Psyllid ID: psy15634


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MSLSSHHQHSYFSMPPGLDTSHLNLGEQHIKRPMNAFMVWSRIQRRKIALDNPKMHNSIIFNCHIMHFLCPQKIELKSKRDIHVEACRKSNLFDRDKGLDITNNICREKMTKM
ccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHcc
cccccccccccccccccccccccccccccccccccHHHHHcHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHccc
mslsshhqhsyfsmppgldtshlnlgeqhikrpmnaFMVWSRIQRRKIaldnpkmhnsiifnchimhflcpqkielkskrDIHVEACRksnlfdrdkglditNNICREKMTKM
MSLSSHHQHSYFSMPPGLDTSHLNLGEQHIKRPMNAFMVWSRIQRRKIALDNPKMHNSIIFNCHIMHFLCPQKIELKSKRDIHVEACrksnlfdrdkglditnnicrekmtkm
MSLSSHHQHSYFSMPPGLDTSHLNLGEQHIKRPMNAFMVWSRIQRRKIALDNPKMHNSIIFNCHIMHFLCPQKIELKSKRDIHVEACRKSNLFDRDKGLDITNNICREKMTKM
***************************QHIKRPMNAFMVWSRIQRRKIALDNPKMHNSIIFNCHIMHFLCPQKIELKSKRDIHVEACRKSNLFDRDKGLDITNNIC*******
**********************************NAFMVWSRIQRRKIALDNPKMHNSIIFNCHIMHFLCPQKIELKSKRDIHVEACR***********DITNNICREKMT**
***********FSMPPGLDTSHLNLGEQHIKRPMNAFMVWSRIQRRKIALDNPKMHNSIIFNCHIMHFLCPQKIELKSKRDIHVEACRKSNLFDRDKGLDITNNICREKMTKM
*****************************IKRPMNAFMVWSRI********N**MHNSIIFNCHIMHFLCPQKIELKSKRDIHVEACRKSNLFDRDKGLDITNNICREK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLSSHHQHSYFSMPPGLDTSHLNLGEQHIKRPMNAFMVWSRIQRRKIALDNPKMHNSIIFNCHIMHFLCPQKIELKSKRDIHVEACRKSNLFDRDKGLDITNNICREKMTKM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query113 2.2.26 [Sep-21-2011]
Q7SZS1 239 Transcription factor Sox- yes N/A 0.283 0.133 0.875 1e-10
Q24533 382 SOX domain-containing pro no N/A 0.300 0.089 0.852 2e-10
P53784 375 Transcription factor SOX- yes N/A 0.300 0.090 0.764 5e-10
P43267 231 Protein SOX-15 OS=Mus mus no N/A 0.530 0.259 0.441 7e-10
Q6TC28219 Sex-determining region Y N/A N/A 0.309 0.159 0.742 8e-10
Q6TC27219 Sex-determining region Y N/A N/A 0.309 0.159 0.742 8e-10
P41225 446 Transcription factor SOX- yes N/A 0.300 0.076 0.764 1e-09
P55863 309 Transcription factor Sox- N/A N/A 0.398 0.145 0.622 1e-09
Q6RVD7 245 Transcription factor Sox- no N/A 0.283 0.130 0.812 2e-09
Q9W7R6 240 Transcription factor SOX- yes N/A 0.283 0.133 0.843 2e-09
>sp|Q7SZS1|SX21A_DANRE Transcription factor Sox-21-A OS=Danio rerio GN=sox21a PE=2 SV=1 Back     alignment and function desciption
 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 30/32 (93%)

Query: 29 HIKRPMNAFMVWSRIQRRKIALDNPKMHNSII 60
          H+KRPMNAFMVWSR QRRK+ALDNPKMHNS I
Sbjct: 7  HVKRPMNAFMVWSRAQRRKMALDNPKMHNSEI 38




May function as a switch in neuronal development (By similarity). Acts as a negative regulator of transcription. Plays a role in dorsoventral patterning of the embryo.
Danio rerio (taxid: 7955)
>sp|Q24533|DICH_DROME SOX domain-containing protein dichaete OS=Drosophila melanogaster GN=D PE=2 SV=1 Back     alignment and function description
>sp|P53784|SOX3_MOUSE Transcription factor SOX-3 OS=Mus musculus GN=Sox3 PE=1 SV=2 Back     alignment and function description
>sp|P43267|SOX15_MOUSE Protein SOX-15 OS=Mus musculus GN=Sox15 PE=2 SV=3 Back     alignment and function description
>sp|Q6TC28|SRY_LUTLU Sex-determining region Y protein OS=Lutra lutra GN=SRY PE=3 SV=1 Back     alignment and function description
>sp|Q6TC27|SRY_ENHLU Sex-determining region Y protein OS=Enhydra lutris GN=SRY PE=3 SV=1 Back     alignment and function description
>sp|P41225|SOX3_HUMAN Transcription factor SOX-3 OS=Homo sapiens GN=SOX3 PE=1 SV=2 Back     alignment and function description
>sp|P55863|SOX3A_XENLA Transcription factor Sox-3-A OS=Xenopus laevis GN=sox3-a PE=1 SV=1 Back     alignment and function description
>sp|Q6RVD7|SX21B_DANRE Transcription factor Sox-21-B OS=Danio rerio GN=sox21b PE=2 SV=1 Back     alignment and function description
>sp|Q9W7R6|SOX14_CHICK Transcription factor SOX-14 OS=Gallus gallus GN=SOX14 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
350416776 311 PREDICTED: SOX domain-containing protein 0.513 0.186 0.585 2e-13
340721649 311 PREDICTED: SOX domain-containing protein 0.513 0.186 0.571 4e-12
383864574206 PREDICTED: SOX domain-containing protein 0.513 0.281 0.547 7e-12
380016546 279 PREDICTED: SOX domain-containing protein 0.513 0.207 0.547 2e-11
345494190 339 PREDICTED: transcription factor Sox-14-l 0.300 0.100 0.941 3e-11
242007463 261 transcription factor Sox-3, putative [Pe 0.380 0.164 0.739 2e-10
391326901 321 PREDICTED: uncharacterized protein LOC10 0.309 0.109 0.857 2e-10
442632266 587 Sox21b, isoform C [Drosophila melanogast 0.300 0.057 0.882 2e-10
195128971 614 GI11537 [Drosophila mojavensis] gi|19392 0.300 0.055 0.882 3e-10
91083767 217 PREDICTED: similar to AGAP010919-PA [Tri 0.309 0.161 0.885 4e-10
>gi|350416776|ref|XP_003491097.1| PREDICTED: SOX domain-containing protein dichaete-like [Bombus impatiens] Back     alignment and taxonomy information
 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/70 (58%), Positives = 46/70 (65%), Gaps = 12/70 (17%)

Query: 3  LSSHHQHSYFSMPPGLDTSHL------------NLGEQHIKRPMNAFMVWSRIQRRKIAL 50
          +SSH QH  +   PG+D   +             L EQHIKRPMNAFMVWSRIQR+KIAL
Sbjct: 2  ISSHQQHPSYGFLPGMDLHSIHRVNQDMNQQTPTLQEQHIKRPMNAFMVWSRIQRKKIAL 61

Query: 51 DNPKMHNSII 60
          DNPKMHNS I
Sbjct: 62 DNPKMHNSEI 71




Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340721649|ref|XP_003399229.1| PREDICTED: SOX domain-containing protein dichaete-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383864574|ref|XP_003707753.1| PREDICTED: SOX domain-containing protein dichaete-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380016546|ref|XP_003692243.1| PREDICTED: SOX domain-containing protein dichaete-like [Apis florea] Back     alignment and taxonomy information
>gi|345494190|ref|XP_003427240.1| PREDICTED: transcription factor Sox-14-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242007463|ref|XP_002424559.1| transcription factor Sox-3, putative [Pediculus humanus corporis] gi|212508002|gb|EEB11821.1| transcription factor Sox-3, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|391326901|ref|XP_003737948.1| PREDICTED: uncharacterized protein LOC100900235 [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|442632266|ref|NP_001261829.1| Sox21b, isoform C [Drosophila melanogaster] gi|440215768|gb|AGB94522.1| Sox21b, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195128971|ref|XP_002008932.1| GI11537 [Drosophila mojavensis] gi|193920541|gb|EDW19408.1| GI11537 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|91083767|ref|XP_972019.1| PREDICTED: similar to AGAP010919-PA [Tribolium castaneum] gi|270008129|gb|EFA04577.1| dichaete [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query113
FB|FBgn0042630 571 Sox21b "Sox21b" [Drosophila me 0.513 0.101 0.6 2e-11
ZFIN|ZDB-GENE-990715-6 239 sox21a "SRY-box containing gen 0.283 0.133 0.875 3.5e-11
FB|FBgn0036411 388 Sox21a "Sox21a" [Drosophila me 0.477 0.139 0.593 4.2e-11
WB|WBGene00004950212 sox-3 [Caenorhabditis elegans 0.398 0.212 0.673 7.4e-11
FB|FBgn0000411 382 D "Dichaete" [Drosophila melan 0.300 0.089 0.852 1.8e-10
UNIPROTKB|E1BHN5 204 LOC614121 "Uncharacterized pro 0.283 0.156 0.812 4.1e-10
ZFIN|ZDB-GENE-040429-1 245 sox21b "SRY-box containing gen 0.283 0.130 0.812 6e-10
UNIPROTKB|B0ZTE1 262 sox21 "Transcription factor So 0.283 0.122 0.812 8e-10
ZFIN|ZDB-GENE-051113-268 238 sox14 "SRY-box containing gene 0.283 0.134 0.843 8.9e-10
UNIPROTKB|A4QNG3 239 sox14 "Transcription factor So 0.283 0.133 0.843 9.1e-10
FB|FBgn0042630 Sox21b "Sox21b" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 166 (63.5 bits), Expect = 2.0e-11, P = 2.0e-11
 Identities = 36/60 (60%), Positives = 41/60 (68%)

Query:     1 MSLSSHHQHSYFSMPPGLDTSHLNLGEQHIKRPMNAFMVWSRIQRRKIALDNPKMHNSII 60
             M+  S     +FS+     T   N  E+HIKRPMNAFMVWSR+QRRKIA DNPKMHNS I
Sbjct:   221 MNSGSSASDVFFSLMIQNTTKRQN--EEHIKRPMNAFMVWSRLQRRKIAQDNPKMHNSEI 278




GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0008301 "DNA binding, bending" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
ZFIN|ZDB-GENE-990715-6 sox21a "SRY-box containing gene 21a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0036411 Sox21a "Sox21a" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00004950 sox-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0000411 D "Dichaete" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BHN5 LOC614121 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040429-1 sox21b "SRY-box containing gene 21 b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B0ZTE1 sox21 "Transcription factor Sox-21" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051113-268 sox14 "SRY-box containing gene 14" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A4QNG3 sox14 "Transcription factor Sox-14" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
cd0138872 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I 1e-11
pfam0050569 pfam00505, HMG_box, HMG (high mobility group) box 2e-08
smart0039870 smart00398, HMG, high mobility group 8e-07
cd0008466 cd00084, HMG-box, High Mobility Group (HMG)-box is 4e-05
>gnl|CDD|238684 cd01388, SOX-TCF_HMG-box, SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
 Score = 55.0 bits (133), Expect = 1e-11
 Identities = 17/32 (53%), Positives = 22/32 (68%)

Query: 29 HIKRPMNAFMVWSRIQRRKIALDNPKMHNSII 60
          HIKRPMNAFM++S+  RRK+  + P   N  I
Sbjct: 1  HIKRPMNAFMLFSKRHRRKVLQEYPLKENRAI 32


These proteins contain a single HMG box, and bind the minor groove of DNA in a highly sequence-specific manner. Members include SRY and its homologs in insects and vertebrates, and transcription factor-like proteins, TCF-1, -3, -4, and LEF-1. They appear to bind the minor groove of the A/T C A A A G/C-motif. Length = 72

>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box Back     alignment and domain information
>gnl|CDD|197700 smart00398, HMG, high mobility group Back     alignment and domain information
>gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 113
KOG0527|consensus 331 99.97
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 99.92
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 99.88
KOG0528|consensus511 99.87
PTZ0019994 high mobility group protein; Provisional 99.72
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 99.68
smart0039870 HMG high mobility group. 99.66
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 99.6
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 99.6
COG5648211 NHP6B Chromatin-associated proteins containing the 99.54
KOG3248|consensus 421 99.49
KOG0381|consensus96 99.32
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 99.29
KOG2746|consensus 683 99.24
KOG0526|consensus615 99.21
KOG4715|consensus 410 97.91
PF04769201 MAT_Alpha1: Mating-type protein MAT alpha 1; Inter 97.25
PF0807355 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 96.8
PF04690170 YABBY: YABBY protein; InterPro: IPR006780 YABBY pr 96.03
PF06382183 DUF1074: Protein of unknown function (DUF1074); In 83.11
COG5648211 NHP6B Chromatin-associated proteins containing the 81.54
>KOG0527|consensus Back     alignment and domain information
Probab=99.97  E-value=1.5e-30  Score=207.23  Aligned_cols=83  Identities=37%  Similarity=0.414  Sum_probs=77.2

Q ss_pred             CCCCCCCCCCCCCCCchHHHHHHHHHHHHHhhCCCCChHHHHHHhhhhcCC-------hhHhhHHHHHHHHHHHhcCCcc
Q psy15634         20 TSHLNLGEQHIKRPMNAFMVWSRIQRRKIALDNPKMHNSIIFNCHIMHFLC-------PQKIELKSKRDIHVEACRKSNL   92 (113)
Q Consensus        20 ~~~~~k~~~~~KRPlNAFmlf~~~~R~~v~~~~P~~~~~eISk~LG~~Wk~-------~y~~~a~~~k~~h~~a~p~yky   92 (113)
                      +...++...||||||||||+|++++|++|.++||+|+|+||||.||.+||.       ||.++|+++|..|+++||||||
T Consensus        53 ~~~~k~~~~hIKRPMNAFMVWSq~~RRkma~qnP~mHNSEISK~LG~~WK~Lse~EKrPFi~EAeRLR~~HmkehPdYKY  132 (331)
T KOG0527|consen   53 GMKDKTSTDRIKRPMNAFMVWSQGQRRKLAKQNPKMHNSEISKRLGAEWKLLSEEEKRPFVDEAERLRAQHMKEYPDYKY  132 (331)
T ss_pred             cccCCCCccccCCCcchhhhhhHHHHHHHHHhCcchhhHHHHHHHHHHHhhcCHhhhccHHHHHHHHHHHHHHhCCCccc
Confidence            444678899999999999999999999999999999999999999999985       8999999999999999999999


Q ss_pred             CCCCCCCCCC
Q psy15634         93 FDRDKGLDIT  102 (113)
Q Consensus        93 ~pr~k~~~~~  102 (113)
                      +||||.+...
T Consensus       133 RPRRKkk~~~  142 (331)
T KOG0527|consen  133 RPRRKKKKRP  142 (331)
T ss_pred             cccccccccc
Confidence            9999987643



>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>KOG0528|consensus Back     alignment and domain information
>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3248|consensus Back     alignment and domain information
>KOG0381|consensus Back     alignment and domain information
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>KOG2746|consensus Back     alignment and domain information
>KOG0526|consensus Back     alignment and domain information
>KOG4715|consensus Back     alignment and domain information
>PF04769 MAT_Alpha1: Mating-type protein MAT alpha 1; InterPro: IPR006856 This family includes Saccharomyces cerevisiae (Baker's yeast) mating type protein alpha 1 (P01365 from SWISSPROT) Back     alignment and domain information
>PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] Back     alignment and domain information
>PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] Back     alignment and domain information
>PF06382 DUF1074: Protein of unknown function (DUF1074); InterPro: IPR024460 This family consists of several proteins which appear to be specific to Insecta Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
2le4_A81 Solution Structure Of The Hmg Box Dna-Binding Domai 2e-09
1gt0_D80 Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Le 2e-09
1o4x_B88 Ternary Complex Of The Dna Binding Domains Of The O 2e-09
2gzk_A159 Structure Of A Complex Of Tandem Hmg Boxes And Dna 1e-08
1j46_A85 3d Solution Nmr Structure Of The Wild Type Hmg-Box 2e-08
1hrz_A76 The 3d Structure Of The Human Sry-Dna Complex Solve 2e-08
1j47_A85 3d Solution Nmr Structure Of The M9i Mutant Of The 6e-08
3u2b_C79 Structure Of The Sox4 Hmg Domain Bound To Dna Lengt 9e-08
1i11_A81 Solution Structure Of The Dna Binding Domain, Sox-5 3e-07
2yul_A82 Solution Structure Of The Hmg Box Of Human Transcri 3e-06
4euw_A106 Crystal Structure Of A Hmg Domain Of Transcription 6e-06
4a3n_A71 Crystal Structure Of Hmg-Box Of Human Sox17 Length 1e-05
3f27_D83 Structure Of Sox17 Bound To Dna Length = 83 1e-05
>pdb|2LE4|A Chain A, Solution Structure Of The Hmg Box Dna-Binding Domain Of Human Stem Cell Transcription Factor Sox2 Length = 81 Back     alignment and structure

Iteration: 1

Score = 57.4 bits (137), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 25/31 (80%), Positives = 28/31 (90%) Query: 30 IKRPMNAFMVWSRIQRRKIALDNPKMHNSII 60 +KRPMNAFMVWSR QRRK+A +NPKMHNS I Sbjct: 4 VKRPMNAFMVWSRGQRRKMAQENPKMHNSEI 34
>pdb|1GT0|D Chain D, Crystal Structure Of A PouHMGDNA TERNARY COMPLEX Length = 80 Back     alignment and structure
>pdb|1O4X|B Chain B, Ternary Complex Of The Dna Binding Domains Of The Oct1 And Sox2 Transcription Factors With A 19mer Oligonucleotide From The Hoxb1 Regulatory Element Length = 88 Back     alignment and structure
>pdb|2GZK|A Chain A, Structure Of A Complex Of Tandem Hmg Boxes And Dna Length = 159 Back     alignment and structure
>pdb|1J46|A Chain A, 3d Solution Nmr Structure Of The Wild Type Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 Back     alignment and structure
>pdb|1HRZ|A Chain A, The 3d Structure Of The Human Sry-Dna Complex Solved By Multi-Dimensional Heteronuclear-Edited And-Filtered Nmr Length = 76 Back     alignment and structure
>pdb|1J47|A Chain A, 3d Solution Nmr Structure Of The M9i Mutant Of The Hmg-Box Domain Of The Human Male Sex Determining Factor Sry Complexed To Dna Length = 85 Back     alignment and structure
>pdb|3U2B|C Chain C, Structure Of The Sox4 Hmg Domain Bound To Dna Length = 79 Back     alignment and structure
>pdb|1I11|A Chain A, Solution Structure Of The Dna Binding Domain, Sox-5 Hmg Box From Mouse Length = 81 Back     alignment and structure
>pdb|2YUL|A Chain A, Solution Structure Of The Hmg Box Of Human Transcription Factor Sox-17 Length = 82 Back     alignment and structure
>pdb|4EUW|A Chain A, Crystal Structure Of A Hmg Domain Of Transcription Factor Sox-9 Bound To Dna (Sox-9DNA) FROM HOMO SAPIENS AT 2.77 A RESOLUTION Length = 106 Back     alignment and structure
>pdb|4A3N|A Chain A, Crystal Structure Of Hmg-Box Of Human Sox17 Length = 71 Back     alignment and structure
>pdb|3F27|D Chain D, Structure Of Sox17 Bound To Dna Length = 83 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query113
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 2e-15
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 3e-15
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 3e-15
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 5e-15
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 1e-14
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 2e-14
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 2e-14
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 3e-14
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 4e-14
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 4e-14
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 8e-14
1wgf_A90 Upstream binding factor 1; transcription factor, D 2e-13
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 7e-12
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 4e-06
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 2e-09
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 7e-09
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 1e-07
1hme_A77 High mobility group protein fragment-B; DNA-bindin 2e-07
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 4e-07
2lhj_A97 High mobility group protein homolog NHP1; structur 6e-07
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 6e-06
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 3e-05
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 3e-05
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 7e-05
1ckt_A71 High mobility group 1 protein; high-mobility group 3e-04
2yrq_A173 High mobility group protein B1; HMG box domain, DN 9e-04
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Length = 81 Back     alignment and structure
 Score = 64.5 bits (158), Expect = 2e-15
 Identities = 23/35 (65%), Positives = 26/35 (74%)

Query: 26 GEQHIKRPMNAFMVWSRIQRRKIALDNPKMHNSII 60
          G  HIKRPMNAFMVW++ +RRKI    P MHNS I
Sbjct: 1  GSPHIKRPMNAFMVWAKDERRKILQAFPDMHNSNI 35


>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Length = 76 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} Length = 71 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A Length = 83 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Length = 85 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Length = 106 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} Length = 79 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Length = 86 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Length = 80 Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Length = 73 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} PDB: 1e7j_A* 1hma_A 1qrv_A* Length = 73 Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Length = 71 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 99.93
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 99.92
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 99.92
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 99.92
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 99.91
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 99.91
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 99.91
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 99.91
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 99.9
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 99.89
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 99.88
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 99.85
1hme_A77 High mobility group protein fragment-B; DNA-bindin 99.85
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 99.85
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 99.85
1wgf_A90 Upstream binding factor 1; transcription factor, D 99.84
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 99.82
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 99.82
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 99.81
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 99.81
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 99.81
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 99.81
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 99.81
2lhj_A97 High mobility group protein homolog NHP1; structur 99.8
1ckt_A71 High mobility group 1 protein; high-mobility group 99.77
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.77
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.75
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.72
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.71
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 99.67
2cto_A93 Novel protein; high mobility group box domain, hel 99.66
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 99.63
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 99.62
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 99.61
3tmm_A 238 Transcription factor A, mitochondrial; HMG, high m 99.6
1l8y_A91 Upstream binding factor 1; HUBF, HMG box 5, DNA bi 99.59
3tq6_A 214 Transcription factor A, mitochondrial; transcripti 99.57
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.43
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.4
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
Probab=99.93  E-value=6.8e-26  Score=144.84  Aligned_cols=72  Identities=40%  Similarity=0.495  Sum_probs=66.6

Q ss_pred             CCCCCCCchHHHHHHHHHHHHHhhCCCCChHHHHHHhhhhcCC-------hhHhhHHHHHHHHHHHhcCCccCCCCCCC
Q psy15634         28 QHIKRPMNAFMVWSRIQRRKIALDNPKMHNSIIFNCHIMHFLC-------PQKIELKSKRDIHVEACRKSNLFDRDKGL   99 (113)
Q Consensus        28 ~~~KRPlNAFmlf~~~~R~~v~~~~P~~~~~eISk~LG~~Wk~-------~y~~~a~~~k~~h~~a~p~yky~pr~k~~   99 (113)
                      ++||||+||||||++++|..|..++|+++++|||++||++|++       +|...|++.+..|.+++|+|+|+|+++++
T Consensus         1 G~iKRP~naf~lf~~~~r~~~~~~~p~~~~~eisk~lg~~Wk~ls~~eK~~y~~~A~~~k~~y~~~~p~Yky~Prk~~k   79 (79)
T 3u2b_C            1 GHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIQEAERLRLKHMADYPDYKYRPRKKVK   79 (79)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHHTTSTTSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHSSSCCCCCCC---
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHCcCCCHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHCCCCeeCCCCCCC
Confidence            5899999999999999999999999999999999999999985       79999999999999999999999998864



>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 113
d1gt0d_80 a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 1e-08
d2lefa_86 a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE 2e-08
d1i11a_70 a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 2e-08
d1j46a_85 a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 5e-08
d1hsma_79 a.21.1.1 (A:) High mobility group protein 1, HMG1 7e-07
d1qrva_73 a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI 1e-06
d1wgfa_90 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 1e-06
d1lwma_93 a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces 4e-06
d1v63a_101 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 3e-05
d1k99a_91 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 4e-05
d1ckta_71 a.21.1.1 (A:) High mobility group protein 1, HMG1 1e-04
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure

class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: Sox-2
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 45.9 bits (109), Expect = 1e-08
 Identities = 25/32 (78%), Positives = 28/32 (87%)

Query: 29 HIKRPMNAFMVWSRIQRRKIALDNPKMHNSII 60
           +KRPMNAFMVWSR QRRK+A +NPKMHNS I
Sbjct: 2  RVKRPMNAFMVWSRGQRRKMAQENPKMHNSEI 33


>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query113
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.92
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 99.91
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 99.88
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 99.79
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 99.76
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 99.75
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 99.74
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 99.73
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 99.72
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 99.51
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 99.48
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: Sox-2
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.92  E-value=2.3e-25  Score=142.85  Aligned_cols=72  Identities=44%  Similarity=0.559  Sum_probs=68.6

Q ss_pred             CCCCCCCchHHHHHHHHHHHHHhhCCCCChHHHHHHhhhhcCC-------hhHhhHHHHHHHHHHHhcCCccCCCCCCC
Q psy15634         28 QHIKRPMNAFMVWSRIQRRKIALDNPKMHNSIIFNCHIMHFLC-------PQKIELKSKRDIHVEACRKSNLFDRDKGL   99 (113)
Q Consensus        28 ~~~KRPlNAFmlf~~~~R~~v~~~~P~~~~~eISk~LG~~Wk~-------~y~~~a~~~k~~h~~a~p~yky~pr~k~~   99 (113)
                      ++||||+||||||++++|..|.++||+++++|||++||++|++       +|...|++.+..|.+++|+|+|.|+++.+
T Consensus         1 ~kiKRP~nAy~lF~~~~r~~~~~~~p~~~~~eisk~~g~~W~~l~~eeK~~y~~~A~~~k~~y~~~~p~Yk~~p~rk~k   79 (80)
T d1gt0d_           1 DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTK   79 (80)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHHTTSTTSCHHHHHHHHHHHHTTSCHHHHHHHHHHHHHHHHHHHHHCTTCCCCCCCCCC
T ss_pred             CCCCCCCcHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHCcCCHHHHHHHHHHHHHHHHHHHHHCccccCCCCCCCC
Confidence            5799999999999999999999999999999999999999986       79999999999999999999999998765



>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure