Psyllid ID: psy1552

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220
MTHIPHGENDTSTSESVGKKARKGIFRSLLCCFRGNHSSSNVSKASGGSEGQYSPPHSPVRLLPPIRHQDMHKKCMVIDLDETLVHSSFKYADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRDLHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLRNSNHPYNMQPSLGGGGSNNGSQDGGGLPSRTK
ccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEcccccHHHHHHcccccccccccccccccccccccEEccccccccccccEEEEEccccccccccccEEcccccccccccHHHHHHHHHHHHHcccccHHHHHHcccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccHHHHHEEEEccccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHHHHHHcHHHHcHHHHHHHcccccEEEEEEEEcEEEccccHHHHHHHHcccHcEEEEEEccccEEEEccccccEEEcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHccccccHcHHHHHHHccccccccccccccc
mthiphgendtstsesvgKKARKGIFRSLLccfrgnhsssnvskasggsegqyspphspvrllppirhqdmhkkcmvidldetlvhssfkyadPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRDLHQVIivdnspasyifhpdnavpvaswfddmtdtelydlVPFFERLSKMDSVYSFLrnsnhpynmqpslggggsnngsqdggglpsrtk
mthiphgendtstsesvgkKARKGIFRSLLCCFRGNHSSSNVSKASGGSEGQYSPPHSPVRLLPPIRHQDMHKKCMVIDLDETLVHSSFKYADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRDLHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLRNSNHPYNMQPSLggggsnngsqdggglpsrtk
MTHIPHGENDTSTSESVGKKARKGIFRSLLCCFRgnhsssnvskasggsEGQYSPPHSPVRLLPPIRHQDMHKKCMVIDLDETLVHSSFKYADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRDLHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLRNSNHPYNMQPSLggggsnngsqdgggLPSRTK
***********************GIFRSLLCCFR*********************************HQDMHKKCMVIDLDETLVHSSFKYADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRDLHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLR********************************
*****************************LC***************************PVRLLPPIRHQDMHKKCMVIDLDETLVHSSFKYADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRDLHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLRNSNH****************************
********************ARKGIFRSLLCCFRGNHS******************HSPVRLLPPIRHQDMHKKCMVIDLDETLVHSSFKYADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRDLHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLRNSNHPYNMQPSLGGGGSN**************
*********************RKGIFRSLLCCFRGNH***************YSPPHSPVRLLPPIRHQDMHKKCMVIDLDETLVHSSFKYADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRDLHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLRNSNHPYNMQPSLGGGG****************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTHIPHGENDTSTSESVGKKARKGIFRSLLCCFRGNHSSSNVSKASGGSEGQYSPPHSPVRLLPPIRHQDMHKKCMVIDLDETLVHSSFKYADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRDLHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLRNSNHPYNMQPSLGGGGSNNGSQDGGGLPSRTK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query220 2.2.26 [Sep-21-2011]
Q9PTJ6275 CTD small phosphatase-lik yes N/A 0.781 0.625 0.504 8e-54
P58466261 Carboxy-terminal domain R yes N/A 0.809 0.681 0.485 5e-53
Q9GZU7261 Carboxy-terminal domain R yes N/A 0.822 0.693 0.487 8e-53
O15194276 CTD small phosphatase-lik no N/A 0.822 0.655 0.477 9e-53
P58465276 CTD small phosphatase-lik no N/A 0.822 0.655 0.477 2e-52
O14595271 Carboxy-terminal domain R no N/A 0.822 0.667 0.455 8e-49
Q8BX07270 Carboxy-terminal domain R no N/A 0.822 0.670 0.453 3e-48
Q09695325 Uncharacterized protein C yes N/A 0.572 0.387 0.443 5e-35
Q07800427 Phosphatase PSR1 OS=Sacch yes N/A 0.581 0.299 0.396 3e-30
Q07949397 Probable phosphatase PSR2 no N/A 0.531 0.294 0.407 1e-29
>sp|Q9PTJ6|CTDSL_CHICK CTD small phosphatase-like protein OS=Gallus gallus GN=NFI1 PE=2 SV=2 Back     alignment and function desciption
 Score =  210 bits (534), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 120/238 (50%), Positives = 138/238 (57%), Gaps = 66/238 (27%)

Query: 16  SVGKKARKGIFRSLLCCFRGNHS---SSNVSKA-----------SGGSEGQYSP-PHSPV 60
           S+ K+  + IF +L CCFR  +    S+N + A             G + Q  P P  P 
Sbjct: 32  SLKKQRSRSIFSTLFCCFRDYNVEPPSTNSTSALPPLVEENGGLQKGDQMQVMPIPSPPA 91

Query: 61  R-LLPPIRHQDMHKKCMVIDLDETLVHSSFK----------------------------- 90
           + LLP +   D  KKC+VIDLDETLVHSSFK                             
Sbjct: 92  KYLLPELTASDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVD 151

Query: 91  ---------------------YADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLG 129
                                YADPVADLLDRWGVFRARLFRESCVFH GNYVKDL++LG
Sbjct: 152 EFLQRMGELFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLG 211

Query: 130 RDLHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFL 187
           R+L +VIIVDNSPASYIFHP+NAVPV SWFDDMTDTEL DL+PFFE LSK + VYS L
Sbjct: 212 RELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSKEEEVYSML 269
Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells.
Gallus gallus (taxid: 9031)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|P58466|CTDS1_MOUSE Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 OS=Mus musculus GN=Ctdsp1 PE=1 SV=1 Back     alignment and function description
>sp|Q9GZU7|CTDS1_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 OS=Homo sapiens GN=CTDSP1 PE=1 SV=1 Back     alignment and function description
>sp|O15194|CTDSL_HUMAN CTD small phosphatase-like protein OS=Homo sapiens GN=CTDSPL PE=1 SV=2 Back     alignment and function description
>sp|P58465|CTDSL_MOUSE CTD small phosphatase-like protein OS=Mus musculus GN=Ctdspl PE=2 SV=3 Back     alignment and function description
>sp|O14595|CTDS2_HUMAN Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Homo sapiens GN=CTDSP2 PE=1 SV=2 Back     alignment and function description
>sp|Q8BX07|CTDS2_MOUSE Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2 OS=Mus musculus GN=Ctdsp2 PE=2 SV=1 Back     alignment and function description
>sp|Q09695|YA22_SCHPO Uncharacterized protein C2F7.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F7.02c PE=1 SV=1 Back     alignment and function description
>sp|Q07800|PSR1_YEAST Phosphatase PSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSR1 PE=1 SV=1 Back     alignment and function description
>sp|Q07949|PSR2_YEAST Probable phosphatase PSR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSR2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
189237962292 PREDICTED: similar to CG5830 CG5830-PA [ 0.895 0.674 0.559 4e-69
322794416268 hypothetical protein SINV_15653 [Solenop 0.868 0.712 0.588 2e-68
383850180293 PREDICTED: carboxy-terminal domain RNA p 0.895 0.672 0.560 1e-67
307210659298 CTD small phosphatase-like protein [Harp 0.95 0.701 0.541 9e-67
350403552293 PREDICTED: carboxy-terminal domain RNA p 0.890 0.668 0.559 2e-66
332030720292 Carboxy-terminal domain RNA polymerase I 0.9 0.678 0.555 2e-66
66521481293 PREDICTED: carboxy-terminal domain RNA p 0.895 0.672 0.556 3e-66
340722900293 PREDICTED: carboxy-terminal domain RNA p 0.890 0.668 0.555 4e-66
380022709293 PREDICTED: carboxy-terminal domain RNA p 0.895 0.672 0.552 5e-66
345486020294 PREDICTED: carboxy-terminal domain RNA p 0.868 0.649 0.565 2e-65
>gi|189237962|ref|XP_001811853.1| PREDICTED: similar to CG5830 CG5830-PA [Tribolium castaneum] gi|270006659|gb|EFA03107.1| hypothetical protein TcasGA2_TC013017 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  266 bits (681), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 141/252 (55%), Positives = 160/252 (63%), Gaps = 55/252 (21%)

Query: 4   IPHGENDTSTSE--SVGKKARKGIFRSLLCCF-RGNHSSSNVSKASGGSEGQYSPPHSPV 60
           +P  END S  +  S  KK  +G FRSL CC  R     +NV +   G+  QY P  S  
Sbjct: 27  LPRSENDLSEEKIPSNNKKGNRGFFRSLFCCLGRKGTKKTNVEQCVDGN--QYIPGSSCT 84

Query: 61  RLLPPIRHQDMHKKCMVIDLDETLVHSSFK------------------------------ 90
            LLPP+RHQDMHKKCMVIDLDETLVHSSFK                              
Sbjct: 85  YLLPPVRHQDMHKKCMVIDLDETLVHSSFKPISNADFVVPVEIDGTVHQVYVLKRPHVDD 144

Query: 91  --------------------YADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGR 130
                               YADPVADLLD+WGVFR+RLFRESCVF+ GNYVKDLNKLGR
Sbjct: 145 FLKRMGELYECVLFTASLAKYADPVADLLDQWGVFRSRLFRESCVFYRGNYVKDLNKLGR 204

Query: 131 DLHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLRNS 190
           +L Q++IVDNSPASYIFHPDNAVPVASWFDDM+D+EL DL+PFFE+LSKMD+VY+ L NS
Sbjct: 205 ELQQIVIVDNSPASYIFHPDNAVPVASWFDDMSDSELLDLIPFFEKLSKMDNVYTVLCNS 264

Query: 191 NHPYNMQPSLGG 202
           NHPYN   S  G
Sbjct: 265 NHPYNSSVSQNG 276

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322794416|gb|EFZ17505.1| hypothetical protein SINV_15653 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383850180|ref|XP_003700675.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307210659|gb|EFN87082.1| CTD small phosphatase-like protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350403552|ref|XP_003486835.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332030720|gb|EGI70396.1| Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|66521481|ref|XP_623986.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340722900|ref|XP_003399838.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380022709|ref|XP_003695181.1| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1-like [Apis florea] Back     alignment and taxonomy information
>gi|345486020|ref|XP_001605639.2| PREDICTED: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query220
MGI|MGI:2654470261 Ctdsp1 "CTD (carboxy-terminal 0.45 0.379 0.808 1.6e-55
ZFIN|ZDB-GENE-050522-523265 ctdsp1 "CTD (carboxy-terminal 0.45 0.373 0.828 5.4e-55
UNIPROTKB|Q9GZU7261 CTDSP1 "Carboxy-terminal domai 0.45 0.379 0.808 5.4e-55
UNIPROTKB|E2RFB6261 CTDSP1 "Uncharacterized protei 0.45 0.379 0.808 8.8e-55
UNIPROTKB|E2RTC0343 CTDSP1 "Uncharacterized protei 0.45 0.288 0.808 8.8e-55
UNIPROTKB|E1BDE3260 CTDSP1 "Uncharacterized protei 0.45 0.380 0.808 1.1e-54
UNIPROTKB|H7C1Z7262 CTDSP1 "Carboxy-terminal domai 0.45 0.377 0.808 1.4e-54
UNIPROTKB|I3L819265 CTDSPL "Uncharacterized protei 0.445 0.369 0.846 1.3e-53
UNIPROTKB|Q9PTJ6275 NFI1 "CTD small phosphatase-li 0.445 0.356 0.846 4.2e-53
UNIPROTKB|O15194276 CTDSPL "CTD small phosphatase- 0.445 0.355 0.846 1.1e-52
MGI|MGI:2654470 Ctdsp1 "CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 454 (164.9 bits), Expect = 1.6e-55, Sum P(2) = 1.6e-55
 Identities = 80/99 (80%), Positives = 94/99 (94%)

Query:    90 KYADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRDLHQVIIVDNSPASYIFHP 149
             KYADPVADLLD+WG FRARLFRESCVFH GNYVKDL++LGRDL +V+I+DNSPASY+FHP
Sbjct:   157 KYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHP 216

Query:   150 DNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLR 188
             DNAVPVASWFD+M+DTEL+DL+PFFE+LS++D VYS LR
Sbjct:   217 DNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLR 255
GO:0004721 "phosphoprotein phosphatase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISO
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISO
GO:0006470 "protein dephosphorylation" evidence=ISO
GO:0008420 "CTD phosphatase activity" evidence=ISO
GO:0016787 "hydrolase activity" evidence=IEA
GO:0016791 "phosphatase activity" evidence=IEA
GO:0045665 "negative regulation of neuron differentiation" evidence=IDA
GO:0046872 "metal ion binding" evidence=IEA
GO:0050768 "negative regulation of neurogenesis" evidence=IGI;IMP;IDA
ZFIN|ZDB-GENE-050522-523 ctdsp1 "CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GZU7 CTDSP1 "Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFB6 CTDSP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RTC0 CTDSP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDE3 CTDSP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H7C1Z7 CTDSP1 "Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L819 CTDSPL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PTJ6 NFI1 "CTD small phosphatase-like protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O15194 CTDSPL "CTD small phosphatase-like protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9GZU7CTDS1_HUMAN3, ., 1, ., 3, ., 1, 60.48730.82270.6934yesN/A
Q9PTJ6CTDSL_CHICK3, ., 1, ., 3, ., 1, 60.50420.78180.6254yesN/A
P58466CTDS1_MOUSE3, ., 1, ., 3, ., 1, 60.48540.80900.6819yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.30.921

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
TIGR02251162 TIGR02251, HIF-SF_euk, Dullard-like phosphatase do 1e-50
pfam03031153 pfam03031, NIF, NLI interacting factor-like phosph 2e-41
smart00577148 smart00577, CPDc, catalytic domain of ctd-like pho 3e-33
COG5190390 COG5190, FCP1, TFIIF-interacting CTD phosphatases, 2e-30
>gnl|CDD|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain Back     alignment and domain information 
 Score =  161 bits (410), Expect = 1e-50
 Identities = 69/161 (42%), Positives = 84/161 (52%), Gaps = 52/161 (32%)

Query: 73  KKCMVIDLDETLVHSSFK------------------------------------------ 90
           KK +V+DLDETLVHS+FK                                          
Sbjct: 1   KKTLVLDLDETLVHSTFKMPKVDADFKVPVLIDGKIIPVYVFKRPHVDEFLERVSKWYEL 60

Query: 91  ---------YADPVADLLDRW-GVFRARLFRESCVFHHGNYVKDLNKLGRDLHQVIIVDN 140
                    YADPV D+LDR   V   RL+RESCVF +G YVKDL+ +G+DL +VII+DN
Sbjct: 61  VIFTASLEEYADPVLDILDRGGKVISRRLYRESCVFTNGKYVKDLSLVGKDLSKVIIIDN 120

Query: 141 SPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMD 181
           SP SY   PDNA+P+ SWF D  DTEL +L+PF E L   D
Sbjct: 121 SPYSYSLQPDNAIPIKSWFGDPNDTELLNLIPFLEGLRFED 161

This model represents the putative phosphatase domain of a family of eukaryotic proteins including "Dullard" , and the NLI interacting factor (NIF)-like phosphatases. This domain is a member of the haloacid dehalogenase (HAD) superfamily by virtue of a conserved set of three catalytic motifs and a conserved fold as predicted by PSIPRED. The third motif in this family is distinctive (hhhhDNxPxxa) and aparrently lacking the last aspartate. This domain is classified as a "Class III" HAD, since there is no large "cap" domain found between motifs 1 and 2 or motifs 2 and 3. This domain is related to domains found in FCP1-like phosphatases (TIGR02250), and together both are detected by the pfam03031. Length = 162
>gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase Back     alignment and domain information
>gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases Back     alignment and domain information
>gnl|CDD|227517 COG5190, FCP1, TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 220
KOG1605|consensus262 100.0
KOG2832|consensus393 99.97
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 99.97
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 99.96
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 99.96
COG5190390 FCP1 TFIIF-interacting CTD phosphatases, including 99.92
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 99.88
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.71
KOG0323|consensus 635 98.8
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 95.19
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 94.52
PRK13288214 pyrophosphatase PpaX; Provisional 93.66
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 93.3
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 93.09
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 92.44
COG3882 574 FkbH Predicted enzyme involved in methoxymalonyl-A 90.77
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 90.6
PHA02530300 pseT polynucleotide kinase; Provisional 89.6
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 89.47
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 88.65
PRK13225273 phosphoglycolate phosphatase; Provisional 88.57
PRK13222226 phosphoglycolate phosphatase; Provisional 87.98
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 87.93
COG0637221 Predicted phosphatase/phosphohexomutase [General f 87.25
PLN02575381 haloacid dehalogenase-like hydrolase 87.09
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 86.3
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 85.03
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 84.74
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 83.81
PLN02940 382 riboflavin kinase 83.18
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 83.0
PRK11587218 putative phosphatase; Provisional 82.77
PRK13226229 phosphoglycolate phosphatase; Provisional 82.51
KOG3109|consensus244 82.27
PRK10444248 UMP phosphatase; Provisional 82.22
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 81.94
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 81.12
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 80.36
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 80.01
>KOG1605|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.7e-43  Score=310.99  Aligned_cols=173  Identities=42%  Similarity=0.629  Sum_probs=139.9

Q ss_pred             ccccccccccccccccccCCCCCCCCCCCCCCCCC-C----CCCCCCCCCCCCcccCCCCceEEEecCcceeecc--c--
Q psy1552          19 KKARKGIFRSLLCCFRGNHSSSNVSKASGGSEGQY-S----PPHSPVRLLPPIRHQDMHKKCMVIDLDETLVHSS--F--   89 (220)
Q Consensus        19 ~~~~~~~~~~l~cc~~~~~~~~~~~~~~~~~~~~~-~----p~~~~~~LLP~~~~~~~~k~tLVLDLDETLVhss--~--   89 (220)
                      .+.....-++++||.+................+++ .    ......+++|...+ ..+|+|||||||||||||+  +  
T Consensus        31 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~kk~lVLDLDeTLvHss~~~~~  109 (262)
T KOG1605|consen   31 MMLVEDSSQSSSNASSAFSPEFDEELYSEDLFEKYQPVKYASQTPLSPVLPLRLA-TVGRKTLVLDLDETLVHSSLNLKP  109 (262)
T ss_pred             ceeccccccchhhhhhccccccchhhhhhhhhhhcccccccccccccccCCcccc-cCCCceEEEeCCCcccccccccCC
Confidence            44555666677777764432111110010111122 1    12245567776554 7899999999999999999  4  


Q ss_pred             ------------------------------------------------ccHHHHHHhhcC-CCccceEEEecCeeeecCc
Q psy1552          90 ------------------------------------------------KYADPVADLLDR-WGVFRARLFRESCVFHHGN  120 (220)
Q Consensus        90 ------------------------------------------------~YAd~Vid~LDp-~g~f~~rLyResC~~~~g~  120 (220)
                                                                      .||++|+|.||| +++|++||||++|++.+|+
T Consensus       110 ~~~~d~~~~v~~~~~~~~~yV~kRP~vdeFL~~~s~~~e~v~FTAs~~~Ya~~v~D~LD~~~~i~~~RlyR~~C~~~~g~  189 (262)
T KOG1605|consen  110 IVNADFTVPVEIDGHIHQVYVRKRPHVDEFLSRVSKWYELVLFTASLEVYADPLLDILDPDRKIISHRLYRDSCTLKDGN  189 (262)
T ss_pred             CCCcceeeeeeeCCcceEEEEEcCCCHHHHHHHhHHHHHHHHHHhhhHHHHHHHHHHccCCCCeeeeeecccceEeECCc
Confidence                                                            799999999999 7899999999999999999


Q ss_pred             ccccccccccccCcEEEEeCCCCccccCCCceeecCCCCCCCCchHHHHHHHHHhhccCCCChHHHHhhcCC
Q psy1552         121 YVKDLNKLGRDLHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLRNSNH  192 (220)
Q Consensus       121 yvKDLs~LgRdL~rVIIVDnsp~s~~~qpdN~I~I~~f~gd~~D~eLl~Llp~Le~L~~~~DVR~vL~~~~~  192 (220)
                      |+|||+.+||||++||||||+|.+|.+||+|||||++|+.|+.|+||++|+|||++|+.++|||+++++..+
T Consensus       190 yvKdls~~~~dL~~viIiDNsP~sy~~~p~NgIpI~sw~~d~~D~eLL~LlpfLe~L~~~~Dvr~~l~~~~~  261 (262)
T KOG1605|consen  190 YVKDLSVLGRDLSKVIIVDNSPQSYRLQPENGIPIKSWFDDPTDTELLKLLPFLEALAFVDDVRPILARRFG  261 (262)
T ss_pred             EEEEcceeccCcccEEEEcCChHHhccCccCCCcccccccCCChHHHHHHHHHHHHhcccccHHHHHHHhhc
Confidence            999999999999999999999999999999999999999999999999999999999999999999998653

>KOG2832|consensus Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>KOG0323|consensus Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>KOG3109|consensus Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
3pgl_A180 Crystal Structure Of Human Small C-Terminal Domain 2e-49
2ghq_A181 Ctd-Specific Phosphatase Scp1 In Complex With Pepti 6e-49
1ta0_A197 Three-Dimensional Structure Of A Rna-Polymerase Ii 7e-49
3l0y_A184 Crystal Structure Of Scp1 Phosphatase D98a Mutant L 8e-49
3l0c_A184 Crystal Structure Of Scp1 Phosphatase D206a Mutant 8e-49
1t9z_A197 Three-Dimensional Structure Of A Rna-Polymerase Ii 5e-48
3l0b_A184 Crystal Structure Of Scp1 Phosphatase D206a Mutant 6e-48
2hhl_A195 Crystal Structure Of The Human Small Ctd Phosphatas 2e-47
2q5e_A187 Crystal Structure Of Human Carboxy-Terminal Domain 6e-44
3qle_A204 Structural Basis For The Function Of Tim50 In The M 1e-14
>pdb|3PGL|A Chain A, Crystal Structure Of Human Small C-Terminal Domain Phosphatase 1 (Scp1) Bound To Rabeprazole Length = 180 Back     alignment and structure 
Iteration: 1

 Score =  192 bits (487), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 116/178 (65%), Gaps = 50/178 (28%)
Query: 62  LLPPIRHQDMHKKCMVIDLDETLVHSSFK------------------------------- 90
           LLP  + QD  K C+VIDLDETLVHSSFK                               
Sbjct: 3   LLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEF 62
Query: 91  -------------------YADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRD 131
                              YADPVADLLD+WG FRARLFRESCVFH GNYVKDL++LGRD
Sbjct: 63  LQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRD 122
Query: 132 LHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLRN 189
           L +V+I+DNSPASY+FHPDNAVPVASWFD+M+DTEL+DL+PFFE+LS++D VYS LR 
Sbjct: 123 LRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ 180
>pdb|2GHQ|A Chain A, Ctd-Specific Phosphatase Scp1 In Complex With Peptide C- Terminal Domain Of Rna Polymerase Ii Length = 181 Back     alignment and structure
>pdb|1TA0|A Chain A, Three-Dimensional Structure Of A Rna-Polymerase Ii Binding Protein With Associated Ligand Length = 197 Back     alignment and structure
>pdb|3L0Y|A Chain A, Crystal Structure Of Scp1 Phosphatase D98a Mutant Length = 184 Back     alignment and structure
>pdb|3L0C|A Chain A, Crystal Structure Of Scp1 Phosphatase D206a Mutant With Trap Inorganic Phosphate Length = 184 Back     alignment and structure
>pdb|1T9Z|A Chain A, Three-Dimensional Structure Of A Rna-Polymerase Ii Binding Protein Length = 197 Back     alignment and structure
>pdb|3L0B|A Chain A, Crystal Structure Of Scp1 Phosphatase D206a Mutant Phosphory Intermediate Length = 184 Back     alignment and structure
>pdb|2HHL|A Chain A, Crystal Structure Of The Human Small Ctd Phosphatase 3 Isoform 1 Length = 195 Back     alignment and structure
>pdb|2Q5E|A Chain A, Crystal Structure Of Human Carboxy-Terminal Domain Rna Polymerase Ii Polypeptide A Small Phosphatase 2 Length = 187 Back     alignment and structure
>pdb|3QLE|A Chain A, Structural Basis For The Function Of Tim50 In The Mitochondrial Presequence Translocase Length = 204 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query220
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 2e-60
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 3e-60
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 3e-56
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 3e-27
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 3e-21
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 2e-17
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 9e-05
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 Back     alignment and structure
 Score =  186 bits (474), Expect = 2e-60
 Identities = 98/177 (55%), Positives = 115/177 (64%), Gaps = 50/177 (28%)

Query: 62  LLPPIRHQDMHKKCMVIDLDETLVHSSFKY------------------------------ 91
           LLP  + QD  K C+VI+LDETLVHSSFK                               
Sbjct: 4   LLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEF 63

Query: 92  --------------------ADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRD 131
                               ADPVADLLD+WG FRARLFRESCVFH GNYVKDL++LGRD
Sbjct: 64  LQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRD 123

Query: 132 LHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLR 188
           L +V+I+DNSPASY+FHPDNAVPVASWFD+M+DTEL+DL+PFFE+LS++D VYS LR
Sbjct: 124 LRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLR 180
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 100.0
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 100.0
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 100.0
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 100.0
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 99.89
3ef0_A372 RNA polymerase II subunit A C-terminal domain phos 99.89
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 95.94
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 95.48
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 94.79
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 94.35
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 93.95
3ib6_A189 Uncharacterized protein; structural genomics, unkn 93.74
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 93.64
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 93.5
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 93.39
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 93.3
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 92.85
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 92.47
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 92.39
3sd7_A240 Putative phosphatase; structural genomics, haloaci 91.88
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 91.15
3mn1_A189 Probable YRBI family phosphatase; structural genom 91.01
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 90.94
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 90.66
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 90.07
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 89.69
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 88.2
3mmz_A176 Putative HAD family hydrolase; structural genomics 87.78
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 87.75
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 87.47
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 86.9
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 86.88
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 86.86
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 86.43
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 85.56
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 85.5
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 85.24
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 84.83
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 84.76
2hsz_A243 Novel predicted phosphatase; structural genomics, 84.7
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 84.69
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 84.39
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 84.15
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 84.04
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 83.91
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 83.75
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 83.7
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 83.33
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 83.01
1swv_A 267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 82.81
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 82.32
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 82.32
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 82.23
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 82.01
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 81.78
4dw8_A 279 Haloacid dehalogenase-like hydrolase; HAD, putativ 81.72
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 81.69
3iru_A 277 Phoshonoacetaldehyde hydrolase like protein; phosp 81.62
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 81.6
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 81.48
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 81.25
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 81.15
3mpo_A 279 Predicted hydrolase of the HAD superfamily; SGX, P 81.09
2zg6_A220 Putative uncharacterized protein ST2620, probable 81.08
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 80.98
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 80.97
2p11_A231 Hypothetical protein; putative haloacid dehalogena 80.61
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 80.18
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 80.18
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 80.14
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 80.14
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
Probab=100.00  E-value=9.3e-40  Score=279.47  Aligned_cols=138  Identities=37%  Similarity=0.644  Sum_probs=123.7

Q ss_pred             CCCCCCCCCCCcc-cCCCCceEEEecCcceeeccc-----------------------------------ccHHHHHHhh
Q psy1552          56 PHSPVRLLPPIRH-QDMHKKCMVIDLDETLVHSSF-----------------------------------KYADPVADLL   99 (220)
Q Consensus        56 ~~~~~~LLP~~~~-~~~~k~tLVLDLDETLVhss~-----------------------------------~YAd~Vid~L   99 (220)
                      .+..+.||||+.+ .+++++||||||||||||+++                                   .||++|++.|
T Consensus        16 ~p~~~~lLp~~~~~~~~~~~tLVLDLDeTLvh~~~~~~~~~~v~~RPgl~eFL~~l~~~yeivI~Tas~~~ya~~vl~~L   95 (204)
T 3qle_A           16 EPPFPDLLPPPPPPPYQRPLTLVITLEDFLVHSEWSQKHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKL   95 (204)
T ss_dssp             ---CCCCSCCCC----CCSEEEEEECBTTTEEEEEETTTEEEEEECTTHHHHHHHHTTTEEEEEECSSCHHHHHHHHHHT
T ss_pred             CCCcccCCCCCCccccCCCeEEEEeccccEEeeeccccCceeEEeCCCHHHHHHHHHhCCEEEEEcCCcHHHHHHHHHHh
Confidence            3456789998875 567899999999999999965                                   7999999999


Q ss_pred             cCCC-ccceEEEecCeeeecCcccccccccccccCcEEEEeCCCCccccCCCceeecCCCCCCCCchHHHHHHHHHhhcc
Q psy1552         100 DRWG-VFRARLFRESCVFHHGNYVKDLNKLGRDLHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLS  178 (220)
Q Consensus       100 Dp~g-~f~~rLyResC~~~~g~yvKDLs~LgRdL~rVIIVDnsp~s~~~qpdN~I~I~~f~gd~~D~eLl~Llp~Le~L~  178 (220)
                      ||.+ +|.+|+||++|++..|.|+|||++||||+++||||||+|.+|.+||+|||+|.+|.|+. |+||++|+|||+.|+
T Consensus        96 Dp~~~~f~~rl~R~~c~~~~g~y~KdL~~Lgrdl~~vIiIDDsp~~~~~~p~N~I~I~~~~~~~-D~eL~~L~~~L~~L~  174 (204)
T 3qle_A           96 DPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEA-DDKLVRLIPFLEYLA  174 (204)
T ss_dssp             STTCSSEEEEECGGGSEEETTEEECCGGGSCSCGGGEEEEESCTTTTTTCGGGEEECCCCCSSC-CCHHHHHHHHHHHHH
T ss_pred             CCCCCeEEEEEEecceeEECCeeeecHHHhCCChHHEEEEECCHHHHhhCccCceEeeeECCCC-ChhHHHHHHHHHHHh
Confidence            9985 89999999999999999999999999999999999999999999999999999999875 669999999999998


Q ss_pred             --CCCChHHHHhhcCCCC
Q psy1552         179 --KMDSVYSFLRNSNHPY  194 (220)
Q Consensus       179 --~~~DVR~vL~~~~~~~  194 (220)
                        +++|||++|++|++..
T Consensus       175 ~~~~~DVR~~L~~~~~~~  192 (204)
T 3qle_A          175 TQQTKDVRPILNSFEDKK  192 (204)
T ss_dssp             HTCCSCSHHHHTTSSCGG
T ss_pred             hcChHHHHHHHHHhcCCC
Confidence              6999999999998753
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 220
d1ta0a_181 c.108.1.16 (A:) Carboxy-terminal domain RNA polyme 3e-43
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  141 bits (357), Expect = 3e-43
 Identities = 100/177 (56%), Positives = 116/177 (65%), Gaps = 50/177 (28%)

Query: 62  LLPPIRHQDMHKKCMVIDLDETLVHSSFK------------------------------- 90
           LLP  + QD  K C+VIDLDETLVHSSFK                               
Sbjct: 4   LLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEF 63

Query: 91  -------------------YADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRD 131
                              YADPVADLLD+WG FRARLFRESCVFH GNYVKDL++LGRD
Sbjct: 64  LQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRD 123

Query: 132 LHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYDLVPFFERLSKMDSVYSFLR 188
           L +V+I+DNSPASY+FHPDNAVPVASWFD+M+DTEL+DL+PFFE+LS++D VYS LR
Sbjct: 124 LRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLR 180

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query220
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 100.0
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 96.6
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 96.11
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 95.88
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 95.86
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 95.61
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 95.46
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 95.43
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 95.08
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 94.64
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 94.48
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 93.49
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 93.26
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 92.99
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 92.55
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 91.06
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 90.6
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 90.58
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 88.78
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 88.68
d1vjra_ 261 Hypothetical protein TM1742 {Thermotoga maritima [ 88.43
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 87.05
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 85.68
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 85.44
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 85.24
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 85.16
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 85.12
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 82.3
d1wvia_ 253 Putative phosphatase SMU.1415c {Streptococcus muta 82.1
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 81.45
d1rkqa_ 271 Hypothetical protein YidA {Escherichia coli [TaxId 81.13
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 80.82
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 80.45
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.4e-40  Score=275.55  Aligned_cols=130  Identities=77%  Similarity=1.301  Sum_probs=125.6

Q ss_pred             CCCCCCCcccCCCCceEEEecCcceeeccc--------------------------------------------------
Q psy1552          60 VRLLPPIRHQDMHKKCMVIDLDETLVHSSF--------------------------------------------------   89 (220)
Q Consensus        60 ~~LLP~~~~~~~~k~tLVLDLDETLVhss~--------------------------------------------------   89 (220)
                      ++|||++.+...+|+|||||||||||||++                                                  
T Consensus         2 ~~llp~~~~~~~~k~~LVLDLDeTLihs~~~~~~~~~~~~~~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei~I~Ta~~~   81 (181)
T d1ta0a_           2 QYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLA   81 (181)
T ss_dssp             CCSSCCCCGGGTTSCEEEECCBTTTEEEESSCCTTCSEEEEEEETTEEEEEEEEECTTHHHHHHHHHHHSEEEEECSSCH
T ss_pred             CccCCCCCcccCCCeEEEEeCCCCEEccccCCCCCccceeeecccceeeeeEEecCCCHHHHHHHHHhceEEEEEcCCcH
Confidence            489999999999999999999999999863                                                  


Q ss_pred             ccHHHHHHhhcCCCccceEEEecCeeeecCcccccccccccccCcEEEEeCCCCccccCCCceeecCCCCCCCCchHHHH
Q psy1552          90 KYADPVADLLDRWGVFRARLFRESCVFHHGNYVKDLNKLGRDLHQVIIVDNSPASYIFHPDNAVPVASWFDDMTDTELYD  169 (220)
Q Consensus        90 ~YAd~Vid~LDp~g~f~~rLyResC~~~~g~yvKDLs~LgRdL~rVIIVDnsp~s~~~qpdN~I~I~~f~gd~~D~eLl~  169 (220)
                      +||++|++.|||++.|.+++||++|....+.++|||+++||++++||||||++.+|..||+|+|+|++|.|+++|+||+.
T Consensus        82 ~YA~~il~~ldp~~~~~~~~~r~~c~~~~~~~~KdL~~l~~~l~~vvivDd~~~~~~~~~~N~I~I~~f~~~~~D~eL~~  161 (181)
T d1ta0a_          82 KYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHD  161 (181)
T ss_dssp             HHHHHHHHHHCSSCCEEEEECGGGSEEETTEEECCGGGSCSCGGGEEEECSCGGGGTTCGGGBCCCCCCSSCTTCCHHHH
T ss_pred             HHHHHHHHHhccCCceeEEEEeeeeeecCCcccccHhhcCCCHHHeEEEcCChhhhhcCccCeeEecCcCCCCCcHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhccCCCChHHHHhh
Q psy1552         170 LVPFFERLSKMDSVYSFLRN  189 (220)
Q Consensus       170 Llp~Le~L~~~~DVR~vL~~  189 (220)
                      |+++|+.|++++|||++|++
T Consensus       162 l~~~L~~l~~~~DVR~~l~~  181 (181)
T d1ta0a_         162 LLPFFEQLSRVDDVYSVLRQ  181 (181)
T ss_dssp             HHHHHHHHTTCSCHHHHHCC
T ss_pred             HHHHHHHHccCCcHHHHhcC
Confidence            99999999999999999985
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure