr 4e-06
3a9q_A212 Crystal Structure Analysis Of E173a Variant Of The 2e-05
3a68_A212 Crystal Structure Of Plant Ferritin Reveals A Novel 2e-05
1rcd_A173 Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Lengt 1e-04
1rci_A173 Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Lengt 1e-04
>pdb|1Z6O|M Chain M, Crystal Structure Of Trichoplusia Ni Secreted Ferritin Length = 191 Back     alignment and structure 
Iteration: 1

 Score = 80.9 bits (198), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 46/67 (68%)
Query: 3  EDGDSHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHV 62
          E G S    A GAHFS+D VNRPGFA+ FF +ASEEREHA+K I YL MRG LT+    +
Sbjct: 32 EVGASLQYLAMGAHFSKDVVNRPGFAQLFFDAASEEREHAMKLIEYLLMRGELTNDVSSL 91
Query: 63 LSIIPST 69
          L + P T
Sbjct: 92 LQVRPPT 98
>pdb|3VNX|A Chain A, Crystal Structure Of Ferritin From Multicellular Green Algae, Ulva Pertusa Length = 204 Back     alignment and structure
>pdb|3A9Q|A Chain A, Crystal Structure Analysis Of E173a Variant Of The Soybean Ferritin Sfer4 Length = 212 Back     alignment and structure
>pdb|3A68|A Chain A, Crystal Structure Of Plant Ferritin Reveals A Novel Metal Binding Site That Functions As A Transit Site For Metal Transfer In Ferritin Length = 212 Back     alignment and structure
>pdb|1RCD|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Length = 173 Back     alignment and structure
>pdb|1RCI|A Chain A, Bullfrog Red Cell L Ferritin TartrateMGPH 5.5 Length = 173 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query71
1z6o_M191 Ferritin heavy chain; metal binding protein, iron 7e-17
1rcd_A173 L ferritin; iron storage; 2.00A {Rana catesbeiana} 1e-13
2cih_A183 Ferritin heavy chain; apoferritin, ferroxidase, DI 4e-13
3vnx_A204 Ferritin; 4-helix bundle, iron storage, oxidoreduc 5e-13
3a68_A212 Sferh-4, ferritin-4, chloroplastic; 4-helix bundle 7e-13
3ka8_A176 Ferritin, middle subunit; iron storage, DIIRON, ir 1e-12
2v2p_A174 Ferritin light chain; metal transport, iron, haemi 5e-12
3oj5_A 189 Ferritin family protein; ferroxidase, cytosol, oxi 9e-12
3e6s_A168 Ferritin; iron storage, ferroxidase, oxidoreductas 1e-11
3kxu_A191 Ferritin; iron storage protein, disorder, iron, me 1e-11
1eum_A165 Ferritin 1; ECFTNA, metal binding protein; 2.05A { 3e-11
1krq_A167 Ferritin; H-chain like four-helix bundle, binding 3e-11
3bvf_A181 Ferritin; iron storage, metal-binding, oxidoreduct 3e-11
2jd6_0174 Ferritin homolog, ferritin; metal transport, iron, 5e-11
1vlg_A176 Ferritin; TM1128, structural genomics, JCSG, prote 6e-11
1s3q_A173 Ferritin; ferroxidase, four helix bundle, iron sto 8e-11
1z6o_A212 Ferritin light chain; metal binding protein, iron 1e-10
3qz3_A184 Ferritin; structural genomics, the center for stru 2e-10
>1z6o_M Ferritin heavy chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Length = 191 Back     alignment and structure
 Score = 69.3 bits (170), Expect = 7e-17
 Identities = 34/54 (62%), Positives = 41/54 (75%)

Query: 14 GAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHVLSIIP 67
          GAHFS+D VNRPGFA+ FF +ASEEREHA+K I YL MRG LT+    +L + P
Sbjct: 43 GAHFSKDVVNRPGFAQLFFDAASEEREHAMKLIEYLLMRGELTNDVSSLLQVRP 96
>1rcd_A L ferritin; iron storage; 2.00A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 1rcg_A 1rci_A 1rcc_A 1rce_A Length = 173 Back     alignment and structure
>2cih_A Ferritin heavy chain; apoferritin, ferroxidase, DI-iron non-heme protein, iron storage, iron, metal-binding, oxidoreductase, phosphorylation; 1.5A {Homo sapiens} PDB: 2chi_A 2cei_A 1fha_A 2fha_A 2cn7_A 2iu2_A 2clu_A 2cn6_A 3ajo_A 3ajq_A 3ajp_A 3erz_A 3es3_A 2z6m_A 1r03_A Length = 183 Back     alignment and structure
>3vnx_A Ferritin; 4-helix bundle, iron storage, oxidoreductase; 2.40A {Ulva pertusa} Length = 204 Back     alignment and structure
>3a68_A Sferh-4, ferritin-4, chloroplastic; 4-helix bundle, iron storage, CAGE-like protein, plant, iron, metal-binding, oxidoreductase, plastid; 1.80A {Glycine max} PDB: 3a9q_A Length = 212 Back     alignment and structure
>3ka8_A Ferritin, middle subunit; iron storage, DIIRON, iron, metal-binding, oxidoreductase; 1.35A {Rana catesbeiana} PDB: 3ka9_A 3ka3_A 1mfr_A 3ka4_A 3rbc_A 3re7_A 3rgd_A 3ka6_A 3shx_A 3sh6_A 3se1_A 1bg7_A Length = 176 Back     alignment and structure
>2v2p_A Ferritin light chain; metal transport, iron, haemin, apoferritin, iron storage, metal-binding; 1.15A {Equus caballus} PDB: 2v2r_A 2v2m_A 2v2l_A 2v2s_A 2v2o_A 2v2n_A 2za6_A 2v2j_A 2v2i_A 2z5p_A 1dat_A 2g4h_A 1aew_A 3h7g_A 2zg9_X 2zg8_X 3fi6_A 3o7r_A 2w0o_A 1hrs_A* ... Length = 174 Back     alignment and structure
>3oj5_A Ferritin family protein; ferroxidase, cytosol, oxidoreductase; 2.85A {Mycobacterium tuberculosis} PDB: 3qd8_A Length = 189 Back     alignment and structure
>3e6s_A Ferritin; iron storage, ferroxidase, oxidoreductase; 1.95A {Pseudo-nitzschia multiseries} PDB: 3e6r_A Length = 168 Back     alignment and structure
>3kxu_A Ferritin; iron storage protein, disorder, iron, metal binding protein; 1.85A {Homo sapiens} PDB: 3hx2_A 3hx5_A 3hx7_A Length = 191 Back     alignment and structure
>1eum_A Ferritin 1; ECFTNA, metal binding protein; 2.05A {Escherichia coli} SCOP: a.25.1.1 Length = 165 Back     alignment and structure
>1krq_A Ferritin; H-chain like four-helix bundle, binding protein; 2.70A {Campylobacter jejuni} SCOP: a.25.1.1 Length = 167 Back     alignment and structure
>2jd6_0 Ferritin homolog, ferritin; metal transport, iron, pores, archaeon, entry channels, thermostability, hyperthermophIle, ferroxidase center; 2.75A {Pyrococcus furiosus} PDB: 2jd7_0 2jd8_0 2x17_0 Length = 174 Back     alignment and structure
>1vlg_A Ferritin; TM1128, structural genomics, JCSG, protein structu initiative, PSI, joint center for structural genomics, META protein; 2.00A {Thermotoga maritima} SCOP: a.25.1.1 PDB: 1z4a_A* Length = 176 Back     alignment and structure
>1s3q_A Ferritin; ferroxidase, four helix bundle, iron storage, metal binding; 2.10A {Archaeoglobus fulgidus} SCOP: a.25.1.1 PDB: 1sq3_A 3kx9_A Length = 173 Back     alignment and structure
>1z6o_A Ferritin light chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Length = 212 Back     alignment and structure
>3qz3_A Ferritin; structural genomics, the center for structural genomics of I diseases, csgid, cytoplasmic, oxidoreductase; 2.10A {Vibrio cholerae o1 biovar el tor} Length = 184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
1z6o_M191 Ferritin heavy chain; metal binding protein, iron 99.85
3kxu_A191 Ferritin; iron storage protein, disorder, iron, me 99.84
1z6o_A212 Ferritin light chain; metal binding protein, iron 99.84
3ka8_A176 Ferritin, middle subunit; iron storage, DIIRON, ir 99.84
3vnx_A204 Ferritin; 4-helix bundle, iron storage, oxidoreduc 99.83
2cih_A183 Ferritin heavy chain; apoferritin, ferroxidase, DI 99.82
1rcd_A173 L ferritin; iron storage; 2.00A {Rana catesbeiana} 99.82
2v2p_A174 Ferritin light chain; metal transport, iron, haemi 99.81
3a68_A212 Sferh-4, ferritin-4, chloroplastic; 4-helix bundle 99.81
3e6s_A168 Ferritin; iron storage, ferroxidase, oxidoreductas 99.81
1s3q_A173 Ferritin; ferroxidase, four helix bundle, iron sto 99.76
3uno_A 189 Probable bacterioferritin BFRB; ferroxidase activi 99.75
3qz3_A184 Ferritin; structural genomics, the center for stru 99.75
1eum_A165 Ferritin 1; ECFTNA, metal binding protein; 2.05A { 99.73
1krq_A167 Ferritin; H-chain like four-helix bundle, binding 99.71
3bvf_A181 Ferritin; iron storage, metal-binding, oxidoreduct 99.61
4am5_A159 Bacterioferritin; metal binding protein, ferroxida 99.54
1vlg_A176 Ferritin; TM1128, structural genomics, JCSG, prote 99.54
2jd6_0174 Ferritin homolog, ferritin; metal transport, iron, 99.46
1lko_A 191 Rubrerythrin all-iron(II) form; reduced form, DIIR 99.39
3oj5_A 189 Ferritin family protein; ferroxidase, cytosol, oxi 99.38
3r2k_A154 Bacterioferritin, BFR; bacterial ferritin, iron bi 99.28
1j30_A144 144AA long hypothetical rubrerythrin; sulerythrin, 99.25
3uoi_A161 Bacterioferritin, BFR; structural genomics, TB str 99.24
2y3q_A158 Bacterioferritin; metal binding protein, redox; HE 99.16
3qb9_A174 Bacterioferritin, BFR; cytosol, structural genomic 99.16
3gvy_A161 Bacterioferritin; iron storage, DI-iron, ferroxida 99.14
2vzb_A170 Putative bacterioferritin-related protein; DPS, DP 99.14
3fvb_A182 Bacterioferritin; niaid, ssgcid, decode, structura 99.13
1jgc_A161 Bacterioferritin, BFR; iron storage protein, metal 99.12
2fkz_A155 Bacterioferritin; ferroxidase, DIIRON site, iron T 99.09
2qqy_A149 Sigma B operon; dodecameric alpha-helical, ferriti 99.09
1nfv_A179 Bacterioferritin; 24 subunits in the active molecu 99.05
1ji5_A142 DLP-1; dodecamer, four-helix bundle, metal transpo 98.9
2c41_A158 DPS family DNA-binding stress response protein; ir 98.85
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 98.79
2vxx_A192 Starvation induced DNA binding protein; stress res 98.7
1jig_A146 DLP-2; dodecamer, four-helix bundle, metal transpo 98.51
1n1q_A149 DPS protein; four-helix bundle, unknown function; 98.49
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 98.46
2d5k_A156 DPS, DPS family protein; four helix bundle, metal 98.46
4di0_A144 Rubrerythrin; ssgcid, seattle structural genomics 98.42
2clb_A188 DPS-like protein; DI-iron carboxylate, hypothetica 98.35
1tjo_A182 Iron-rich DPSA-homolog protein; ferritin, low-iron 98.01
3qhb_A179 Symerythrin, ORF180; four-helix bundle, carboxylat 96.53
2fzf_A175 Hypothetical protein; structural genomics, southea 96.44
2oh3_A167 Rubrerythrin, COG1633: uncharacterized conserved p 96.05
1zpy_A95 Hypothetical protein NE0167; structural genomics, 95.51
3k6c_A95 Uncharacterized protein NE0167; structural genomic 94.8
2bk6_A156 Non-heme iron-containing ferritin; DPS (DNA bindin 94.28
2fjc_A156 Antigen TPF1; mini ferritin, iron binding protein, 94.18
1o9r_A162 Agrobacterium tumefaciens DPS; iron-binding protei 94.14
2chp_A153 MRGA, metalloregulation DNA-binding stress protein 93.83
2yjk_A161 AFP, DPS; metal-binding protein, iron uptake, ferr 93.69
1vjx_A157 Putative ferritin-like DIIRON-carboxylate protein; 93.6
4di0_A144 Rubrerythrin; ssgcid, seattle structural genomics 93.43
1vjx_A157 Putative ferritin-like DIIRON-carboxylate protein; 93.3
2z90_A161 Starvation-inducible DNA-binding protein or FINE t 92.68
2yw6_A183 DNA protection during starvation protein; DNA-bind 92.48
3ak8_A167 DNA protection during starvation protein; DPS-like 92.38
2c2j_A211 DNA-binding stress response protein; DNA-binding p 92.32
2cf7_A165 DPR; peroxide resistance, DPS-family, ferritin-lik 92.17
2c2u_A207 DPS, DNA-binding stress response protein; DNA-bind 92.1
2pyb_A151 NAPA, neutrophil activating protein; ferritin, DPS 91.82
2wlu_A175 DPS-like peroxide resistance protein; DNA-binding, 91.62
4etr_A153 Putative uncharacterized protein; DUF2383, domain 90.95
2xgw_A199 Peroxide resistance protein; metal binding protein 90.62
1j30_A144 144AA long hypothetical rubrerythrin; sulerythrin, 90.56
2fzf_A175 Hypothetical protein; structural genomics, southea 88.63
3fse_A365 Two-domain protein containing DJ-1/THIJ/PFPI-like 87.59
3iq1_A159 DPS family protein; csgid, SAD, niaid, metal trans 87.57
4eve_A164 Neutrophil-activating protein; dodecamer, four-hel 85.26
3kwo_A152 Putative bacterioferritin; alpha-helix, bacterial 85.03
3qhb_A179 Symerythrin, ORF180; four-helix bundle, carboxylat 84.06
2oh3_A167 Rubrerythrin, COG1633: uncharacterized conserved p 82.42
2qqy_A149 Sigma B operon; dodecameric alpha-helical, ferriti 81.19
2e0z_A 345 Virus-like particle; bacteriophage, HK97; 3.60A {P 80.56
>1z6o_M Ferritin heavy chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Back     alignment and structure
Probab=99.85  E-value=8.9e-22  Score=131.75  Aligned_cols=60  Identities=60%  Similarity=0.886  Sum_probs=55.9

Q ss_pred             chhHHhhHhhhhhccccccccCChhHHHHHHHHHHHHHHHHHHHHHHHHHhCCccccccc
Q psy15457          2 GEDGDSHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHH   61 (71)
Q Consensus         2 ~El~aS~~YLsma~~f~~~~~~l~Gfa~fF~~qs~eE~ehA~~l~~yl~~RGg~v~~~~~   61 (71)
                      .||+||+.|++||+||+++++++|||++||+.+|+|||+||++|++|+++|||+|.++..
T Consensus        31 ~El~As~~Yl~ma~~f~~~~~~l~g~a~~f~~~s~EE~~HA~kli~yi~~rGg~~~~~~~   90 (191)
T 1z6o_M           31 MEVGASLQYLAMGAHFSKDVVNRPGFAQLFFDAASEEREHAMKLIEYLLMRGELTNDVSS   90 (191)
T ss_dssp             HHHHHHHHHHHHHHHHHSTTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCSSCCGG
T ss_pred             HHHHHHHHHHHHHHHHCcccCChHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcchhhh
Confidence            489999999999999999889999999999999999999999999999999999954433
>3kxu_A Ferritin; iron storage protein, disorder, iron, metal binding protein; 1.85A {Homo sapiens} PDB: 3hx2_A 3hx5_A 3hx7_A Back     alignment and structure
>1z6o_A Ferritin light chain; metal binding protein, iron storage; 1.91A {Trichoplusia NI} SCOP: a.25.1.1 Back     alignment and structure
>3ka8_A Ferritin, middle subunit; iron storage, DIIRON, iron, metal-binding, oxidoreductase; 1.35A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 3ka9_A 3ka3_A 1mfr_A 3ka4_A 3rbc_A 3re7_A 3rgd_A 4das_A* 3ka6_A 3shx_A 3sh6_A 3se1_A 1bg7_A Back     alignment and structure
>3vnx_A Ferritin; 4-helix bundle, iron storage, oxidoreductase; 2.40A {Ulva pertusa} Back     alignment and structure
>2cih_A Ferritin heavy chain; apoferritin, ferroxidase, DI-iron non-heme protein, iron storage, iron, metal-binding, oxidoreductase, phosphorylation; 1.5A {Homo sapiens} PDB: 2chi_A 2cei_A 1fha_A 2fha_A 2cn7_A 2iu2_A 2clu_A 2cn6_A 3ajo_A 3ajq_A 3ajp_A 3erz_A 3es3_A 2z6m_A 1r03_A Back     alignment and structure
>1rcd_A L ferritin; iron storage; 2.00A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 1rcg_A 1rci_A 1rcc_A 1rce_A Back     alignment and structure
>2v2p_A Ferritin light chain; metal transport, iron, haemin, apoferritin, iron storage, metal-binding; 1.15A {Equus caballus} PDB: 2v2r_A 2v2m_A 2v2l_A 2v2s_A 2v2o_A 2v2n_A 2za6_A 2v2j_A 2v2i_A 2z5p_A 1dat_A 2g4h_A 1aew_A 3h7g_A 2zg9_X 2zg8_X 3fi6_A 3o7r_A 2w0o_A 1hrs_A* ... Back     alignment and structure
>3a68_A Sferh-4, ferritin-4, chloroplastic; 4-helix bundle, iron storage, CAGE-like protein, plant, iron, metal-binding, oxidoreductase, plastid; 1.80A {Glycine max} PDB: 3a9q_A Back     alignment and structure
>3e6s_A Ferritin; iron storage, ferroxidase, oxidoreductase; 1.95A {Pseudo-nitzschia multiseries} SCOP: a.25.1.1 PDB: 3e6r_A Back     alignment and structure
>1s3q_A Ferritin; ferroxidase, four helix bundle, iron storage, metal binding; 2.10A {Archaeoglobus fulgidus} SCOP: a.25.1.1 PDB: 1sq3_A 3kx9_A Back     alignment and structure
>3uno_A Probable bacterioferritin BFRB; ferroxidase activity, iron storage, oxidoreductase; 2.50A {Mycobacterium tuberculosis} PDB: 3oj5_A 3qd8_A Back     alignment and structure
>3qz3_A Ferritin; structural genomics, the center for structural genomics of I diseases, csgid, cytoplasmic, oxidoreductase; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: a.25.1.1 Back     alignment and structure
>1eum_A Ferritin 1; ECFTNA, metal binding protein; 2.05A {Escherichia coli} SCOP: a.25.1.1 Back     alignment and structure
>1krq_A Ferritin; H-chain like four-helix bundle, binding protein; 2.70A {Campylobacter jejuni} SCOP: a.25.1.1 Back     alignment and structure
>4am5_A Bacterioferritin; metal binding protein, ferroxidase centre, iron storage, DI centre, iron channel, heme binding; HET: HEM; 1.58A {Blastochloris viridis} PDB: 4am2_A* 4am4_A* Back     alignment and structure
>1vlg_A Ferritin; TM1128, structural genomics, JCSG, protein structu initiative, PSI, joint center for structural genomics, META protein; 2.00A {Thermotoga maritima} SCOP: a.25.1.1 PDB: 1z4a_A* Back     alignment and structure
>2jd6_0 Ferritin homolog, ferritin; metal transport, iron, pores, archaeon, entry channels, thermostability, hyperthermophIle, ferroxidase center; 2.75A {Pyrococcus furiosus} PDB: 2jd7_0 2jd8_0 2x17_0 Back     alignment and structure
>1lko_A Rubrerythrin all-iron(II) form; reduced form, DIIRON, four-helix bundle, rubre like, electron transport; 1.63A {Desulfovibrio vulgaris} SCOP: a.25.1.1 g.41.5.1 PDB: 1dvb_A 1jyb_A 1b71_A 1lkm_A 1lkp_A 1qyb_A 1s2z_A 1s30_A 1ryt_A Back     alignment and structure
>3oj5_A Ferritin family protein; ferroxidase, cytosol, oxidoreductase; 2.85A {Mycobacterium tuberculosis} PDB: 3qd8_A Back     alignment and structure
>3r2k_A Bacterioferritin, BFR; bacterial ferritin, iron binding, iron storage, iron homeost iron release, iron mobilization; 1.55A {Pseudomonas aeruginosa} SCOP: a.25.1.0 PDB: 3r2h_A 3r2l_A 3r2m_A 3r2o_A 3r2r_A 3r2s_A Back     alignment and structure
>1j30_A 144AA long hypothetical rubrerythrin; sulerythrin, sulfolobus tokodaii strain 7, FOU bundle, domain swapping, metal binding site plasticity; 1.70A {Sulfolobus tokodaii} SCOP: a.25.1.1 Back     alignment and structure
>3uoi_A Bacterioferritin, BFR; structural genomics, TB structural genomics consortium, TBSG ferroxidation and iron storage, cytosol; HET: HEM; 1.90A {Mycobacterium tuberculosis} PDB: 3uof_A* 3qb9_A* 2wtl_A* 3bkn_A* Back     alignment and structure
>2y3q_A Bacterioferritin; metal binding protein, redox; HET: HEM; 1.55A {Escherichia coli} PDB: 1bfr_A* 1bcf_A* 2htn_A* 2vxi_A* 3e1j_A* 3e1l_A* 3e1m_A* 3e1n_A* 3e1o_A* 3e1p_A* 3ghq_A* 3e1q_A* 3e2c_A* 3isf_A* 3is8_A* 3ise_A* 3is7_A* Back     alignment and structure
>3qb9_A Bacterioferritin, BFR; cytosol, structural genomics, TB structural genomics consort TBSGC, metal binding protein; HET: HEM; 2.11A {Mycobacterium tuberculosis} PDB: 2wtl_A* 3bkn_A* Back     alignment and structure
>3gvy_A Bacterioferritin; iron storage, DI-iron, ferroxida activity, heme, metal binding protein; HET: HEM; 2.80A {Rhodobacter sphaeroides} SCOP: a.25.1.1 Back     alignment and structure
>2vzb_A Putative bacterioferritin-related protein; DPS, DPSL, iron, oxidative stress, metal transport; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3fvb_A Bacterioferritin; niaid, ssgcid, decode, structural genomics, seattle structural genomics center for infectious disease; HET: HEM; 1.81A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>1jgc_A Bacterioferritin, BFR; iron storage protein, metal binding protein; HET: HEM; 2.60A {Rhodobacter capsulatus} SCOP: a.25.1.1 Back     alignment and structure
>2fkz_A Bacterioferritin; ferroxidase, DIIRON site, iron T metal binding protein; HET: HEM; 2.00A {Azotobacter vinelandii} SCOP: a.25.1.1 PDB: 2fl0_A* 1sof_A* Back     alignment and structure
>2qqy_A Sigma B operon; dodecameric alpha-helical, ferritin fold, structural genomic protein structure initiative; 2.00A {Bacillus anthracis str} Back     alignment and structure
>1nfv_A Bacterioferritin; 24 subunits in the active molecule, DIIRON HAEM Fe-coproporphyrin III cofactor, iron storage-electron complex; HET: FEC; 1.95A {Desulfovibrio desulfuricans} SCOP: a.25.1.1 PDB: 1nf6_A* 1nf4_A* Back     alignment and structure
>1ji5_A DLP-1; dodecamer, four-helix bundle, metal transport; 2.50A {Bacillus anthracis} SCOP: a.25.1.1 Back     alignment and structure
>2c41_A DPS family DNA-binding stress response protein; iron-binding/oxidation protein, DPS (DNA-binding proteins from starved cells); HET: PG4 PGE; 1.81A {Thermosynechococcus elongatus} Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2vxx_A Starvation induced DNA binding protein; stress response protein, DPS, oxidation, iron binding, ferroxidase centre; HET: PG4; 2.40A {Synechococcus elongatus} Back     alignment and structure
>1jig_A DLP-2; dodecamer, four-helix bundle, metal transport; 1.46A {Bacillus anthracis} SCOP: a.25.1.1 Back     alignment and structure
>1n1q_A DPS protein; four-helix bundle, unknown function; 2.20A {Brevibacillus brevis} SCOP: a.25.1.1 Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>2d5k_A DPS, DPS family protein; four helix bundle, metal binding protein; 1.85A {Staphylococcus aureus subsp} Back     alignment and structure
>4di0_A Rubrerythrin; ssgcid, seattle structural genomics center for infectious DI peroxidase, oxidoreductase; 1.90A {Burkholderia pseudomallei} Back     alignment and structure
>2clb_A DPS-like protein; DI-iron carboxylate, hypothetical protein, bacterioferritin, hydrogen peroxide, metal binding protein, archaea; 2.4A {Sulfolobus solfataricus} Back     alignment and structure
>1tjo_A Iron-rich DPSA-homolog protein; ferritin, low-iron, metal binding protein; 1.60A {Halobacterium salinarum} SCOP: a.25.1.1 PDB: 1moj_A 1tk6_A 1tko_A 1tkp_A Back     alignment and structure
>3qhb_A Symerythrin, ORF180; four-helix bundle, carboxylate bridged-DIIRON, ferritin-like superfamily, metal transport; 1.20A {Cyanophora paradoxa} PDB: 3qhc_A 3sid_A Back     alignment and structure
>2fzf_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.70A {Pyrococcus furiosus} SCOP: a.25.1.1 Back     alignment and structure
>2oh3_A Rubrerythrin, COG1633: uncharacterized conserved protein; ZP_00055496.1, COG1633: uncharacterized conSer protein; HET: MSE PGE; 2.00A {Magnetospirillum magnetotacticum} SCOP: a.25.1.8 Back     alignment and structure
>1zpy_A Hypothetical protein NE0167; structural genomics, MCSG, PSI, protein structure initiative; 2.20A {Nitrosomonas europaea atcc 19718} PDB: 3k6c_A Back     alignment and structure
>3k6c_A Uncharacterized protein NE0167; structural genomics, MCSG, unknown function protein, PSI, PR structure initiative; 2.20A {Nitrosomonas europaea} Back     alignment and structure
>2bk6_A Non-heme iron-containing ferritin; DPS (DNA binding protein from starved cells), ferroxidase center, mutagenesis study; 2.19A {Listeria innocua} SCOP: a.25.1.1 PDB: 1qgh_A 2bjy_A 2iy4_A 2bkc_A Back     alignment and structure
>2fjc_A Antigen TPF1; mini ferritin, iron binding protein, metal transport; 2.50A {Treponema pallidum} SCOP: a.25.1.1 Back     alignment and structure
>1o9r_A Agrobacterium tumefaciens DPS; iron-binding protein, DNA protection from oxidative damage, DNA-binding, iron- binding protein; 1.45A {Agrobacterium tumefaciens} SCOP: a.25.1.1 PDB: 3ge4_A* Back     alignment and structure
>2chp_A MRGA, metalloregulation DNA-binding stress protein; DNA-binding protein, DPS, dodecameric, ferritin; 2.0A {Bacillus subtilis} Back     alignment and structure
>2yjk_A AFP, DPS; metal-binding protein, iron uptake, ferritin fold; 2.00A {Microbacterium arborescens} PDB: 2yjj_A Back     alignment and structure
>1vjx_A Putative ferritin-like DIIRON-carboxylate protein; structural genomics, joint center for structural genomics, J protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.25.1.1 Back     alignment and structure
>4di0_A Rubrerythrin; ssgcid, seattle structural genomics center for infectious DI peroxidase, oxidoreductase; 1.90A {Burkholderia pseudomallei} Back     alignment and structure
>1vjx_A Putative ferritin-like DIIRON-carboxylate protein; structural genomics, joint center for structural genomics, J protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.25.1.1 Back     alignment and structure
>2z90_A Starvation-inducible DNA-binding protein or FINE tangled PILI major subunit; quarternary assembly, ferroxidation; 2.40A {Mycobacterium smegmatis str} Back     alignment and structure
>2yw6_A DNA protection during starvation protein; DNA-binding protein, quarternary assembly, ferroxidation, oxidoreductase; HET: DNA; 2.53A {Mycobacterium smegmatis} SCOP: a.25.1.1 PDB: 1vei_A 1vel_A 1veq_A 1uvh_A* 2yw7_A Back     alignment and structure
>3ak8_A DNA protection during starvation protein; DPS-like protein, dodecamer, iron-binding protein, metal BIN protein, oxidoreductase; HET: DNA; 1.25A {Salmonella enterica subsp} PDB: 3ak9_A* 1f33_A* 1f30_A* 1dps_A 1jts_A* 1jre_A* 1l8h_A* 1l8i_A* 4dyu_A* Back     alignment and structure
>2c2j_A DNA-binding stress response protein; DNA-binding protein, DPS; 2.05A {Deinococcus radiodurans} PDB: 2c6r_A Back     alignment and structure
>2cf7_A DPR; peroxide resistance, DPS-family, ferritin-like, ferroxidase, iron-binding; HET: EPE; 1.50A {Streptococcus suis} PDB: 2ux1_A* 2bw1_A* 1umn_A* 2v15_A* 2xjm_A* 2xjn_A* 2xjo_A* 2xkq_A* Back     alignment and structure
>2c2u_A DPS, DNA-binding stress response protein; DNA-binding protein, iron; 1.1A {Deinococcus radiodurans} PDB: 2c2f_A 2f7n_A Back     alignment and structure
>2pyb_A NAPA, neutrophil activating protein; ferritin, DPS, four-helix bundle, metal transport; 2.60A {Borrelia burgdorferi} Back     alignment and structure
>2wlu_A DPS-like peroxide resistance protein; DNA-binding, oxidoreductase; 1.94A {Streptococcus pyogenes} PDB: 2wla_A Back     alignment and structure
>4etr_A Putative uncharacterized protein; DUF2383, domain of unknown function, cytoplasmic, unknown FU; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>2xgw_A Peroxide resistance protein; metal binding protein; 2.10A {Streptococcus pyogenes} Back     alignment and structure
>1j30_A 144AA long hypothetical rubrerythrin; sulerythrin, sulfolobus tokodaii strain 7, FOU bundle, domain swapping, metal binding site plasticity; 1.70A {Sulfolobus tokodaii} SCOP: a.25.1.1 Back     alignment and structure
>2fzf_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.70A {Pyrococcus furiosus} SCOP: a.25.1.1 Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI-like ferritin-like domains; structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3iq1_A DPS family protein; csgid, SAD, niaid, metal transport, STRU genomics, center for structural genomics of infectious DISE; 1.67A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>4eve_A Neutrophil-activating protein; dodecamer, four-helix bundle, metal transport; 2.10A {Helicobacter pylori} PDB: 4evd_A 3t9j_A 3ta8_A 4evb_A 4evc_A 1ji4_A Back     alignment and structure
>3kwo_A Putative bacterioferritin; alpha-helix, bacterial ferritin fold, structural genomics, center for structural genomics of infectious diseases; 1.99A {Campylobacter jejuni} SCOP: a.25.1.0 Back     alignment and structure
>3qhb_A Symerythrin, ORF180; four-helix bundle, carboxylate bridged-DIIRON, ferritin-like superfamily, metal transport; 1.20A {Cyanophora paradoxa} PDB: 3qhc_A 3sid_A Back     alignment and structure
>2oh3_A Rubrerythrin, COG1633: uncharacterized conserved protein; ZP_00055496.1, COG1633: uncharacterized conSer protein; HET: MSE PGE; 2.00A {Magnetospirillum magnetotacticum} SCOP: a.25.1.8 Back     alignment and structure
>2qqy_A Sigma B operon; dodecameric alpha-helical, ferritin fold, structural genomic protein structure initiative; 2.00A {Bacillus anthracis str} Back     alignment and structure
>2e0z_A Virus-like particle; bacteriophage, HK97; 3.60A {Pyrococcus furiosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 71
d1z6om1191 a.25.1.1 (M:1-191) (Apo)ferritin {Cabbage looper(T 9e-11
d1z6oa1200 a.25.1.1 (A:13-212) (Apo)ferritin {Cabbage looper( 2e-10
d1euma_161 a.25.1.1 (A:) Non-hem ferritin {Escherichia coli, 4e-06
d1rcda_171 a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesb 2e-05
d1r03a_171 a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), 4e-05
d1bg7a_173 a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesb 5e-05
d1s3qa1162 a.25.1.1 (A:3-164) Non-hem ferritin {Archaeon Arch 1e-04
d1krqa_165 a.25.1.1 (A:) Non-hem ferritin {Campylobacter jeju 5e-04
d1lb3a_179 a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) 9e-04
d1vlga_164 a.25.1.1 (A:) Non-hem ferritin {Thermotoga maritim 0.001
>d1z6om1 a.25.1.1 (M:1-191) (Apo)ferritin {Cabbage looper(Trichoplusia ni), H chain [TaxId: 7111]} Length = 191 Back     information, alignment and structure

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ferritin
domain: (Apo)ferritin
species: Cabbage looper(Trichoplusia ni), H chain [TaxId: 7111]

 Score = 52.3 bits (125), Expect = 9e-11
 Identities = 34/54 (62%), Positives = 41/54 (75%)

Query: 14 GAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHVLSIIP 67
          GAHFS+D VNRPGFA+ FF +ASEEREHA+K I YL MRG LT+    +L + P
Sbjct: 43 GAHFSKDVVNRPGFAQLFFDAASEEREHAMKLIEYLLMRGELTNDVSSLLQVRP 96
>d1z6oa1 a.25.1.1 (A:13-212) (Apo)ferritin {Cabbage looper(Trichoplusia ni), L chain [TaxId: 7111]} Length = 200 Back     information, alignment and structure
>d1euma_ a.25.1.1 (A:) Non-hem ferritin {Escherichia coli, FtnA [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1rcda_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} Length = 171 Back     information, alignment and structure
>d1r03a_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), mitocondial isoform [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1bg7a_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} Length = 173 Back     information, alignment and structure
>d1s3qa1 a.25.1.1 (A:3-164) Non-hem ferritin {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 162 Back     information, alignment and structure
>d1krqa_ a.25.1.1 (A:) Non-hem ferritin {Campylobacter jejuni [TaxId: 197]} Length = 165 Back     information, alignment and structure
>d1lb3a_ a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure
>d1vlga_ a.25.1.1 (A:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]} Length = 164 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query71
d1z6om1191 (Apo)ferritin {Cabbage looper(Trichoplusia ni), H 99.9
d1z6oa1200 (Apo)ferritin {Cabbage looper(Trichoplusia ni), L 99.89
d1rcda_171 (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 99.84
d1bg7a_173 (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 99.83
d1r03a_171 (Apo)ferritin {Human (Homo sapiens), mitocondial i 99.83
d1lb3a_179 (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090] 99.81
d1s3qa1162 Non-hem ferritin {Archaeon Archaeoglobus fulgidus 99.79
d1krqa_165 Non-hem ferritin {Campylobacter jejuni [TaxId: 197 99.78
d1vlga_164 Non-hem ferritin {Thermotoga maritima [TaxId: 2336 99.78
d1euma_161 Non-hem ferritin {Escherichia coli, FtnA [TaxId: 5 99.77
d1yuza1135 Nigerythrin, N-terminal domain {Desulfovibrio vulg 99.34
d2fkza1154 Bacterioferritin (cytochrome b1) {Azotobacter vine 99.34
d1jgca_160 Bacterioferritin (cytochrome b1) {Rhodobacter caps 99.29
d1j30a_141 Hypothetical rubrerythrin {Archaeon Sulfolobus tok 99.26
d2htna1158 Bacterioferritin (cytochrome b1) {Escherichia coli 99.26
d1nf4a_169 Bacterioferritin (cytochrome b1) {Desulfovibrio de 99.17
d1lkoa1146 Rubrerythrin, N-terminal domain {Desulfovibrio vul 99.14
d1nnqa1133 Rubrerythrin, N-terminal domain {Archaeon Pyrococc 98.05
d2oh3a1152 Uncharacterized protein AMB4284 homologue {Magneto 97.57
d2fzfa1158 Hypothetical protein PF1190 {Archaeon Pyrococcus f 97.51
d1zpya191 Hypothetical protein NE0167 {Nitrosomonas europaea 96.2
d1vjxa_149 Hypothetical protein TM1526 {Thermotoga maritima [ 95.02
d2ib0a1142 Hypothetical protein Rv2844 {Mycobacterium tubercu 93.92
d1yuza1135 Nigerythrin, N-terminal domain {Desulfovibrio vulg 92.95
d1vjxa_149 Hypothetical protein TM1526 {Thermotoga maritima [ 89.89
d1j30a_141 Hypothetical rubrerythrin {Archaeon Sulfolobus tok 89.79
d1lkoa1146 Rubrerythrin, N-terminal domain {Desulfovibrio vul 89.65
d1nnqa1133 Rubrerythrin, N-terminal domain {Archaeon Pyrococc 89.39
d1umna_151 Dodecameric ferritin homolog {Streptococcus suis [ 89.23
d1o9ra_162 Dodecameric ferritin homolog {Agrobacterium tumefa 88.25
d2oh3a1152 Uncharacterized protein AMB4284 homologue {Magneto 87.07
d1ji4a_144 Dodecameric ferritin homolog {Helicobacter pylori, 86.09
d1ji5a_142 Dodecameric ferritin homolog {Bacillus anthracis, 85.65
d2fzfa1158 Hypothetical protein PF1190 {Archaeon Pyrococcus f 84.56
d1jiga_146 Dodecameric ferritin homolog {Bacillus anthracis, 84.26
d1dpsa_159 Dodecameric ferritin homolog {Escherichia coli, Dp 84.14
d2fjca1151 Dodecameric ferritin homolog {Treponema pallidum, 83.08
d1n1qa_149 Dodecameric ferritin homolog {Bacillus brevis, Dps 81.18
>d1z6om1 a.25.1.1 (M:1-191) (Apo)ferritin {Cabbage looper(Trichoplusia ni), H chain [TaxId: 7111]} Back     information, alignment and structure
class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ferritin
domain: (Apo)ferritin
species: Cabbage looper(Trichoplusia ni), H chain [TaxId: 7111]

Probab=99.90  E-value=9.3e-25  Score=145.08  Aligned_cols=65  Identities=57%  Similarity=0.852  Sum_probs=59.9

Q ss_pred             chhHHhhHhhhhhccccccccCChhHHHHHHHHHHHHHHHHHHHHHHHHHhCCcccccccccccc
Q psy15457          2 GEDGDSHGRFAPGAHFSRDCVNRPGFAKFFFTSASEEREHAIKFISYLTMRGNLTDYHHHVLSII   66 (71)
Q Consensus         2 ~El~aS~~YLsma~~f~~~~~~l~Gfa~fF~~qs~eE~ehA~~l~~yl~~RGg~v~~~~~~~~~~   66 (71)
                      .|+.||+.||+||.||+++++++|||++||+.+|+|||+||++|++|+++|||++.+++++..+.
T Consensus        31 ~El~aSy~Yl~ma~~f~~~~~~l~Gfa~ff~~~s~EE~eHa~kl~~Yl~~RGg~v~~~~~~~~~~   95 (191)
T d1z6om1          31 MEVGASLQYLAMGAHFSKDVVNRPGFAQLFFDAASEEREHAMKLIEYLLMRGELTNDVSSLLQVR   95 (191)
T ss_dssp             HHHHHHHHHHHHHHHHHSTTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCSSCCGGGCCCC
T ss_pred             HHHHHHHHHHHHHHHHccccCcchhHHHHHHHHHHHHHHHHHHHHHHHHHcCCcccccccccCCC
Confidence            48999999999999999988999999999999999999999999999999999998777765433
>d1z6oa1 a.25.1.1 (A:13-212) (Apo)ferritin {Cabbage looper(Trichoplusia ni), L chain [TaxId: 7111]} Back     information, alignment and structure
>d1rcda_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} Back     information, alignment and structure
>d1bg7a_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} Back     information, alignment and structure
>d1r03a_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), mitocondial isoform [TaxId: 9606]} Back     information, alignment and structure
>d1lb3a_ a.25.1.1 (A:) (Apo)ferritin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s3qa1 a.25.1.1 (A:3-164) Non-hem ferritin {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1krqa_ a.25.1.1 (A:) Non-hem ferritin {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1vlga_ a.25.1.1 (A:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1euma_ a.25.1.1 (A:) Non-hem ferritin {Escherichia coli, FtnA [TaxId: 562]} Back     information, alignment and structure
>d1yuza1 a.25.1.1 (A:23-157) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2fkza1 a.25.1.1 (A:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1jgca_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1j30a_ a.25.1.1 (A:) Hypothetical rubrerythrin {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2htna1 a.25.1.1 (A:1-158) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nf4a_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1lkoa1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1nnqa1 a.25.1.1 (A:2-134) Rubrerythrin, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]} Back     information, alignment and structure
>d2fzfa1 a.25.1.1 (A:10-167) Hypothetical protein PF1190 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zpya1 a.25.1.5 (A:4-94) Hypothetical protein NE0167 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1vjxa_ a.25.1.1 (A:) Hypothetical protein TM1526 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ib0a1 a.25.1.9 (A:17-158) Hypothetical protein Rv2844 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yuza1 a.25.1.1 (A:23-157) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1vjxa_ a.25.1.1 (A:) Hypothetical protein TM1526 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j30a_ a.25.1.1 (A:) Hypothetical rubrerythrin {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1lkoa1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1nnqa1 a.25.1.1 (A:2-134) Rubrerythrin, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1umna_ a.25.1.1 (A:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]} Back     information, alignment and structure
>d1o9ra_ a.25.1.1 (A:) Dodecameric ferritin homolog {Agrobacterium tumefaciens, Dps [TaxId: 358]} Back     information, alignment and structure
>d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]} Back     information, alignment and structure
>d1ji4a_ a.25.1.1 (A:) Dodecameric ferritin homolog {Helicobacter pylori, Nap [TaxId: 210]} Back     information, alignment and structure
>d1ji5a_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-1 [TaxId: 1392]} Back     information, alignment and structure
>d2fzfa1 a.25.1.1 (A:10-167) Hypothetical protein PF1190 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jiga_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus anthracis, Dlp-2 [TaxId: 1392]} Back     information, alignment and structure
>d1dpsa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Escherichia coli, Dps [TaxId: 562]} Back     information, alignment and structure
>d2fjca1 a.25.1.1 (A:27-177) Dodecameric ferritin homolog {Treponema pallidum, TpF1 [TaxId: 160]} Back     information, alignment and structure
>d1n1qa_ a.25.1.1 (A:) Dodecameric ferritin homolog {Bacillus brevis, Dps [TaxId: 1393]} Back     information, alignment and structure