Psyllid ID: psy15682

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220----
ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGMTKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNEQYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELSEDEEEEKKEEEKEEDKTPKLEDEGEDADCPA
cccccccccccccccccccccEEEEEEEccccccEEEccccccccccccccEEEEccccccHHHHHHcccccccccHHHHHHHHHcccccccEEcccccEEEEEEEEEEEEEEEccccccEEEEEEcccccEEEEcccccccccccEEEEEEccccHHcccHHHHHHHHHHccccccccEEEEEEEEEEcccccHHHHHHHHHcccccccccEEcccccccccc
HHHHHHHHccccHHHHcccccccEEEEEEHHHcEEEEEEcccEEEccccEEEEEEccccccHHHHHccccccHHHHHHHHHHHHHccccHHHHHHHccHHHHHHHcEEEEEEEEEcccccEEEEEEccccEEEEEEccccccccEEEEEEEEcHHHHHHHcHHHHHHHHHHHcccccccEEEcccccccccccccHHcccHHHcccHHcccHHccccccccccc
aldkiryesltdpsrleseknlhikiipnkeektltiidsgfipnkeektltiidsgigmtKADLVNnlgttaksgTKASMEALQAGadismigqfgvgfYSAYMVADKVTVtskhndneqyiwessaggsftikpdnsqplgrgtKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELSEDEEEEKKEEekeedktpkledegedadcpa
aldkiryesltdpsrleseknlhikiipnkeektltiidsgfipnkeeKTLTIIDSGIGMTKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNEQYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKkhsqfigypikllvekerekelsedeeeekkeeekeedktpkledegedadcpa
ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGMTKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNEQYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYieekkikeivkkHSQFIGYPIkllvekerekelsedeeeekkeeekeedktpkledeGEDADCPA
**********************HIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGMTKADLVNNLGT***********ALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNEQYIWES*******************TKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLV****************************************
ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGMTKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNEQYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLV****************************LEDEG*******
ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGMTKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNEQYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEK**************************************
ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGMTKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNEQYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLLVEK***************************E**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGMTKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNEQYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPIKLxxxxxxxxxxxxxxxxxxxxxxxxxxxTPKLEDEGEDADCPA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query224 2.2.26 [Sep-21-2011]
P02828 717 Heat shock protein 83 OS= yes N/A 0.897 0.280 0.723 9e-83
P04810 375 Heat shock protein 83 (Fr N/A N/A 0.897 0.536 0.719 2e-82
P30946 694 Heat shock protein HSP 90 yes N/A 0.866 0.279 0.682 4e-82
Q7PT10 720 Heat shock protein 83 OS= yes N/A 0.790 0.245 0.782 4e-82
O02192 716 Heat shock protein 83 OS= N/A N/A 0.790 0.247 0.777 3e-81
P82995 733 Heat shock protein HSP 90 yes N/A 0.803 0.245 0.719 5e-81
P04809 717 Heat shock protein 83 OS= yes N/A 0.901 0.281 0.707 6e-81
O16087269 Heat shock protein 83 (Fr N/A N/A 0.901 0.750 0.698 9e-81
P04811 374 Heat shock protein 83 (Fr N/A N/A 0.790 0.473 0.766 2e-80
P07901 733 Heat shock protein HSP 90 yes N/A 0.803 0.245 0.714 2e-80
>sp|P02828|HSP83_DROME Heat shock protein 83 OS=Drosophila melanogaster GN=Hsp83 PE=1 SV=1 Back     alignment and function desciption
 Score =  306 bits (783), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 185/221 (83%), Gaps = 20/221 (9%)

Query: 1   ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGM 60
           ALDKIRYESLTDPS+L+S K L+IK+IPNK         +G        TLTIID+GIGM
Sbjct: 43  ALDKIRYESLTDPSKLDSGKELYIKLIPNKT--------AG--------TLTIIDTGIGM 86

Query: 61  TKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNE 120
           TK+DLVNNLGT AKSGTKA MEALQAGADISMIGQFGVGFYSAY+VADKVTVTSK+ND+E
Sbjct: 87  TKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKNNDDE 146

Query: 121 QYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPI 180
           QY+WESSAGGSFT++ DNS+PLGRGTKIVL++KEDQ +Y+EE KIKEIV KHSQFIGYPI
Sbjct: 147 QYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNKHSQFIGYPI 206

Query: 181 KLLVEKEREKELSEDEEEEKKEEEKE----EDKTPKLEDEG 217
           KLLVEKEREKE+S+DE +++K+E  E    E   PK+ED G
Sbjct: 207 KLLVEKEREKEVSDDEADDEKKEGDEKKEMETDEPKIEDVG 247
Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.
Drosophila melanogaster (taxid: 7227)
>sp|P04810|HSP83_DROSI Heat shock protein 83 (Fragment) OS=Drosophila simulans GN=Hsp83 PE=3 SV=1 Back     alignment and function description
>sp|P30946|HS90A_RABIT Heat shock protein HSP 90-alpha OS=Oryctolagus cuniculus GN=HSP90AA1 PE=1 SV=2 Back     alignment and function description
>sp|Q7PT10|HSP83_ANOGA Heat shock protein 83 OS=Anopheles gambiae GN=Hsp83 PE=3 SV=3 Back     alignment and function description
>sp|O02192|HSP83_DROAV Heat shock protein 83 OS=Drosophila auraria GN=Hsp83 PE=3 SV=1 Back     alignment and function description
>sp|P82995|HS90A_RAT Heat shock protein HSP 90-alpha OS=Rattus norvegicus GN=Hsp90aa1 PE=1 SV=3 Back     alignment and function description
>sp|P04809|HSP83_DROPS Heat shock protein 83 OS=Drosophila pseudoobscura pseudoobscura GN=Hsp83 PE=3 SV=2 Back     alignment and function description
>sp|O16087|HSP83_DROMI Heat shock protein 83 (Fragment) OS=Drosophila miranda GN=Hsp83 PE=3 SV=1 Back     alignment and function description
>sp|P04811|HSP83_DROVI Heat shock protein 83 (Fragment) OS=Drosophila virilis GN=Hsp83 PE=3 SV=1 Back     alignment and function description
>sp|P07901|HS90A_MOUSE Heat shock protein HSP 90-alpha OS=Mus musculus GN=Hsp90aa1 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
89892739 714 heat shock protein 90 [Liriomyza sativae 0.919 0.288 0.726 7e-86
195431710 716 GK15907 [Drosophila willistoni] gi|19415 0.919 0.287 0.746 8e-85
89892737 714 heat shock protein 90 [Liriomyza huidobr 0.897 0.281 0.733 8e-85
301137080 723 heat shock protein 90 [Gryllus firmus] 0.799 0.247 0.794 1e-84
37963511317 heat shock protein 83 [Drosophila sucine 0.919 0.649 0.730 3e-84
195127443 717 GI13350 [Drosophila mojavensis] gi|19391 0.906 0.283 0.735 4e-84
117499964 716 heat shock protein 83 [Drosophila buzzat 0.897 0.280 0.745 5e-84
37963509 339 heat shock protein 83 [Drosophila capric 0.919 0.607 0.726 8e-84
226446417253 heat shock protein 90 [Apis mellifera] 0.875 0.774 0.709 8e-84
292606981 730 heat shock protein 90 [Nilaparvata lugen 0.888 0.272 0.725 9e-84
>gi|89892739|gb|AAW49253.2| heat shock protein 90 [Liriomyza sativae] Back     alignment and taxonomy information
 Score =  322 bits (825), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 162/223 (72%), Positives = 186/223 (83%), Gaps = 17/223 (7%)

Query: 1   ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGM 60
           ALDKIRYESLTDPS+L+S K L+IKIIPNK   TLT+                ID+GIGM
Sbjct: 44  ALDKIRYESLTDPSKLDSGKELYIKIIPNKANGTLTL----------------IDTGIGM 87

Query: 61  TKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNE 120
           TK DLVNNLGT AKSGTKA MEALQAGADISMIGQFGVGFYSAY+VADKVTVTSKHND+E
Sbjct: 88  TKTDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKHNDDE 147

Query: 121 QYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPI 180
           QY+WESSAGGSFT++ D+ +PLGRGTKIVLH+KEDQAEY+EE KIKE+V KHSQFIGYPI
Sbjct: 148 QYVWESSAGGSFTVRLDDGEPLGRGTKIVLHIKEDQAEYLEESKIKEVVNKHSQFIGYPI 207

Query: 181 KLLVEKEREKELSEDE-EEEKKEEEKEEDKTPKLEDEGEDADC 222
           KLLVEKER++E+S+DE E+E K+E+K +   PK+ED GED D 
Sbjct: 208 KLLVEKERDQEVSDDEAEDENKDEKKMDTDEPKIEDVGEDEDA 250

Source: Liriomyza sativae

Species: Liriomyza sativae

Genus: Liriomyza

Family: Agromyzidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195431710|ref|XP_002063871.1| GK15907 [Drosophila willistoni] gi|194159956|gb|EDW74857.1| GK15907 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|89892737|gb|AAW49252.2| heat shock protein 90 [Liriomyza huidobrensis] Back     alignment and taxonomy information
>gi|301137080|gb|ADK64952.1| heat shock protein 90 [Gryllus firmus] Back     alignment and taxonomy information
>gi|37963511|gb|AAR05879.1| heat shock protein 83 [Drosophila sucinea] Back     alignment and taxonomy information
>gi|195127443|ref|XP_002008178.1| GI13350 [Drosophila mojavensis] gi|193919787|gb|EDW18654.1| GI13350 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|117499964|gb|ABK34943.1| heat shock protein 83 [Drosophila buzzatii] Back     alignment and taxonomy information
>gi|37963509|gb|AAR05878.1| heat shock protein 83 [Drosophila capricorni] Back     alignment and taxonomy information
>gi|226446417|gb|ACO58574.1| heat shock protein 90 [Apis mellifera] Back     alignment and taxonomy information
>gi|292606981|gb|ADE34169.1| heat shock protein 90 [Nilaparvata lugens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query224
FB|FBgn0001233 717 Hsp83 "Heat shock protein 83" 0.732 0.228 0.711 1.9e-60
ZFIN|ZDB-GENE-031001-3 734 hsp90aa1.2 "heat shock protein 0.732 0.223 0.7 2.4e-60
UNIPROTKB|Q76LV2 733 HSP90AA1 "Heat shock protein H 0.732 0.223 0.672 8.1e-60
UNIPROTKB|P07900 732 HSP90AA1 "Heat shock protein H 0.732 0.224 0.672 8.1e-60
UNIPROTKB|O02705 733 HSP90AA1 "Heat shock protein H 0.732 0.223 0.672 8.1e-60
UNIPROTKB|Q9GKX7 733 HSP90AA1 "Heat shock protein H 0.732 0.223 0.672 8.1e-60
RGD|631409 733 Hsp90aa1 "heat shock protein 9 0.732 0.223 0.672 8.1e-60
UNIPROTKB|P46633 733 HSP90AA1 "Heat shock protein H 0.732 0.223 0.672 1e-59
UNIPROTKB|F1NKM3179 F1NKM3 "Uncharacterized protei 0.732 0.916 0.683 1.7e-59
UNIPROTKB|F1NKM6220 F1NKM6 "Uncharacterized protei 0.732 0.745 0.683 1.7e-59
FB|FBgn0001233 Hsp83 "Heat shock protein 83" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 619 (223.0 bits), Expect = 1.9e-60, P = 1.9e-60
 Identities = 128/180 (71%), Positives = 145/180 (80%)

Query:     1 ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGM 60
             ALDKIRYESLTDPS+L+S K L+IK+IPNK         +G        TLTIID+GIGM
Sbjct:    43 ALDKIRYESLTDPSKLDSGKELYIKLIPNKT--------AG--------TLTIIDTGIGM 86

Query:    61 TKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNE 120
             TK+DLVNNLGT AKSGTKA MEALQAGADISMIGQFGVGFYSAY+VADKVTVTSK+ND+E
Sbjct:    87 TKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKNNDDE 146

Query:   121 QYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYXXXXXXXXXXXXHSQFIGYPI 180
             QY+WESSAGGSFT++ DNS+PLGRGTKIVL++KEDQ +Y            HSQFIGYPI
Sbjct:   147 QYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNKHSQFIGYPI 206
GO:0007283 "spermatogenesis" evidence=IMP
GO:0042623 "ATPase activity, coupled" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISS;IDA;NAS
GO:0009408 "response to heat" evidence=IEP;ISS
GO:0006457 "protein folding" evidence=ISS;TAS
GO:0008293 "torso signaling pathway" evidence=NAS
GO:0008595 "anterior/posterior axis specification, embryo" evidence=TAS
GO:0007098 "centrosome cycle" evidence=IMP
GO:0005813 "centrosome" evidence=IDA
GO:0045187 "regulation of circadian sleep/wake cycle, sleep" evidence=IMP;TAS
GO:0007465 "R7 cell fate commitment" evidence=TAS
GO:0008360 "regulation of cell shape" evidence=IMP
GO:0007015 "actin filament organization" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0009631 "cold acclimation" evidence=IEP
GO:0005811 "lipid particle" evidence=IDA
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0019094 "pole plasm mRNA localization" evidence=IMP
GO:0048477 "oogenesis" evidence=IGI
GO:0010529 "negative regulation of transposition" evidence=IMP
GO:0005705 "polytene chromosome interband" evidence=IDA
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
ZFIN|ZDB-GENE-031001-3 hsp90aa1.2 "heat shock protein 90, alpha (cytosolic), class A member 1, tandem duplicate 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q76LV2 HSP90AA1 "Heat shock protein HSP 90-alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P07900 HSP90AA1 "Heat shock protein HSP 90-alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O02705 HSP90AA1 "Heat shock protein HSP 90-alpha" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9GKX7 HSP90AA1 "Heat shock protein HSP 90-alpha" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms
RGD|631409 Hsp90aa1 "heat shock protein 90, alpha (cytosolic), class A member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P46633 HSP90AA1 "Heat shock protein HSP 90-alpha" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKM3 F1NKM3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKM6 F1NKM6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P24724HSP90_THEPANo assigned EC number0.57790.88830.2760yesN/A
Q5R710HS90B_PONABNo assigned EC number0.69940.79010.2444yesN/A
P55737HS902_ARATHNo assigned EC number0.65770.75890.2432yesN/A
P07900HS90A_HUMANNo assigned EC number0.72020.79010.2418yesN/A
P07901HS90A_MOUSENo assigned EC number0.71420.80350.2455yesN/A
P51818HS903_ARATHNo assigned EC number0.66310.75890.2432yesN/A
Q7PT10HSP83_ANOGANo assigned EC number0.78230.79010.2458yesN/A
Q25293HSP83_LEIINNo assigned EC number0.59090.89730.2867yesN/A
P40292HSP90_ASPFUNo assigned EC number0.63730.78570.2492yesN/A
Q9GKX7HS90A_HORSENo assigned EC number0.72020.79010.2414yesN/A
P11501HS90A_CHICKNo assigned EC number0.72530.79010.2431yesN/A
P46633HS90A_CRIGRNo assigned EC number0.72020.79010.2414yesN/A
O43109HSP90_PODASNo assigned EC number0.64780.86600.2767yesN/A
P02828HSP83_DROMENo assigned EC number0.72390.89730.2803yesN/A
P54651HSC90_DICDINo assigned EC number0.64730.83030.2657yesN/A
O02705HS90A_PIGNo assigned EC number0.72020.79010.2414yesN/A
Q76LV2HS90A_BOVINNo assigned EC number0.72020.79010.2414yesN/A
O03986HS904_ARATHNo assigned EC number0.65770.75890.2432yesN/A
Q18688HSP90_CAEELNo assigned EC number0.66510.90170.2877yesN/A
P04809HSP83_DROPSNo assigned EC number0.70720.90170.2817yesN/A
P30946HS90A_RABITNo assigned EC number0.68200.86600.2795yesN/A
P82995HS90A_RATNo assigned EC number0.71930.80350.2455yesN/A
A5A6K9HS90A_PANTRNo assigned EC number0.71500.79010.2414yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
PTZ00272 701 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp 9e-75
PRK05218 613 PRK05218, PRK05218, heat shock protein 90; Provisi 3e-67
COG0326 623 COG0326, HtpG, Molecular chaperone, HSP90 family [ 1e-65
PTZ00130 814 PTZ00130, PTZ00130, heat shock protein 90; Provisi 2e-46
PRK14083 601 PRK14083, PRK14083, HSP90 family protein; Provisio 3e-20
pfam00183 529 pfam00183, HSP90, Hsp90 protein 2e-18
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyras 2e-06
pfam13589134 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyr 3e-06
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPas 3e-04
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; 3e-04
>gnl|CDD|240341 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information 
 Score =  238 bits (609), Expect = 9e-75
 Identities = 126/221 (57%), Positives = 166/221 (75%), Gaps = 18/221 (8%)

Query: 1   ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGM 60
           A DKIRY+SLTDPS L     L I+++P+KE KTLT+ D+G                IGM
Sbjct: 40  ACDKIRYQSLTDPSVLGESPRLCIRVVPDKENKTLTVEDNG----------------IGM 83

Query: 61  TKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNE 120
           TKADLVNNLGT A+SGTKA MEAL+AG D+SMIGQFGVGFYSAY+VAD+VTVTSK+N +E
Sbjct: 84  TKADLVNNLGTIARSGTKAFMEALEAGGDMSMIGQFGVGFYSAYLVADRVTVTSKNNSDE 143

Query: 121 QYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPI 180
            Y+WESSAGG+FTI       + RGT+I LH+KEDQ EY+E +++KE++KKHS+FIGY I
Sbjct: 144 SYVWESSAGGTFTITSTPESDMKRGTRITLHLKEDQMEYLEPRRLKELIKKHSEFIGYDI 203

Query: 181 KLLVEKEREKELSEDEEEE--KKEEEKEEDKTPKLEDEGED 219
           +L+VEK  EKE+++++EE+  K +E+ EE K  ++++  E 
Sbjct: 204 ELMVEKTTEKEVTDEDEEDTKKADEDGEEPKVEEVKEGDEG 244

Length = 701
>gnl|CDD|235366 PRK05218, PRK05218, heat shock protein 90; Provisional Back     alignment and domain information
>gnl|CDD|223403 COG0326, HtpG, Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185466 PTZ00130, PTZ00130, heat shock protein 90; Provisional Back     alignment and domain information
>gnl|CDD|237603 PRK14083, PRK14083, HSP90 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215774 pfam00183, HSP90, Hsp90 protein Back     alignment and domain information
>gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|222246 pfam13589, HATPase_c_3, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|214643 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 224
COG0326 623 HtpG Molecular chaperone, HSP90 family [Posttransl 100.0
KOG0020|consensus 785 100.0
PTZ00130 814 heat shock protein 90; Provisional 100.0
PTZ00272 701 heat shock protein 83 kDa (Hsp83); Provisional 100.0
KOG0019|consensus 656 100.0
PRK05218 613 heat shock protein 90; Provisional 100.0
PRK14083 601 HSP90 family protein; Provisional 100.0
PF13589137 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and 99.38
TIGR00585312 mutl DNA mismatch repair protein MutL. All protein 99.2
COG1389 538 DNA topoisomerase VI, subunit B [DNA replication, 99.11
PRK04184 535 DNA topoisomerase VI subunit B; Validated 98.84
TIGR01052 488 top6b DNA topoisomerase VI, B subunit. This model 98.72
PRK14868 795 DNA topoisomerase VI subunit B; Provisional 98.66
PRK00095 617 mutL DNA mismatch repair protein; Reviewed 98.55
PF00183 531 HSP90: Hsp90 protein; InterPro: IPR001404 Molecula 98.3
PRK05559 631 DNA topoisomerase IV subunit B; Reviewed 98.15
PRK14867 659 DNA topoisomerase VI subunit B; Provisional 98.09
smart00433 594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomeras 97.91
TIGR01055 625 parE_Gneg DNA topoisomerase IV, B subunit, proteob 97.88
TIGR01059 654 gyrB DNA gyrase, B subunit. This model describes t 97.86
PRK05644 638 gyrB DNA gyrase subunit B; Validated 97.79
COG0323 638 MutL DNA mismatch repair enzyme (predicted ATPase) 97.75
PF02518111 HATPase_c: Histidine kinase-, DNA gyrase B-, and H 97.73
PRK14939 756 gyrB DNA gyrase subunit B; Provisional 97.67
COG0187 635 GyrB Type IIA topoisomerase (DNA gyrase/topo II, t 96.99
TIGR01058 637 parE_Gpos DNA topoisomerase IV, B subunit, Gram-po 96.73
PTZ00109 903 DNA gyrase subunit b; Provisional 96.18
PHA02569 602 39 DNA topoisomerase II large subunit; Provisional 96.09
cd00075103 HATPase_c Histidine kinase-like ATPases; This fami 95.96
PRK10755356 sensor protein BasS/PmrB; Provisional 95.91
PTZ00108 1388 DNA topoisomerase 2-like protein; Provisional 95.84
PRK10604433 sensor protein RstB; Provisional 95.72
PLN03128 1135 DNA topoisomerase 2; Provisional 95.64
PRK09470461 cpxA two-component sensor protein; Provisional 95.41
PRK10549466 signal transduction histidine-protein kinase BaeS; 95.36
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine 95.36
KOG1979|consensus 694 95.23
PLN03237 1465 DNA topoisomerase 2; Provisional 95.22
PRK15347 921 two component system sensor kinase SsrA; Provision 94.55
TIGR02916679 PEP_his_kin putative PEP-CTERM system histidine ki 94.53
PRK11006430 phoR phosphate regulon sensor protein; Provisional 94.51
PRK11100475 sensory histidine kinase CreC; Provisional 94.37
KOG1978|consensus 672 94.27
PRK09303380 adaptive-response sensory kinase; Validated 94.04
PRK11466 914 hybrid sensory histidine kinase TorS; Provisional 93.76
TIGR01386457 cztS_silS_copS heavy metal sensor kinase. Members 93.57
TIGR02966333 phoR_proteo phosphate regulon sensor kinase PhoR. 93.38
PRK10618 894 phosphotransfer intermediate protein in two-compon 93.27
PRK03660146 anti-sigma F factor; Provisional 93.13
TIGR02938494 nifL_nitrog nitrogen fixation negative regulator N 93.13
PRK15053545 dpiB sensor histidine kinase DpiB; Provisional 92.94
PRK09467435 envZ osmolarity sensor protein; Provisional 92.86
PRK10364457 sensor protein ZraS; Provisional 92.66
PRK11091 779 aerobic respiration control sensor protein ArcB; P 92.5
PRK10815485 sensor protein PhoQ; Provisional 92.47
PRK10841 924 hybrid sensory kinase in two-component regulatory 92.4
TIGR01925137 spIIAB anti-sigma F factor. This model describes t 92.13
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 91.7
PRK13837828 two-component VirA-like sensor kinase; Provisional 91.51
PRK10490895 sensor protein KdpD; Provisional 91.5
KOG1977|consensus 1142 91.49
PRK11086542 sensory histidine kinase DcuS; Provisional 91.06
TIGR03785703 marine_sort_HK proteobacterial dedicated sortase s 90.94
PRK09835482 sensor kinase CusS; Provisional 90.61
TIGR02956 968 TMAO_torS TMAO reductase sytem sensor TorS. This p 90.39
PRK11360607 sensory histidine kinase AtoS; Provisional 90.33
COG3290537 CitA Signal transduction histidine kinase regulati 89.68
PRK04069161 serine-protein kinase RsbW; Provisional 89.03
TIGR01924159 rsbW_low_gc serine-protein kinase RsbW. This model 87.95
COG0642336 BaeS Signal transduction histidine kinase [Signal 87.48
PRK10337449 sensor protein QseC; Provisional 86.01
PRK13557540 histidine kinase; Provisional 85.9
COG4585365 Signal transduction histidine kinase [Signal trans 84.11
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Si 83.29
COG4251750 Bacteriophytochrome (light-regulated signal transd 82.51
PRK09959 1197 hybrid sensory histidine kinase in two-component r 81.85
PRK11073348 glnL nitrogen regulation protein NR(II); Provision 81.07
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=8.2e-49  Score=377.10  Aligned_cols=172  Identities=52%  Similarity=0.855  Sum_probs=159.9

Q ss_pred             CcchhhhhhccCCCCcCCCCcceEEEEecCccccccccccCCcCCCCCcEEEEEeCCCCCCHHHHHHhhchhccccchhH
Q psy15682          1 ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGMTKADLVNNLGTTAKSGTKAS   80 (224)
Q Consensus         1 aldk~r~~~~~~~~~~~~~~~~~I~i~~n~~~a~~~~i~~~~~~d~~~~~L~I~DnGiGMt~~eL~~~l~tIg~Sg~~~f   80 (224)
                      |||||||++|++|.++..+++++|+|..|+++                ++|+|+|||||||+++++++|||||+||+++|
T Consensus        42 AidKlr~~al~~~~~~~~~~~~~I~i~~Dk~~----------------kTLtI~DNGIGMT~~Ev~~~LgTIAkSgT~~F  105 (623)
T COG0326          42 AIDKLRFEALSDPELGEGDSDLRIRISFDKDN----------------KTLTISDNGIGMTKDEVIENLGTIAKSGTKEF  105 (623)
T ss_pred             HHHHHHHHhccCccccCCCCCceEEEEEcccC----------------CEEEEEeCCCCCCHHHHHHHHHHhhhccHHHH
Confidence            79999999999999999999999999999999                99999999999999999999999999999999


Q ss_pred             HHHHHcC-CCCCccCCccceeeeEeeecCeEEEEeeeCC-CceeEEEeCCCCceEEeeCCCCCCCCCcEEEEEecCChHh
Q psy15682         81 MEALQAG-ADISMIGQFGVGFYSAYMVADKVTVTSKHND-NEQYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAE  158 (224)
Q Consensus        81 ~~~~~~~-~~~~~iGqFGIGf~S~Fmvad~V~V~Tk~~~-~~~~~w~s~~~~~~~v~~~~~~~~~~GT~I~L~Lk~~~~e  158 (224)
                      ++.+... .+.++||||||||||||||||+|+|+|++++ +.++.|+|+|.|.|+|.+.+.++. +||+|+|||+++..+
T Consensus       106 ~~~l~~~~~~~~lIGQFGVGFYSaFmVAdkV~V~T~~~~~~~~~~W~S~g~g~ytv~~~~~~~~-~GT~I~L~Lk~~e~e  184 (623)
T COG0326         106 LESLSEDQKDSDLIGQFGVGFYSAFMVADKVTVITRSAGEDEAYHWESDGEGEYTVEDIDKEPR-RGTEITLHLKEEEDE  184 (623)
T ss_pred             HHHhccccccccccccccchhhheeeeeeeEEEEeccCCCCcceEEEEcCCCceEEeeccCCCC-CCcEEEEEECCchHH
Confidence            9998754 4689999999999999999999999999997 567899999999999999754322 699999999999999


Q ss_pred             hhcHHHHHHHHHHhccccccceEEeeeeeee
Q psy15682        159 YIEEKKIKEIVKKHSQFIGYPIKLLVEKERE  189 (224)
Q Consensus       159 ~~~~~~vk~likkys~~i~~PI~v~~~~~~~  189 (224)
                      |++.++|+++|++||.||++||++.+++..+
T Consensus       185 fl~~~rl~~ivkkYSd~i~~PI~~~~~~~~~  215 (623)
T COG0326         185 FLEEWRLREIVKKYSDHIAYPIYIEGEKEKD  215 (623)
T ss_pred             HhhhhHHHHHHHHHhcccccceEEeeecccc
Confidence            9999999999999999999999998876553

>KOG0020|consensus Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>KOG0019|consensus Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>PRK14083 HSP90 family protein; Provisional Back     alignment and domain information
>PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit Back     alignment and domain information
>PRK14868 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>PF00183 HSP90: Hsp90 protein; InterPro: IPR001404 Molecular chaperones, or heat shock proteins (Hsps) are ubiquitous proteins that act to maintain proper protein folding within the cell [] Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>PRK14867 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit, proteobacterial Back     alignment and domain information
>TIGR01059 gyrB DNA gyrase, B subunit Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK14939 gyrB DNA gyrase subunit B; Provisional Back     alignment and domain information
>COG0187 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit, Gram-positive Back     alignment and domain information
>PTZ00109 DNA gyrase subunit b; Provisional Back     alignment and domain information
>PHA02569 39 DNA topoisomerase II large subunit; Provisional Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PTZ00108 DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PLN03128 DNA topoisomerase 2; Provisional Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>KOG1979|consensus Back     alignment and domain information
>PLN03237 DNA topoisomerase 2; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>KOG1978|consensus Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK15053 dpiB sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>KOG1977|consensus Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>TIGR03785 marine_sort_HK proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>TIGR01924 rsbW_low_gc serine-protein kinase RsbW Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
3inw_A228 Hsp90 N-Terminal Domain With Pochoxime A Length = 2 2e-68
3bm9_A226 Discovery Of Benzisoxazoles As Potent Inhibitors Of 3e-68
3r4m_A228 Optimization Of Potent, Selective, And Orally Bioav 3e-68
1uy6_A236 Human Hsp90-Alpha With 9-Butyl-8-(3,4,5-Trimethoxy- 3e-68
3b24_A229 Hsp90 Alpha N-Terminal Domain In Complex With An Am 3e-68
2bsm_A235 Novel, Potent Small Molecule Inhibitors Of The Mole 3e-68
2ye2_A252 Hsp90 Inhibitors And Drugs From Fragment And Virtua 3e-68
1uyi_A236 Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benzyl)-2-F 3e-68
2yi0_A229 Structural Characterization Of 5-Aryl-4-(5-Substitu 3e-68
4eeh_A229 Hsp90 Alpha N-Terminal Domain In Complex With An In 3e-68
2ye7_A252 Hsp90 Inhibitors And Drugs From Fragment And Virtua 3e-68
3tuh_A209 Crystal Structure Of The N-Terminal Domain Of An Hs 3e-68
3d0b_A232 Crystal Structure Of Benzamide Tetrahydro-4h-Carbaz 4e-68
3hhu_A224 Human Heat-Shock Protein 90 (Hsp90) In Complex With 4e-68
3qdd_A237 Hsp90a N-Terminal Domain In Complex With Biib021 Le 4e-68
4awo_A230 Complex Of Hsp90 Atpase Domain With Tropane Derived 4e-68
4egh_A232 Hsp90-Alpha Atpase Domain In Complex With (4-Hydrox 4e-68
3k98_A232 Hsp90 N-Terminal Domain In Complex With (1r)-2-(5-C 4e-68
3eko_A226 Dihydroxylphenyl Amides As Inhibitors Of The Hsp90 4e-68
2qfo_A207 Hsp90 Complexed With A143571 And A516383 Length = 2 4e-68
1osf_A215 Human Hsp90 In Complex With 17-desmethoxy-17-n,n- D 4e-68
2yjw_A209 Tricyclic Series Of Hsp90 Inhibitors Length = 209 4e-68
3k97_A251 Hsp90 N-Terminal Domain In Complex With 4-Chloro-6- 4e-68
2fwy_A256 Structure Of Human Hsp90-Alpha Bound To The Potent 4e-68
3ft5_A249 Structure Of Hsp90 Bound With A Novel Fragment Leng 5e-68
2jjc_A218 Hsp90 Alpha Atpase Domain With Bound Small Molecule 5e-68
1byq_A228 Hsp90 N-Terminal Domain Bound To Adp-Mg Length = 22 6e-68
2ccs_A236 Human Hsp90 With 4-Chloro-6-(4-Piperazin-1-Yl-1h-Py 6e-68
2k5b_A210 Human Cdc37-Hsp90 Docking Model Based On Nmr Length 6e-68
2xdu_A236 Structre Of Hsp90 With Small Molecule Inhibitor Bou 7e-68
2qf6_A207 Hsp90 Complexed With A56322 Length = 207 7e-68
2xjg_A249 Structure Of Hsp90 With Small Molecule Inhibitor Bo 9e-68
1yc1_A264 Crystal Structures Of Human Hsp90alpha Complexed Wi 9e-68
2yee_A252 Hsp90 Inhibitors And Drugs From Fragment And Virtua 3e-67
2xjj_A249 Structre Of Hsp90 With Small Molecule Inhibitor Bou 4e-67
1uym_A220 Human Hsp90-Beta With Pu3 (9-Butyl-8(3,4,5-Trimetho 3e-66
3nmq_A239 Hsp90b N-Terminal Domain In Complex With Ec44, A Py 6e-66
4gqt_A227 N-Terminal Domain Of C. Elegans Hsp90 Length = 227 1e-61
2jki_A223 Complex Of Hsp90 N-terminal And Sgt1 Cs Domain Leng 6e-58
2xcm_A214 Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord 9e-58
3k60_A223 Crystal Structure Of N-Terminal Domain Of Plasmodiu 1e-55
3h80_A231 Crystal Structure Of The Amino-Terminal Domain Of H 3e-55
2xx2_A214 Macrolactone Inhibitor Bound To Hsp90 N-Term Length 1e-53
1am1_A213 Atp Binding Site In The Hsp90 Molecular Chaperone L 1e-53
1us7_A214 Complex Of Hsp90 And P50 Length = 214 2e-53
2cg9_A 677 Crystal Structure Of An Hsp90-Sba1 Closed Chaperone 2e-53
2bre_A219 Structure Of A Hsp90 Inhibitor Bound To The N-Termi 2e-53
2wep_A220 Yeast Hsp90 N-Terminal Domain Li-Iv Mutant With Adp 2e-53
1ah8_A220 Structure Of The Orthorhombic Form Of The N-Termina 2e-53
1bgq_A225 Radicicol Bound To The Atp Binding Site Of The N-Te 2e-53
1a4h_A230 Structure Of The N-Terminal Domain Of The Yeast Hsp 2e-53
2cgf_A225 A Radicicol Analogue Bound To The Atp Binding Site 2e-53
2akp_A186 Hsp90 Delta24-n210 Mutant Length = 186 3e-53
1zw9_A240 Yeast Hsp82 In Complex With The Novel Hsp90 Inhibit 4e-53
3o6o_A214 Crystal Structure Of The N-Terminal Domain Of An Hs 5e-53
3opd_A231 Crystal Structure Of The N-Terminal Domain Of An Hs 6e-53
2yge_A220 E88g-n92l Mutant Of N-term Hsp90 Complexed With Gel 1e-52
2ygf_A220 L89v, L93i And V136m Mutant Of N-term Hsp90 Complex 3e-52
3c0e_A240 Yeast Hsp82 N-Terminal Domain: Effects Of Mutants 9 3e-52
2yga_A220 E88g-n92l Mutant Of N-term Hsp90 Complexed With Gel 7e-52
3peh_A281 Crystal Structure Of The N-Terminal Domain Of An Hs 1e-42
1qy5_A269 Crystal Structure Of The N-Domain Of The Er Hsp90 C 4e-33
1u0y_A273 N-Domain Of Grp94, With The Charged Domain, In Comp 4e-33
1u2o_A236 Crystal Structure Of The N-Domain Of Grp94 Lacking 5e-33
2o1u_A 666 Structure Of Full Length Grp94 With Amp-Pnp Bound L 1e-32
2o1w_A 506 Structure Of N-Terminal Plus Middle Domains (N+m) O 1e-32
2esa_A236 Grp94 N-Terminal Domain Bound To Geldanamycin: Effe 5e-32
3ied_A272 Crystal Structure Of N-Terminal Domain Of Plasmodiu 6e-29
2iop_A 624 Crystal Structure Of Full-Length Htpg, The Escheric 3e-26
2ior_A235 Crystal Structure Of The N-Terminal Domain Of Htpg, 4e-26
1y4s_A 559 Conformation Rearrangement Of Heat Shock Protein 90 4e-26
>pdb|3INW|A Chain A, Hsp90 N-Terminal Domain With Pochoxime A Length = 228 Back     alignment and structure 
Iteration: 1

 Score =  254 bits (649), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 141/180 (78%), Gaps = 16/180 (8%)
Query: 1   ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGM 60
           ALDKIRYESLTDPS+L+S K LHI +IPNK+++T                LTI+D+GIGM
Sbjct: 47  ALDKIRYESLTDPSKLDSGKELHINLIPNKQDRT----------------LTIVDTGIGM 90
Query: 61  TKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNE 120
           TKADL+NNLGT AKSGTKA MEALQAGADISMIGQFGVGFYSAY+VA+KVTV +KHND+E
Sbjct: 91  TKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDE 150
Query: 121 QYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYXXXXXXXXXXXXHSQFIGYPI 180
           QY WESSAGGSFT++ D  +P+GRGTK++LH+KEDQ EY            HSQFIGYPI
Sbjct: 151 QYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPI 210
>pdb|3BM9|A Chain A, Discovery Of Benzisoxazoles As Potent Inhibitors Of Chaperone Hsp90 Length = 226 Back     alignment and structure
>pdb|3R4M|A Chain A, Optimization Of Potent, Selective, And Orally Bioavailable Pyrrolodinopyrimidine-Containing Inhibitors Of Heat Shock Protein 90. Identification Of Development Candidate 2-Amino-4-{4-Chloro-2-[2-(4- Fluoro-1h-Pyrazol-1-Yl)ethoxy]-6-Methylphenyl}-N-(2,2- Difluoropropyl)-5,7-Dihydro-6h-Pyrrolo[3, 4-D]pyrimidine-6-Carboxamide Length = 228 Back     alignment and structure
>pdb|1UY6|A Chain A, Human Hsp90-Alpha With 9-Butyl-8-(3,4,5-Trimethoxy-Benzyl)-9h-Purin-6-Ylamine Length = 236 Back     alignment and structure
>pdb|3B24|A Chain A, Hsp90 Alpha N-Terminal Domain In Complex With An Aminotriazine Fragment Molecule Length = 229 Back     alignment and structure
>pdb|2BSM|A Chain A, Novel, Potent Small Molecule Inhibitors Of The Molecular Chaperone Hsp90 Discovered Through Structure-Based Design Length = 235 Back     alignment and structure
>pdb|2YE2|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 Back     alignment and structure
>pdb|1UYI|A Chain A, Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benzyl)-2-Fluoro-9- Pent-9h-Purin-6-Ylamine Length = 236 Back     alignment and structure
>pdb|2YI0|A Chain A, Structural Characterization Of 5-Aryl-4-(5-Substituted-2-4- Dihydroxyphenyl)-1,2,3-Thiadiazole Hsp90 Inhibitors. Length = 229 Back     alignment and structure
>pdb|4EEH|A Chain A, Hsp90 Alpha N-Terminal Domain In Complex With An Inhibitor 3-(4- Hydroxy-Phenyl)-1h-Indazol-6-Ol Length = 229 Back     alignment and structure
>pdb|2YE7|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 Back     alignment and structure
>pdb|3TUH|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 In The Presence Of An The Inhibitor Ganetespib Length = 209 Back     alignment and structure
>pdb|3D0B|A Chain A, Crystal Structure Of Benzamide Tetrahydro-4h-Carbazol-4-One Bound To Hsp90 Length = 232 Back     alignment and structure
>pdb|3HHU|A Chain A, Human Heat-Shock Protein 90 (Hsp90) In Complex With {4-[3- (2,4-Dihydroxy-5-Isopropyl-Phenyl)-5-Thioxo- 1,5-Dihydro- [1,2,4]triazol-4-Yl]-Benzyl}-Carbamic Acid Ethyl Ester {zk 2819} Length = 224 Back     alignment and structure
>pdb|3QDD|A Chain A, Hsp90a N-Terminal Domain In Complex With Biib021 Length = 237 Back     alignment and structure
>pdb|4AWO|A Chain A, Complex Of Hsp90 Atpase Domain With Tropane Derived Inhibitors Length = 230 Back     alignment and structure
>pdb|4EGH|A Chain A, Hsp90-Alpha Atpase Domain In Complex With (4-Hydroxyphenyl)morpholin- 4-Yl Methanone Length = 232 Back     alignment and structure
>pdb|3K98|A Chain A, Hsp90 N-Terminal Domain In Complex With (1r)-2-(5-Chloro-2, 4-Dihydroxybenzoyl)-N-Ethylisoindoline-1-Carboxamide Length = 232 Back     alignment and structure
>pdb|3EKO|A Chain A, Dihydroxylphenyl Amides As Inhibitors Of The Hsp90 Molecular Chaperone Length = 226 Back     alignment and structure
>pdb|2QFO|A Chain A, Hsp90 Complexed With A143571 And A516383 Length = 207 Back     alignment and structure
>pdb|1OSF|A Chain A, Human Hsp90 In Complex With 17-desmethoxy-17-n,n- Dimethylaminoethylamino-geldanamycin Length = 215 Back     alignment and structure
>pdb|2YJW|A Chain A, Tricyclic Series Of Hsp90 Inhibitors Length = 209 Back     alignment and structure
>pdb|3K97|A Chain A, Hsp90 N-Terminal Domain In Complex With 4-Chloro-6-{[(2r)-2- (2-Methylphenyl)pyrrolidin-1-Yl]carbonyl}benzene-1, 3-Diol Length = 251 Back     alignment and structure
>pdb|2FWY|A Chain A, Structure Of Human Hsp90-Alpha Bound To The Potent Water Soluble Inhibitor Pu-H64 Length = 256 Back     alignment and structure
>pdb|3FT5|A Chain A, Structure Of Hsp90 Bound With A Novel Fragment Length = 249 Back     alignment and structure
>pdb|2JJC|A Chain A, Hsp90 Alpha Atpase Domain With Bound Small Molecule Fragment Length = 218 Back     alignment and structure
>pdb|1BYQ|A Chain A, Hsp90 N-Terminal Domain Bound To Adp-Mg Length = 228 Back     alignment and structure
>pdb|2CCS|A Chain A, Human Hsp90 With 4-Chloro-6-(4-Piperazin-1-Yl-1h-Pyrazol-3- Yl)-Benzene-1,2-Diol Length = 236 Back     alignment and structure
>pdb|2K5B|A Chain A, Human Cdc37-Hsp90 Docking Model Based On Nmr Length = 210 Back     alignment and structure
>pdb|2XDU|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound Length = 236 Back     alignment and structure
>pdb|2QF6|A Chain A, Hsp90 Complexed With A56322 Length = 207 Back     alignment and structure
>pdb|2XJG|A Chain A, Structure Of Hsp90 With Small Molecule Inhibitor Bound Length = 249 Back     alignment and structure
>pdb|1YC1|A Chain A, Crystal Structures Of Human Hsp90alpha Complexed With Dihydroxyphenylpyrazoles Length = 264 Back     alignment and structure
>pdb|2YEE|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 Back     alignment and structure
>pdb|2XJJ|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound Length = 249 Back     alignment and structure
>pdb|1UYM|A Chain A, Human Hsp90-Beta With Pu3 (9-Butyl-8(3,4,5-Trimethoxy-Benzyl)-9h-Purin-6-Ylamine) Length = 220 Back     alignment and structure
>pdb|3NMQ|A Chain A, Hsp90b N-Terminal Domain In Complex With Ec44, A Pyrrolo-Pyrimidine Methoxypyridine Inhibitor Length = 239 Back     alignment and structure
>pdb|4GQT|A Chain A, N-Terminal Domain Of C. Elegans Hsp90 Length = 227 Back     alignment and structure
>pdb|2JKI|A Chain A, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain Length = 223 Back     alignment and structure
>pdb|2XCM|A Chain A, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 Domain Length = 214 Back     alignment and structure
>pdb|3K60|A Chain A, Crystal Structure Of N-Terminal Domain Of Plasmodium Falciparum Hsp90 (Pf07_0029) Bound To Adp Length = 223 Back     alignment and structure
>pdb|3H80|A Chain A, Crystal Structure Of The Amino-Terminal Domain Of Hsp90 From Leishmania Major, Lmjf33.0312:m1-K213 Length = 231 Back     alignment and structure
>pdb|2XX2|A Chain A, Macrolactone Inhibitor Bound To Hsp90 N-Term Length = 214 Back     alignment and structure
>pdb|1AM1|A Chain A, Atp Binding Site In The Hsp90 Molecular Chaperone Length = 213 Back     alignment and structure
>pdb|1US7|A Chain A, Complex Of Hsp90 And P50 Length = 214 Back     alignment and structure
>pdb|2CG9|A Chain A, Crystal Structure Of An Hsp90-Sba1 Closed Chaperone Complex Length = 677 Back     alignment and structure
>pdb|2BRE|A Chain A, Structure Of A Hsp90 Inhibitor Bound To The N-Terminus Of Yeast Hsp90. Length = 219 Back     alignment and structure
>pdb|2WEP|A Chain A, Yeast Hsp90 N-Terminal Domain Li-Iv Mutant With Adp Length = 220 Back     alignment and structure
>pdb|1AH8|A Chain A, Structure Of The Orthorhombic Form Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone Length = 220 Back     alignment and structure
>pdb|1BGQ|A Chain A, Radicicol Bound To The Atp Binding Site Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone Length = 225 Back     alignment and structure
>pdb|1A4H|A Chain A, Structure Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone In Complex With Geldanamycin Length = 230 Back     alignment and structure
>pdb|2CGF|A Chain A, A Radicicol Analogue Bound To The Atp Binding Site Of The N- Terminal Domain Of The Yeast Hsp90 Chaperone Length = 225 Back     alignment and structure
>pdb|2AKP|A Chain A, Hsp90 Delta24-n210 Mutant Length = 186 Back     alignment and structure
>pdb|1ZW9|A Chain A, Yeast Hsp82 In Complex With The Novel Hsp90 Inhibitor 8-(6-Bromo- Benzo[1, 3]dioxol-5-Ylsulfanyl)-9-(3-Isopropylamino-Propyl)- Adenine Length = 240 Back     alignment and structure
>pdb|3O6O|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Trypanosoma Brucei, Tb10.26.1080 In The Presence Of An The Inhibitor Biib021 Length = 214 Back     alignment and structure
>pdb|3OPD|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Trypanosoma Brucei, Tb10.26.1080 In The Presence Of A Benzamide Derivative Length = 231 Back     alignment and structure
>pdb|2YGE|A Chain A, E88g-n92l Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 Back     alignment and structure
>pdb|2YGF|A Chain A, L89v, L93i And V136m Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 Back     alignment and structure
>pdb|3C0E|A Chain A, Yeast Hsp82 N-Terminal Domain: Effects Of Mutants 98-99 Ks- Aa Length = 240 Back     alignment and structure
>pdb|2YGA|A Chain A, E88g-n92l Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 Back     alignment and structure
>pdb|3PEH|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Plasmodium Falciparum, Pfl1070c In The Presence Of A Thienopyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|1QY5|A Chain A, Crystal Structure Of The N-Domain Of The Er Hsp90 Chaperone Grp94 In Complex With The Specific Ligand Neca Length = 269 Back     alignment and structure
>pdb|1U0Y|A Chain A, N-Domain Of Grp94, With The Charged Domain, In Complex With The Novel Ligand N-Propyl Carboxyamido Adenosine Length = 273 Back     alignment and structure
>pdb|1U2O|A Chain A, Crystal Structure Of The N-Domain Of Grp94 Lacking The Charged Domain In Complex With Neca Length = 236 Back     alignment and structure
>pdb|2O1U|A Chain A, Structure Of Full Length Grp94 With Amp-Pnp Bound Length = 666 Back     alignment and structure
>pdb|2O1W|A Chain A, Structure Of N-Terminal Plus Middle Domains (N+m) Of Grp94 Length = 506 Back     alignment and structure
>pdb|2ESA|A Chain A, Grp94 N-Terminal Domain Bound To Geldanamycin: Effects Of Mutants 168- 169 Ks-Aa Length = 236 Back     alignment and structure
>pdb|3IED|A Chain A, Crystal Structure Of N-Terminal Domain Of Plasmodium Falciparum Hsp90 (Pf14_0417) In Complex With Amppn Length = 272 Back     alignment and structure
>pdb|2IOP|A Chain A, Crystal Structure Of Full-Length Htpg, The Escherichia Coli Hsp90, Bound To Adp Length = 624 Back     alignment and structure
>pdb|2IOR|A Chain A, Crystal Structure Of The N-Terminal Domain Of Htpg, The Escherichia Coli Hsp90, Bound To Adp Length = 235 Back     alignment and structure
>pdb|1Y4S|A Chain A, Conformation Rearrangement Of Heat Shock Protein 90 Upon Adp Binding Length = 559 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query224
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 1e-115
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 1e-114
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 1e-114
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 1e-113
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 1e-113
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 1e-112
3peh_A281 Endoplasmin homolog; structural genomics, structur 1e-110
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 1e-110
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 3e-99
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 3e-97
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 2e-92
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 1e-90
1y4s_A 559 Chaperone protein HTPG; HSP90, molecular chaperone 2e-85
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 2e-85
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Length = 264 Back     alignment and structure
 Score =  327 bits (841), Expect = e-115
 Identities = 141/198 (71%), Positives = 168/198 (84%), Gaps = 16/198 (8%)

Query: 1   ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGM 60
           ALDKIRYE+LTDPS+L+S K LHI +IPNK+++TLTI+D+G                IGM
Sbjct: 83  ALDKIRYETLTDPSKLDSGKELHINLIPNKQDRTLTIVDTG----------------IGM 126

Query: 61  TKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNE 120
           TKADL+NNLGT AKSGTKA MEALQAGADISMIGQFGVGFYSAY+VA+KVTV +KHND+E
Sbjct: 127 TKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDE 186

Query: 121 QYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPI 180
           QY WESSAGGSFT++ D  +P+GRGTK++LH+KEDQ EY+EE++IKEIVKKHSQFIGYPI
Sbjct: 187 QYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPI 246

Query: 181 KLLVEKEREKELSEDEEE 198
            L VEKER+KE+S+DE E
Sbjct: 247 TLFVEKERDKEVSDDEAE 264
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Length = 228 Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Length = 256 Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Length = 220 Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} Length = 239 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Length = 281 Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Length = 236 Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Length = 235 Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Length = 677 Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Length = 666 Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Length = 272 Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Length = 559 Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Length = 624 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
3peh_A281 Endoplasmin homolog; structural genomics, structur 100.0
3nmq_A239 Heat shock protein HSP 90-beta; ATPase, chaperone- 100.0
3ied_A272 Heat shock protein; HSP90, chaperone, structural g 100.0
1qy5_A269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 100.0
3o0i_A256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 100.0
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 100.0
3t0h_A228 Heat shock protein HSP 90-alpha; chaperone, ATPase 100.0
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 100.0
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 100.0
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, A 100.0
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 100.0
1y4s_A 559 Chaperone protein HTPG; HSP90, molecular chaperone 100.0
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 100.0
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; 100.0
1b63_A333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 99.5
1h7s_A 365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 99.34
3h4l_A 367 DNA mismatch repair protein PMS1; ATP binding, DNA 99.31
3na3_A 348 DNA mismatch repair protein MLH1; MUTL protein hom 99.1
1mu5_A 471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 98.76
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 98.65
1kij_A 390 DNA gyrase subunit B; topoisomerase, gyrase B-coum 98.49
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B 98.32
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 98.3
1s16_A 390 Topoisomerase IV subunit B; two-domain protein com 98.1
1zxm_A 400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozy 97.92
4duh_A220 DNA gyrase subunit B; structure-based drug design, 97.88
4emv_A226 DNA topoisomerase IV, B subunit; protein-inhibitor 97.85
1ei1_A 391 DNA gyrase B, GYRB; ATPase domain, dimer, isomeras 97.84
3cwv_A 369 DNA gyrase, B subunit, truncated; structural genom 97.46
3lnu_A 408 Topoisomerase IV subunit B; PARE, ATP-binding, nuc 97.44
1pvg_A 418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA 96.92
3ttz_A198 DNA gyrase subunit B; protein-inhibitor complex, A 96.39
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s 96.39
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, G 95.88
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 95.78
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 95.75
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 95.71
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 95.47
4gfh_A 1177 DNA topoisomerase 2; topoisomerase, protein-DNA co 95.43
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 95.36
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 95.27
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 95.27
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 95.25
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, sign 95.23
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 95.21
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein 95.19
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 94.74
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 94.53
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 94.46
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 94.36
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine 93.72
1b3q_A379 Protein (chemotaxis protein CHEA); histine kinase, 92.09
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 91.46
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, t 89.97
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-51  Score=367.26  Aligned_cols=199  Identities=51%  Similarity=0.789  Sum_probs=179.7

Q ss_pred             CcchhhhhhccCCCCcCCCCcceEEEEecCccccccccccCCcCCCCCcEEEEEeCCCCCCHHHHHHhhchhccccchhH
Q psy15682          1 ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGMTKADLVNNLGTTAKSGTKAS   80 (224)
Q Consensus         1 aldk~r~~~~~~~~~~~~~~~~~I~i~~n~~~a~~~~i~~~~~~d~~~~~L~I~DnGiGMt~~eL~~~l~tIg~Sg~~~f   80 (224)
                      |++|+||++|+|++++...+++.|+|++|+..                ++|+|.|||+|||+++|.++|++||+||++.|
T Consensus        61 A~~k~r~~~l~d~~~~~~~~~l~I~I~~d~~~----------------~tLtI~DNGiGMt~edL~~~LgtIa~Sgtk~f  124 (281)
T 3peh_A           61 ALEKIRFLSLSDESVLGEEKKLEIRISANKEK----------------NILSITDTGIGMTKVDLINNLGTIAKSGTSNF  124 (281)
T ss_dssp             HHHHHHHHHTTCGGGGTTCCCCCEEEEEETTT----------------TEEEEEECSCCCCHHHHHHHHHHHHHSCHHHH
T ss_pred             HHHHHHHHhcCCchhccCCCceEEEEEEcCCC----------------cEEEEEeCCCCCCHHHHHHHHHHHHhHhhhhH
Confidence            78999999999999999999999999999988                99999999999999999999999999999999


Q ss_pred             HHHHHc-CCCCCccCCccceeeeEeeecCeEEEEeeeCCCceeEEEeCCCCceEEeeCC-CCCCCCCcEEEEEecCChHh
Q psy15682         81 MEALQA-GADISMIGQFGVGFYSAYMVADKVTVTSKHNDNEQYIWESSAGGSFTIKPDN-SQPLGRGTKIVLHMKEDQAE  158 (224)
Q Consensus        81 ~~~~~~-~~~~~~iGqFGIGf~S~Fmvad~V~V~Tk~~~~~~~~w~s~~~~~~~v~~~~-~~~~~~GT~I~L~Lk~~~~e  158 (224)
                      +++++. +.+..+||||||||||+||+|++|+|.|+++++.+|.|++++++.|+|.+.+ +++..+||+|+|||++++.+
T Consensus       125 ~e~l~~~~~d~~~IGqFGVGFySaf~vadkV~V~Sk~~~~~~~~Wes~g~g~fti~~~~~~~~~~~GT~I~L~Lked~~e  204 (281)
T 3peh_A          125 LEAISKSGGDMSLIGQFGVGFYSAFLVADKVIVYTKNNDDEQYIWESTADAKFTIYKDPRGATLKRGTRISLHLKEDATN  204 (281)
T ss_dssp             HHHHHHTTCCSTTTTTTTCGGGGGGGTEEEEEEEEECTTSCCEEEEEETTSCEEEEECTTCSTTSSEEEEEEEECGGGGG
T ss_pred             HHhhhccccccccccccCccchhhccccCEEEEEEecCCCCEEEEEECCCccEEEEEcCCCCCCCCCeEEEEEECCchhh
Confidence            999976 5678999999999999999999999999998878999999999999999864 45678999999999999999


Q ss_pred             hhcHHHHHHHHHHhccccccceEEeeeeeeeeecCchHHHhhhhhhhhccCCCccccCCCC
Q psy15682        159 YIEEKKIKEIVKKHSQFIGYPIKLLVEKEREKELSEDEEEEKKEEEKEEDKTPKLEDEGED  219 (224)
Q Consensus       159 ~~~~~~vk~likkys~~i~~PI~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  219 (224)
                      |+++++|+++|++||+||+|||+++.+++.++|+++++++++++    ++++++.++++++
T Consensus       205 ~le~~~ik~ivkkys~fi~~pI~l~~~k~~~~ev~~~~~~~~~~----~~~~~~~e~~~~~  261 (281)
T 3peh_A          205 LLNDKKLMDLISKYSQFIQFPIYLLHENVYTEEVLADIAKDMVN----DPNYDSVKVEETD  261 (281)
T ss_dssp             GGSHHHHHHHHHHHTTTCCSCEEEEEEEEEEEEEEHHHHHHHTT----CTTSSEEEECCCC
T ss_pred             hcCHHHHHHHHHHhhccCCcceEEeeeeeeeeccCcchhhhccc----ccccccccccccc
Confidence            99999999999999999999999999999999999887654322    2345566655544
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Back     alignment and structure
>4duh_A DNA gyrase subunit B; structure-based drug design, antibacterial, DNA gyrase B, GY isomerase-isomerase inhibitor complex; HET: DNA RLI; 1.50A {Escherichia coli} PDB: 1aj6_A* 1kzn_A* 3g7e_A* Back     alignment and structure
>4emv_A DNA topoisomerase IV, B subunit; protein-inhibitor complex, ATP binding, structure-based drug antimicrobial, virtual screen; HET: DNA 0R9; 1.70A {Streptococcus pneumoniae GA47373} PDB: 4em7_A* Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} Back     alignment and structure
>3lnu_A Topoisomerase IV subunit B; PARE, ATP-binding, nucleotide-BI topoisomerase; 2.20A {Xanthomonas oryzae PV} PDB: 3lps_A* Back     alignment and structure
>1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* Back     alignment and structure
>3ttz_A DNA gyrase subunit B; protein-inhibitor complex, ATP-binding, structure-based drug antimicrobial, isomerase-isomerase inhibitor complex; HET: DNA 07N; 1.63A {Staphylococcus aureus} PDB: 3u2d_A* 3u2k_A* 3g75_A* 3g7b_A* Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>4gfh_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, DNA supercoiling, DNA replication; HET: DNA PTR TSP ANP; 4.41A {Saccharomyces cerevisiae} Back     alignment and structure
>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi-domai protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* 3ur1_A Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 224
d1uyla_208 d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 6e-47
d2iwxa1213 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharo 4e-45
d2gqpa1227 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) 9e-44
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: Heat shock protein 90, HSP90, N-terminal domain
domain: HSP90
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  152 bits (384), Expect = 6e-47
 Identities = 134/186 (72%), Positives = 157/186 (84%), Gaps = 16/186 (8%)

Query: 1   ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGM 60
           ALDKIRYESLTDPS+L+S K LHI +IPNK+++TLTI+D+G                IGM
Sbjct: 39  ALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTG----------------IGM 82

Query: 61  TKADLVNNLGTTAKSGTKASMEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNE 120
           TKADL+NNLGT AKSGTKA MEALQAGADISMIGQFGVGFYSAY+VA+KVTV +KHND+E
Sbjct: 83  TKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDE 142

Query: 121 QYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYIEEKKIKEIVKKHSQFIGYPI 180
           QY WESSAGGSFT++ D  +P+GRGTK++LH+KEDQ EY+EE++IKEIVKKHSQFIGYPI
Sbjct: 143 QYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPI 202

Query: 181 KLLVEK 186
            L VEK
Sbjct: 203 TLFVEK 208
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 213 Back     information, alignment and structure
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Length = 227 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query224
d1uyla_208 HSP90 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2gqpa1227 HSP90 {Dog (Canis familiaris) [TaxId: 9615]} 100.0
d2iwxa1213 HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1h7sa2203 DNA mismatch repair protein PMS2 {Human (Homo sapi 98.88
d2hkja3219 Topoisomerase VI-B subunit {Archaeon Sulfolobus sh 98.84
d1b63a2218 DNA mismatch repair protein MutL {Escherichia coli 98.55
d1pvga2239 DNA topoisomerase II {Baker's yeast (Saccharomyces 97.73
d1kija2212 DNA gyrase B {Thermus thermophilus [TaxId: 274]} 97.43
d1ei1a2219 DNA gyrase B {Escherichia coli [TaxId: 562]} 97.34
d1bxda_161 Histidine kinase domain of the osmosensor EnvZ {Es 97.24
d1jm6a2190 Pyruvate dehydrogenase kinase {Rat (Rattus norvegi 97.0
d1ysra1148 Sensor-type histidine kinase PrrB {Mycobacterium t 96.93
d1y8oa2125 Pyruvate dehydrogenase kinase {Human (Homo sapiens 96.59
d1id0a_146 Histidine kinase PhoQ domain {Escherichia coli [Ta 96.57
d2c2aa2161 Sensor histidine kinase TM0853 {Thermotoga maritim 96.53
d1th8a_139 Anti-sigma factor spoIIab {Bacillus stearothermoph 96.18
d1gkza2193 Branched-chain alpha-ketoacid dehydrogenase kinase 96.05
d1ixma_179 Sporulation response regulatory protein Spo0B {Bac 94.08
d1s14a_168 Topoisomerase IV subunit B {Escherichia coli [TaxI 92.65
d1r62a_156 Nitrogen regulation protein NtrB, C-terminal domai 84.71
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: Heat shock protein 90, HSP90, N-terminal domain
domain: HSP90
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.2e-47  Score=326.57  Aligned_cols=170  Identities=79%  Similarity=1.236  Sum_probs=155.6

Q ss_pred             CcchhhhhhccCCCCcCCCCcceEEEEecCccccccccccCCcCCCCCcEEEEEeCCCCCCHHHHHHhhchhccccchhH
Q psy15682          1 ALDKIRYESLTDPSRLESEKNLHIKIIPNKEEKTLTIIDSGFIPNKEEKTLTIIDSGIGMTKADLVNNLGTTAKSGTKAS   80 (224)
Q Consensus         1 aldk~r~~~~~~~~~~~~~~~~~I~i~~n~~~a~~~~i~~~~~~d~~~~~L~I~DnGiGMt~~eL~~~l~tIg~Sg~~~f   80 (224)
                      ||+|+||+.++++..+..++++.|+|..|..+                ++|+|+|||+|||+++|.++|++||+||++.|
T Consensus        39 A~~k~~~~~~~~~~~~~~~~~~~i~i~~d~~~----------------~~l~I~DnGiGMt~~el~~~LgtIa~Sg~~~f  102 (208)
T d1uyla_          39 ALDKIRYESLTDPSKLDSGKELHINLIPNKQD----------------RTLTIVDTGIGMTKADLINNLGTIAKSGTKAF  102 (208)
T ss_dssp             HHHHHHHHHHHCGGGGTTCCCCCEEEEEETTT----------------TEEEEEECSCCCCHHHHHTGGGSCHHHHHHHH
T ss_pred             HHHHHHHHhcCCchhccCCcccceEEeecCCc----------------cEEEEEcCCccccHHHHHhhcccccccchHHH
Confidence            68899999999998888888888999999888                99999999999999999999999999999999


Q ss_pred             HHHHHcCCCCCccCCccceeeeEeeecCeEEEEeeeCCCceeEEEeCCCCceEEeeCCCCCCCCCcEEEEEecCChHhhh
Q psy15682         81 MEALQAGADISMIGQFGVGFYSAYMVADKVTVTSKHNDNEQYIWESSAGGSFTIKPDNSQPLGRGTKIVLHMKEDQAEYI  160 (224)
Q Consensus        81 ~~~~~~~~~~~~iGqFGIGf~S~Fmvad~V~V~Tk~~~~~~~~w~s~~~~~~~v~~~~~~~~~~GT~I~L~Lk~~~~e~~  160 (224)
                      ++++..+.+.++|||||||||||||||++|+|.||+.++.++.|.+.+++.|++...+.....+||+|+|||+++..+|+
T Consensus       103 ~~~~~~~~~~~~IGqFGVGFyS~FmVad~v~V~sk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GT~I~L~lk~d~~efl  182 (208)
T d1uyla_         103 MEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYL  182 (208)
T ss_dssp             HHHHHTTCCGGGGGGGTCGGGGGGGTEEEEEEEEECTTSCCEEEEECSTTEEEEEECCSSCCSSEEEEEEEECGGGGGGG
T ss_pred             HHhhhhccchhhhhhcccceEEeeeccCceEEEEecCCcchheeeeccCCCceEEecccccCCCCcEEEEEeCCChHHHc
Confidence            99887777889999999999999999999999999988778888888888887776555667899999999999999999


Q ss_pred             cHHHHHHHHHHhccccccceEEeeee
Q psy15682        161 EEKKIKEIVKKHSQFIGYPIKLLVEK  186 (224)
Q Consensus       161 ~~~~vk~likkys~~i~~PI~v~~~~  186 (224)
                      +..+|+++|++||+||+|||++++++
T Consensus       183 ~~~~i~~likkys~fi~~PI~l~~ek  208 (208)
T d1uyla_         183 EERRIKEIVKKHSQFIGYPITLFVEK  208 (208)
T ss_dssp             SHHHHHHHHHHHCTTCSSCEEECCC-
T ss_pred             CHHHHHHHHHHHhcccCcCeEecccC
Confidence            99999999999999999999998753
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Back     information, alignment and structure
>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s14a_ d.122.1.2 (A:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure