Psyllid ID: psy15717


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--
MSRVERNGAGEIFVDLIKRNSEKSLEESRQNIKSDIASIEQTMSSIKTVMSDLKTHLYAKFGNHIKLEADDD
cccccccccccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
cccEEEccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
msrverngageIFVDLIKRNSEKSLEESRQNIKSDIASIEQTMSSIKTVMSDLKTHLYAKFGNhikleaddd
msrverngageifvdlikrnseksleESRQNIKSDIASIEQTMSSIKTVMSDLKTHLYAKfgnhikleaddd
MSRVERNGAGEIFVDLIKRNSEKSLEESRQNIKSDIASIEQTMSSIKTVMSDLKTHLYAKFGNHIKLEADDD
***********IFVDL*******************************TVMSDLKTHLYAKFGNHI*******
**RVERNGAGEIFVDLIKRN**************************KTVMSDLKTHLYAKFGNHIKL*****
MSRVERNGAGEIFVDLIKRNSE********NIKSDIASIEQTMSSIKTVMSDLKTHLYAKFGNHIKLEADDD
**RV*RNGAGEIFVDLIKRNSEKSLEESRQNIKSDIASIEQTMSSIKTVMSDLKTHLYAKFGN*IK******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRVERNGAGEIFVDLIKRNSxxxxxxxxxxxxxxxxxxxxxMSSIKTVMSDLKTHLYAKFGNHIKLEADDD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query72 2.2.26 [Sep-21-2011]
Q2TBR6134 Prefoldin subunit 4 OS=Bo yes N/A 0.861 0.462 0.403 9e-09
Q9NQP4134 Prefoldin subunit 4 OS=Ho yes N/A 0.861 0.462 0.403 1e-08
Q9VRL3138 Probable prefoldin subuni yes N/A 0.861 0.449 0.370 7e-06
>sp|Q2TBR6|PFD4_BOVIN Prefoldin subunit 4 OS=Bos taurus GN=PFDN4 PE=2 SV=1 Back     alignment and function desciption
 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 47/62 (75%)

Query: 10  GEIFVDLIKRNSEKSLEESRQNIKSDIASIEQTMSSIKTVMSDLKTHLYAKFGNHIKLEA 69
           G++F+   +  +++ LEE+++N++ +I ++E  + SI+ V++DLK  LYAKFG++I LEA
Sbjct: 72  GDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEA 131

Query: 70  DD 71
           D+
Sbjct: 132 DE 133




Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins.
Bos taurus (taxid: 9913)
>sp|Q9NQP4|PFD4_HUMAN Prefoldin subunit 4 OS=Homo sapiens GN=PFDN4 PE=1 SV=1 Back     alignment and function description
>sp|Q9VRL3|PFD4_DROME Probable prefoldin subunit 4 OS=Drosophila melanogaster GN=CG10635 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query72
321470023138 hypothetical protein DAPPUDRAFT_196440 [ 0.875 0.456 0.507 5e-10
327288180134 PREDICTED: prefoldin subunit 4-like [Ano 0.875 0.470 0.460 2e-09
156552663137 PREDICTED: prefoldin subunit 4-like [Nas 0.875 0.459 0.460 3e-08
225714178129 Prefoldin subunit 4 [Lepeophtheirus salm 0.875 0.488 0.460 3e-08
149734208134 PREDICTED: prefoldin subunit 4-like [Equ 0.861 0.462 0.419 6e-08
387914106134 prefoldin subunit 4-like isoform 2 [Call 0.875 0.470 0.428 7e-08
392883688134 prefoldin subunit 4-like isoform 2 [Call 0.875 0.470 0.428 8e-08
410953532 251 PREDICTED: uncharacterized protein LOC10 0.861 0.247 0.419 9e-08
281351075126 hypothetical protein PANDA_000776 [Ailur 0.861 0.492 0.419 1e-07
359322695133 PREDICTED: prefoldin subunit 4-like [Can 0.861 0.466 0.419 1e-07
>gi|321470023|gb|EFX81001.1| hypothetical protein DAPPUDRAFT_196440 [Daphnia pulex] Back     alignment and taxonomy information
 Score = 68.6 bits (166), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 47/63 (74%)

Query: 10  GEIFVDLIKRNSEKSLEESRQNIKSDIASIEQTMSSIKTVMSDLKTHLYAKFGNHIKLEA 69
           GE+FV     ++++ LEE++  +K DI +IE   ++IKT+MSDLKT LYAKFGN I LEA
Sbjct: 76  GEVFVHFNMEDAKEKLEEAKDKVKKDIEAIEAECTNIKTLMSDLKTQLYAKFGNSINLEA 135

Query: 70  DDD 72
           +++
Sbjct: 136 EEE 138




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|327288180|ref|XP_003228806.1| PREDICTED: prefoldin subunit 4-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|156552663|ref|XP_001599576.1| PREDICTED: prefoldin subunit 4-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|225714178|gb|ACO12935.1| Prefoldin subunit 4 [Lepeophtheirus salmonis] gi|290562876|gb|ADD38832.1| Prefoldin subunit 4 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|149734208|ref|XP_001488806.1| PREDICTED: prefoldin subunit 4-like [Equus caballus] Back     alignment and taxonomy information
>gi|387914106|gb|AFK10662.1| prefoldin subunit 4-like isoform 2 [Callorhinchus milii] Back     alignment and taxonomy information
>gi|392883688|gb|AFM90676.1| prefoldin subunit 4-like isoform 2 [Callorhinchus milii] Back     alignment and taxonomy information
>gi|410953532|ref|XP_003983424.1| PREDICTED: uncharacterized protein LOC101095889 [Felis catus] Back     alignment and taxonomy information
>gi|281351075|gb|EFB26659.1| hypothetical protein PANDA_000776 [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|359322695|ref|XP_003639895.1| PREDICTED: prefoldin subunit 4-like [Canis lupus familiaris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query72
UNIPROTKB|F1NP43137 PFDN4 "Uncharacterized protein 0.861 0.452 0.419 7.4e-11
UNIPROTKB|F1PHE6135 LOC100855575 "Uncharacterized 0.861 0.459 0.419 9.4e-11
UNIPROTKB|A5GHK3134 PFDN4 "Uncharacterized protein 0.861 0.462 0.403 1.5e-10
UNIPROTKB|F1MYY3133 PFDN4 "Prefoldin subunit 4" [B 0.861 0.466 0.403 2e-10
UNIPROTKB|Q2TBR6134 PFDN4 "Prefoldin subunit 4" [B 0.861 0.462 0.403 2e-10
UNIPROTKB|J9P9H1134 PFDN4 "Uncharacterized protein 0.861 0.462 0.419 2e-10
UNIPROTKB|E9PQY2136 PFDN4 "Prefoldin subunit 4" [H 0.861 0.455 0.403 2e-10
UNIPROTKB|Q9NQP4134 PFDN4 "Prefoldin subunit 4" [H 0.861 0.462 0.403 2e-10
ZFIN|ZDB-GENE-100922-122136 pfdn4 "prefoldin subunit 4" [D 0.861 0.455 0.403 1.1e-09
FB|FBgn0035603138 CG10635 [Drosophila melanogast 0.861 0.449 0.370 4.2e-08
UNIPROTKB|F1NP43 PFDN4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 151 (58.2 bits), Expect = 7.4e-11, P = 7.4e-11
 Identities = 26/62 (41%), Positives = 47/62 (75%)

Query:    10 GEIFVDLIKRNSEKSLEESRQNIKSDIASIEQTMSSIKTVMSDLKTHLYAKFGNHIKLEA 69
             G++F+   +  +++ LEE++++++ +I ++E  + SI+ V+SDLK  LYAKFGN+I LEA
Sbjct:    75 GDVFISHSQEETQEMLEEAKKSLQEEIETLESRVESIQRVLSDLKVQLYAKFGNNINLEA 134

Query:    70 DD 71
             +D
Sbjct:   135 ED 136




GO:0006457 "protein folding" evidence=IEA
GO:0016272 "prefoldin complex" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
UNIPROTKB|F1PHE6 LOC100855575 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A5GHK3 PFDN4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MYY3 PFDN4 "Prefoldin subunit 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TBR6 PFDN4 "Prefoldin subunit 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9H1 PFDN4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PQY2 PFDN4 "Prefoldin subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NQP4 PFDN4 "Prefoldin subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-100922-122 pfdn4 "prefoldin subunit 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0035603 CG10635 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 72
KOG1760|consensus131 99.96
PF01920106 Prefoldin_2: Prefoldin subunit; InterPro: IPR00277 99.49
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 99.08
COG1382119 GimC Prefoldin, chaperonin cofactor [Posttranslati 99.02
cd00890129 Prefoldin Prefoldin is a hexameric molecular chape 98.7
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 98.08
PRK09343121 prefoldin subunit beta; Provisional 97.97
PRK14011144 prefoldin subunit alpha; Provisional 97.25
PF02996120 Prefoldin: Prefoldin subunit; InterPro: IPR004127 97.24
PRK03947140 prefoldin subunit alpha; Reviewed 97.14
cd00584129 Prefoldin_alpha Prefoldin alpha subunit; Prefoldin 97.13
TIGR00293126 prefoldin, archaeal alpha subunit/eukaryotic subun 96.89
KOG3478|consensus120 96.85
COG1730145 GIM5 Predicted prefoldin, molecular chaperone impl 94.31
PRK01203130 prefoldin subunit alpha; Provisional 94.14
PF08286118 Spc24: Spc24 subunit of Ndc80; InterPro: IPR013252 93.65
PF06632 342 XRCC4: DNA double-strand break repair and V(D)J re 93.01
KOG4196|consensus135 91.08
KOG4098|consensus140 90.14
COG406475 MtrG Tetrahydromethanopterin S-methyltransferase, 89.59
PF07195239 FliD_C: Flagellar hook-associated protein 2 C-term 89.43
PF0819937 E2: Bacteriophage E2-like protein; InterPro: IPR01 87.92
PF04201162 TPD52: Tumour protein D52 family; InterPro: IPR007 87.83
KOG3501|consensus114 86.99
PF05529192 Bap31: B-cell receptor-associated protein 31-like 86.44
PRK06798440 fliD flagellar capping protein; Validated 86.36
TIGR00293126 prefoldin, archaeal alpha subunit/eukaryotic subun 86.27
PF0894646 Osmo_CC: Osmosensory transporter coiled coil; Inte 85.74
PRK08032462 fliD flagellar capping protein; Reviewed 84.09
PRK09343121 prefoldin subunit beta; Provisional 83.53
PRK07737501 fliD flagellar capping protein; Validated 83.13
KOG4010|consensus 208 83.02
smart0033865 BRLZ basic region leucin zipper. 83.0
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 82.6
cd00632105 Prefoldin_beta Prefoldin beta; Prefoldin is a hexa 82.58
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 81.59
PRK06664661 fliD flagellar hook-associated protein FliD; Valid 81.44
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 80.75
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 80.61
cd00890129 Prefoldin Prefoldin is a hexameric molecular chape 80.3
PF05565162 Sipho_Gp157: Siphovirus Gp157; InterPro: IPR008840 80.24
TIGR02338110 gimC_beta prefoldin, beta subunit, archaeal. Chape 80.04
>KOG1760|consensus Back     alignment and domain information
Probab=99.96  E-value=6.8e-29  Score=158.24  Aligned_cols=68  Identities=32%  Similarity=0.576  Sum_probs=66.4

Q ss_pred             cccccccccceeecchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhCCCccCCCC
Q psy15717          3 RVERNGAGEIFVDLIKRNSEKSLEESRQNIKSDIASIEQTMSSIKTVMSDLKTHLYAKFGNHIKLEAD   70 (72)
Q Consensus         3 ~~v~y~iGe~Fv~l~~e~a~e~LE~~ke~l~~ei~~L~~el~~i~~~m~eLK~~LYakFG~~InLe~~   70 (72)
                      ..|||+||+||+|++.+.++++||+.++.+.++|+.|+++++.|..+|.+||++||||||++||||++
T Consensus        64 ~~Ip~~vGdvF~~~~~~~~~~~LEe~ke~l~k~i~~les~~e~I~~~m~~LK~~LYaKFgdnINLeae  131 (131)
T KOG1760|consen   64 EDIPFKVGDVFIHVKLDKLQDQLEEKKETLEKEIEELESELESISARMDELKKVLYAKFGDNINLEAE  131 (131)
T ss_pred             cccceehhhhheeccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccCccCC
Confidence            47999999999999999999999999999999999999999999999999999999999999999985



>PF01920 Prefoldin_2: Prefoldin subunit; InterPro: IPR002777 Prefoldin (PFD) is a chaperone that interacts exclusively with type II chaperonins, hetero-oligomers lacking an obligate co-chaperonin that are found only in eukaryotes (chaperonin-containing T-complex polypeptide-1 (CCT)) and archaea Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>PRK14011 prefoldin subunit alpha; Provisional Back     alignment and domain information
>PF02996 Prefoldin: Prefoldin subunit; InterPro: IPR004127 This entry comprises of several prefoldin subunits Back     alignment and domain information
>PRK03947 prefoldin subunit alpha; Reviewed Back     alignment and domain information
>cd00584 Prefoldin_alpha Prefoldin alpha subunit; Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly Back     alignment and domain information
>TIGR00293 prefoldin, archaeal alpha subunit/eukaryotic subunit 5 Back     alignment and domain information
>KOG3478|consensus Back     alignment and domain information
>COG1730 GIM5 Predicted prefoldin, molecular chaperone implicated in de novo protein folding [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01203 prefoldin subunit alpha; Provisional Back     alignment and domain information
>PF08286 Spc24: Spc24 subunit of Ndc80; InterPro: IPR013252 Spc24 is a component of the evolutionarily conserved kinetochore-associated Ndc80 complex and is involved in chromosome segregation [] Back     alignment and domain information
>PF06632 XRCC4: DNA double-strand break repair and V(D)J recombination protein XRCC4; InterPro: IPR010585 This entry represents the DNA double-strand break repair and V(D)J recombination protein XRCC4, which is found in certain Metazoans, fungi and plants Back     alignment and domain information
>KOG4196|consensus Back     alignment and domain information
>KOG4098|consensus Back     alignment and domain information
>COG4064 MtrG Tetrahydromethanopterin S-methyltransferase, subunit G [Coenzyme metabolism] Back     alignment and domain information
>PF07195 FliD_C: Flagellar hook-associated protein 2 C-terminus; InterPro: IPR010809 The flagellar hook-associated protein 2 (HAP2 or FliD) forms the distal end of the flagella, and plays a role in mucin specific adhesion of the bacteria [] Back     alignment and domain information
>PF08199 E2: Bacteriophage E2-like protein; InterPro: IPR013184 This is a family of short conserved proteins of 37 amino acids, described in Lactococcus phage c2 and in related phage Back     alignment and domain information
>PF04201 TPD52: Tumour protein D52 family; InterPro: IPR007327 The hD52 gene was originally identified through its elevated expression level in human breast carcinoma Back     alignment and domain information
>KOG3501|consensus Back     alignment and domain information
>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information
>PRK06798 fliD flagellar capping protein; Validated Back     alignment and domain information
>TIGR00293 prefoldin, archaeal alpha subunit/eukaryotic subunit 5 Back     alignment and domain information
>PF08946 Osmo_CC: Osmosensory transporter coiled coil; InterPro: IPR015041 The osmosensory transporter coiled coil is a C-terminal domain found in various bacterial osmoprotective transporters, such as ProP, Proline/betaine transporter, Proline permease 2 and the citrate proton symporters Back     alignment and domain information
>PRK08032 fliD flagellar capping protein; Reviewed Back     alignment and domain information
>PRK09343 prefoldin subunit beta; Provisional Back     alignment and domain information
>PRK07737 fliD flagellar capping protein; Validated Back     alignment and domain information
>KOG4010|consensus Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>cd00632 Prefoldin_beta Prefoldin beta; Prefoldin is a hexameric molecular chaperone complex, composed of two evolutionarily related subunits (alpha and beta), which are found in both eukaryotes and archaea Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PRK06664 fliD flagellar hook-associated protein FliD; Validated Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>cd00890 Prefoldin Prefoldin is a hexameric molecular chaperone complex, found in both eukaryotes and archaea, that binds and stabilizes newly synthesized polypeptides allowing them to fold correctly Back     alignment and domain information
>PF05565 Sipho_Gp157: Siphovirus Gp157; InterPro: IPR008840 This family contains both viral and bacterial proteins which are related to the Gp157 protein of the Streptococcus thermophilus SFi bacteriophage Back     alignment and domain information
>TIGR02338 gimC_beta prefoldin, beta subunit, archaeal Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query72
1fxk_A107 Prefoldin; archaeal protein, chaperone; 2.30A {Met 99.53
2zqm_A117 Prefoldin beta subunit 1; chaperone; HET: CIT; 1.9 99.47
1fxk_C133 Protein (prefoldin); archaeal protein, chaperone; 97.59
2zdi_C151 Prefoldin subunit alpha; chaperone, cytoplasm; 3.0 97.54
3aei_A99 Prefoldin beta subunit 2; double helix, coiled coi 95.49
1ik9_A213 DNA repair protein XRCC4; DNA END joining, double- 93.9
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 93.1
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 92.08
2pnv_A43 Small conductance calcium-activated potassium chan 89.06
1gmj_A84 ATPase inhibitor; coiled-coil structure, P depende 88.28
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 88.13
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 87.98
2l5g_B42 Putative uncharacterized protein NCOR2, G protein 87.86
1g6u_A48 Domain swapped dimer; designed three helix bundle, 87.5
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 86.22
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 84.59
1gmj_A84 ATPase inhibitor; coiled-coil structure, P depende 83.53
1l8d_A112 DNA double-strand break repair RAD50 ATPase; zinc 81.29
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 81.28
1zxa_A67 CGMP-dependent protein kinase 1, alpha isozyme; pa 81.19
2wt7_B90 Transcription factor MAFB; transcription, transcri 80.37
3viq_B85 Mating-type switching protein SWI5; recombination 80.02
>1fxk_A Prefoldin; archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 PDB: 1fxk_B Back     alignment and structure
Probab=99.53  E-value=4.3e-14  Score=85.50  Aligned_cols=60  Identities=12%  Similarity=0.256  Sum_probs=58.4

Q ss_pred             cccccccccceeecchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhC
Q psy15717          3 RVERNGAGEIFVDLIKRNSEKSLEESRQNIKSDIASIEQTMSSIKTVMSDLKTHLYAKFG   62 (72)
Q Consensus         3 ~~v~y~iGe~Fv~l~~e~a~e~LE~~ke~l~~ei~~L~~el~~i~~~m~eLK~~LYakFG   62 (72)
                      .+|++.||.|||+.|.++|.+.|++.++.++.+|+.|+.+++.+..+|.+||..||++||
T Consensus        48 ~~vy~~iG~vfv~~~~~e~~~~L~~~~e~i~~~i~~le~~~~~~~~~l~~lk~~l~~~~~  107 (107)
T 1fxk_A           48 AEVYKSSGNILIRVAKDELTEELQEKLETLQLREKTIERQEERVMKKLQEMQVNIQEAMK  107 (107)
T ss_dssp             CCEEEEETTEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCC
T ss_pred             chHHHHHhHHHHhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            468999999999999999999999999999999999999999999999999999999996



>2zqm_A Prefoldin beta subunit 1; chaperone; HET: CIT; 1.90A {Thermococcus SP} PDB: 2zdi_A Back     alignment and structure
>1fxk_C Protein (prefoldin); archaeal protein, chaperone; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.2.5.1 Back     alignment and structure
>2zdi_C Prefoldin subunit alpha; chaperone, cytoplasm; 3.00A {Pyrococcus horikoshii} Back     alignment and structure
>3aei_A Prefoldin beta subunit 2; double helix, coiled coil, chaperone; 1.70A {Thermococcus SP} Back     alignment and structure
>1ik9_A DNA repair protein XRCC4; DNA END joining, double-strand break repair, V(D)J recombination, protein-protein complex, coiled coil; HET: DNA; 2.30A {Homo sapiens} SCOP: b.59.1.1 h.1.11.1 PDB: 3ii6_A* 1fu1_A* 3rwr_A* Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2pnv_A Small conductance calcium-activated potassium channel protein 2; leucine zipper, SKCA channel, membrane protein; 2.10A {Rattus norvegicus} Back     alignment and structure
>1gmj_A ATPase inhibitor; coiled-coil structure, P dependent oligomerization, ATP hydrolysis; 2.2A {Bos taurus} SCOP: h.4.8.1 PDB: 1ohh_H* 1hf9_A Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>2l5g_B Putative uncharacterized protein NCOR2, G protein pathway suppressor 2; GPS2, SMRT, TBL1, CO-repressor, transcription regulator; NMR {Homo sapiens} Back     alignment and structure
>1g6u_A Domain swapped dimer; designed three helix bundle, de novo protein; 1.48A {Synthetic} SCOP: k.9.1.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1gmj_A ATPase inhibitor; coiled-coil structure, P dependent oligomerization, ATP hydrolysis; 2.2A {Bos taurus} SCOP: h.4.8.1 PDB: 1ohh_H* 1hf9_A Back     alignment and structure
>1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1zxa_A CGMP-dependent protein kinase 1, alpha isozyme; parallel coiled coil dimer, transferase; NMR {Homo sapiens} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>3viq_B Mating-type switching protein SWI5; recombination activator; 2.20A {Schizosaccharomyces pombe} PDB: 3vir_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query72
d1fxka_107 Prefoldin beta subunit {Archaeon Methanobacterium 98.19
d1fxkc_133 Prefoldin alpha subunit {Archaeon Methanobacterium 97.39
d1ivsa166 Valyl-tRNA synthetase (ValRS) C-terminal domain {T 81.1
>d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Prefoldin
family: Prefoldin
domain: Prefoldin beta subunit
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=98.19  E-value=4.4e-06  Score=49.15  Aligned_cols=55  Identities=13%  Similarity=0.288  Sum_probs=51.2

Q ss_pred             cccccccccceeecchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy15717          3 RVERNGAGEIFVDLIKRNSEKSLEESRQNIKSDIASIEQTMSSIKTVMSDLKTHL   57 (72)
Q Consensus         3 ~~v~y~iGe~Fv~l~~e~a~e~LE~~ke~l~~ei~~L~~el~~i~~~m~eLK~~L   57 (72)
                      +++.-.||.+||..+.+++...|....+.++.+|+.|+..+..+..+|.+++..|
T Consensus        48 ~~vyk~vG~vLv~~~~~e~~~~l~~~~e~l~~~i~~l~~q~~~l~~~l~~~~~~l  102 (107)
T d1fxka_          48 AEVYKSSGNILIRVAKDELTEELQEKLETLQLREKTIERQEERVMKKLQEMQVNI  102 (107)
T ss_dssp             CCEEEEETTEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cHHHHHhcchhhcCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3455569999999999999999999999999999999999999999999999876



>d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ivsa1 a.2.7.3 (A:797-862) Valyl-tRNA synthetase (ValRS) C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure