Psyllid ID: psy15736


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70
MEGEDHEEKEYQEEEEEEPEKDKEEVRRRRRRNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEPHADPL
ccccccccHHHHHHHccccccccccEEEEEEEcccccccEEEEEcEEEEccccEEEEEEEEccccccccc
cccccccHHHHHHHHcccccccHHHHHHHHHccccccccEEEEEEEEEcccccEEEEEEEEEcccccccc
megedheekeyqeeeeeepekdKEEVRRRRRRNQKNLPEIEVERswvhsgegyeAQLVCIVHaephadpl
megedheekeyqeeeeeepekdkeevrrrrrrnqknlpeieverswvhsgEGYEAQLVCIVHAEPHADPL
MegedheekeyqeeeeeepekdkeevrrrrrrNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEPHADPL
******************************************ERSWVHSGEGYEAQLVCIVH********
***************************RRRRRNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEP*****
*******************************RNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEPHADPL
*************************VRRR**RNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEP*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGEDHEEKEYQEEEEEEPEKDKEEVRRRRRRNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEPHADPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query70
242018223 500 limbic system-associated membrane protei 0.471 0.066 0.878 5e-09
242021179 454 limbic system-associated membrane protei 0.471 0.072 0.818 2e-08
242005474 369 lachesin precursor, putative [Pediculus 0.4 0.075 0.928 4e-07
328701975 551 PREDICTED: neural cell adhesion molecule 0.442 0.056 0.838 9e-07
328701973 535 PREDICTED: neural cell adhesion molecule 0.442 0.057 0.838 9e-07
195443868 492 GK11479 [Drosophila willistoni] gi|19416 0.428 0.060 0.733 8e-06
195054068 409 GH22352 [Drosophila grimshawi] gi|193895 0.428 0.073 0.7 9e-06
195113691 526 GI21998 [Drosophila mojavensis] gi|19391 0.428 0.057 0.7 1e-05
195399512 476 GJ14353 [Drosophila virilis] gi|19414192 0.428 0.063 0.7 2e-05
170060459169 conserved hypothetical protein [Culex qu 0.614 0.254 0.534 2e-05
>gi|242018223|ref|XP_002429579.1| limbic system-associated membrane protein precursor, putative [Pediculus humanus corporis] gi|212514537|gb|EEB16841.1| limbic system-associated membrane protein precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 65.1 bits (157), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 29/33 (87%), Positives = 31/33 (93%)

Query: 38  PEIEVERSWVHSGEGYEAQLVCIVHAEPHADPL 70
           PEIEVERSWVHSGEG+EAQLVCIVH+EP AD L
Sbjct: 222 PEIEVERSWVHSGEGFEAQLVCIVHSEPPADVL 254




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242021179|ref|XP_002431023.1| limbic system-associated membrane protein precursor, putative [Pediculus humanus corporis] gi|212516252|gb|EEB18285.1| limbic system-associated membrane protein precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|242005474|ref|XP_002423590.1| lachesin precursor, putative [Pediculus humanus corporis] gi|212506738|gb|EEB10852.1| lachesin precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328701975|ref|XP_003241763.1| PREDICTED: neural cell adhesion molecule 1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328701973|ref|XP_001945384.2| PREDICTED: neural cell adhesion molecule 1-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195443868|ref|XP_002069612.1| GK11479 [Drosophila willistoni] gi|194165697|gb|EDW80598.1| GK11479 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195054068|ref|XP_001993948.1| GH22352 [Drosophila grimshawi] gi|193895818|gb|EDV94684.1| GH22352 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195113691|ref|XP_002001401.1| GI21998 [Drosophila mojavensis] gi|193917995|gb|EDW16862.1| GI21998 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195399512|ref|XP_002058363.1| GJ14353 [Drosophila virilis] gi|194141923|gb|EDW58331.1| GJ14353 [Drosophila virilis] Back     alignment and taxonomy information
>gi|170060459|ref|XP_001865812.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167878926|gb|EDS42309.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query70
FB|FBgn0017590 545 klg "klingon" [Drosophila mela 0.428 0.055 0.7 6e-07
FB|FBgn0037107 467 CG7166 [Drosophila melanogaste 0.471 0.070 0.575 4.5e-06
FB|FBgn0017590 klg "klingon" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 124 (48.7 bits), Expect = 6.0e-07, P = 6.0e-07
 Identities = 21/30 (70%), Positives = 28/30 (93%)

Query:    38 PEIEVERSWVHSGEGYEAQLVCIVHAEPHA 67
             P+I+VE+SW+HSGEG+EA+LVCIV A+P A
Sbjct:   288 PDIQVEKSWIHSGEGFEAKLVCIVFADPVA 317




GO:0019897 "extrinsic to plasma membrane" evidence=ISS
GO:0007465 "R7 cell fate commitment" evidence=IGI
GO:0045466 "R7 cell differentiation" evidence=IMP
GO:0007156 "homophilic cell adhesion" evidence=IDA
GO:0007611 "learning or memory" evidence=IMP
GO:0008355 "olfactory learning" evidence=IMP
GO:0048149 "behavioral response to ethanol" evidence=IMP
GO:0007616 "long-term memory" evidence=IMP
GO:0007615 "anesthesia-resistant memory" evidence=IMP
FB|FBgn0037107 CG7166 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 70
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 98.05
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 97.62
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 97.61
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 97.55
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 97.52
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 97.42
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 97.37
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 97.25
KOG3513|consensus 1051 97.21
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 97.13
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 97.12
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 97.02
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 96.94
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 96.59
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 96.54
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 96.5
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 96.26
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 96.02
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 96.0
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 95.85
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 95.83
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 95.81
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 95.79
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 95.73
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 95.67
PHA02785326 IL-beta-binding protein; Provisional 95.65
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 95.5
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 95.35
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 95.06
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 94.99
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 94.83
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 94.73
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 94.68
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 94.55
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 94.36
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 94.06
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 93.82
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 93.26
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 93.18
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 92.95
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 92.88
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 92.68
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 92.41
KOG3513|consensus 1051 92.34
KOG4221|consensus 1381 92.3
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 91.52
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 91.27
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 91.12
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 90.84
PHA02826227 IL-1 receptor-like protein; Provisional 90.57
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 90.42
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 90.2
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 89.67
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 89.11
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 88.01
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 87.62
smart0041086 IG_like Immunoglobulin like. IG domains that canno 87.18
smart0040986 IG Immunoglobulin. 87.18
KOG4194|consensus 873 86.57
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 86.06
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 85.9
cd0577093 IgC_beta2m Class I major histocompatibility comple 85.19
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 85.11
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 83.99
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 83.37
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 82.02
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 81.51
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 81.37
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 80.17
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
Probab=98.05  E-value=3e-06  Score=53.61  Aligned_cols=36  Identities=22%  Similarity=0.332  Sum_probs=30.6

Q ss_pred             eecCCeEEEecc--eEEe--ccCCcEEEEEEEeeeCCCCC
Q psy15736         34 QKNLPEIEVERS--WVHS--GEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        34 V~ypPeI~v~~~--~Vha--~~G~~a~L~CiV~A~P~a~V   69 (70)
                      |+|+|.|+++.+  .|.+  -.|..++|.|.+.|.|.+.+
T Consensus         1 v~~~P~~~~~~~~~~~~~~~~~g~~v~L~C~a~G~P~p~i   40 (109)
T cd05773           1 VRFAPDLQKGPQLRKVASRGDGSSDANLVCQAQGVPRVQF   40 (109)
T ss_pred             CccccccccCCceEEEEEecCCCCEEEEEEECcccCCCEE
Confidence            789999999988  5544  26789999999999999865



Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore. The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p

>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query70
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 98.39
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 98.37
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 98.34
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 98.29
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 98.22
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 98.19
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 98.19
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 98.17
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 98.12
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 98.12
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 98.11
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 98.1
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 98.09
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 98.09
3b43_A 570 Titin; I-SET IG fold, extended poly-IG filament, e 98.06
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 98.02
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 97.97
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 97.96
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 97.96
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 97.96
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 97.95
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 97.93
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 97.93
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 97.91
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 97.91
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 97.89
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 97.87
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 97.84
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 97.84
2nzi_A 305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 97.84
2ec8_A 524 MAST/stem cell growth factor receptor; glycoprotei 97.83
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 97.83
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 97.83
2v9t_A117 Roundabout homolog 1; structural protein-receptor 97.82
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 97.8
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 97.79
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 97.79
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 97.78
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 97.77
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 97.76
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 97.76
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 97.76
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 97.73
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 97.73
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.72
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 97.72
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 97.71
2rik_A 284 Titin; I-SET IG fold, poly-IG linear array, struct 97.71
2yd9_A 304 Receptor-type tyrosine-protein phosphatase S; hydr 97.7
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 97.67
3mjg_X289 Beta-type platelet-derived growth factor receptor; 97.66
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 97.64
1qz1_A 291 Neural cell adhesion molecule 1, 140 kDa isoform; 97.64
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 97.61
3qs7_E 423 FL cytokine receptor; immunoglobulin-like domain, 97.61
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 97.58
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 97.57
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 97.57
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 97.56
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 97.56
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 97.55
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 97.51
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 97.49
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 97.49
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 97.48
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 97.48
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 97.47
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 97.47
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 97.44
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 97.43
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 97.4
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 97.4
1wwb_X103 Protein (brain derived neurotrophic factor recepto 97.38
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 97.35
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 97.35
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 97.34
1z7z_I 450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 97.32
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 97.32
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 97.28
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 97.28
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 97.28
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 97.27
3d9a_H210 Heavy chain of hyhel10 antibody fragment (FAB); ly 97.27
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 97.27
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 97.23
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 97.23
1nqb_A 256 Single-chain antibody fragment; multivalent antibo 97.22
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 97.22
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 97.2
1c1e_H219 Catalytic antibody 1E9 (heavy chain); diels-alder, 97.2
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 97.2
2vol_A207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 97.18
3umt_A256 SCFV heavy chain and light chain; stability engine 97.16
3lcy_A 197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 97.16
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 97.14
3mtr_A 215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 97.13
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 97.13
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 97.12
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 97.12
3eow_R221 Poliovirus receptor; immunoglobulin super family, 97.12
1gsm_A210 Madcam-1, mucosal addressin cell adhesion molecule 97.11
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 97.11
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 97.11
2ghw_B247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 97.11
2wim_A 291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 97.11
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 97.08
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 97.08
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 97.08
1c5d_H215 Monoclonal antibody against the main immunogenic t 97.07
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 97.06
1wio_A 363 CD4, T-cell surface glycoprotein CD4; immunoglobul 97.05
3ejj_X 289 Macrophage colony-stimulating factor 1 receptor; g 97.03
1q9r_B222 S25-2 FAB (IGG1K) heavy chain; antigen-binding fra 97.02
3laf_A 403 Deleted in colorectal cancer; netrin-1 receptor, i 97.02
1qgc_4438 Protein (immunoglobulin); virus-antibody complex, 97.02
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 97.01
2rgs_A218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 97.01
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 97.01
1za6_B 344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 97.0
2ocw_A 585 Polymeric-immunoglobulin receptor; SC, secretory, 97.0
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 97.0
2fbo_J250 V1V2;, variable region-containing chitin-binding p 96.99
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 96.95
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 96.94
3u83_A 331 Poliovirus receptor-related protein 1; nectin-1, h 96.94
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 96.94
2wng_A327 Tyrosine-protein phosphatase non-receptor type sub 96.93
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 96.93
2o26_X 290 MAST/stem cell growth factor receptor; stem cell f 96.92
3bae_H228 WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO 96.91
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 96.91
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 96.88
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 96.87
3s96_B218 3B5H10 FAB light chain; huntingtin, immune system; 96.87
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 96.84
1dee_B223 IGM RF 2A2; FAB-IBP complex 2.7A resolution bindin 96.83
1igt_B444 IGG2A intact antibody - MAB231; intact immunoglobu 96.82
2oz4_A 265 Intercellular adhesion molecule 1; IGSF domain, st 96.82
2yd6_A 212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 96.81
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 96.8
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 96.8
3juy_B256 3B3 single chain variant HIV-1 antibody; envelope 96.78
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 96.77
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 96.77
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 96.76
4dkd_C 292 Macrophage colony-stimulating factor 1 receptor; d 96.75
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 96.74
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 96.73
2wng_A 327 Tyrosine-protein phosphatase non-receptor type sub 96.72
1l6x_A207 Immunoglobulin gamma-1 heavy chain constant regio; 96.72
2iep_A 192 Muscle-specific kinase receptor; beta-sandwich, si 96.69
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 96.69
2v9r_A 212 Roundabout homolog 1; proto-oncogene, differentiat 96.67
2rcj_C523 Light chain; immunoglobulin M, polymeric antibodie 96.66
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 96.65
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 96.65
3qs9_E 527 FL cytokine receptor; immunoglobulin-like domain, 96.64
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 96.63
1op3_H225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 96.62
1ry7_B 334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 96.62
3gkz_A257 Anti-methamphetamine single chain FV; therapeutic 96.61
3nl4_H215 Antigen binding fragment,immunoglobulin IGG - HEA; 96.6
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 96.58
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 96.58
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 96.56
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 96.55
2yd1_A 212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 96.54
1q0x_L212 FAB 9B1, light chain; anti-morphine antibody, FAB 96.53
1f3r_B257 FV antibody fragment; IG-fold, immuno complex, ant 96.52
1he7_A126 High affinity nerve growth factor receptor; transf 96.51
3uzq_A253 Anti-dengue MAB 4E11; dengue antibody neutralizati 96.48
2wqr_A323 IG epsilon chain C region; immune system, immunogl 96.48
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 96.48
2j8h_A 197 Titin, connectin; cardiomyopathy, nuclear protein, 96.47
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 96.46
2ens_A96 Advanced glycosylation END product-specific recept 96.43
2c1o_A 254 IGK-C protein; FAB fragment, enantioselective, fin 96.41
3liz_H253 4C3 monoclonal antibody heavy chain; hydrolase-imm 96.41
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 96.4
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 96.4
1za6_B344 IGG heavy chain; immunoglobulin fold, CH2-domain-d 96.4
2va4_A 192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 96.39
1iam_A185 ICAM-1, CD54, intercellular adhesion molecule-1; r 96.38
2a38_A 194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 96.38
1lk3_L210 9D7 light chain; antigen-antibody complex, immune 96.36
1i1c_A239 IGG2A, IG gamma-2A chain C region; FC, immune syst 96.35
1igy_B434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 96.35
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 96.34
1moe_A240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 96.33
2y23_A 312 Myomesin; structural protein, sarcomere, M-BAND, i 96.31
1igy_B 434 IGG1 intact antibody MAB61.1.3; intact immunoglobu 96.29
2vr9_A 217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 96.28
1mju_H227 Immunoglobulin MS6-12; catalytic antibody, ester h 96.28
2rcj_C 523 Light chain; immunoglobulin M, polymeric antibodie 96.28
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 96.27
1ow0_A214 IG alpha-1 chain C region; IGA1, fcari, CD89, anti 96.26
1bih_A 395 Hemolin; insect immunity, LPS-binding, homophilic 96.25
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 96.25
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 96.24
1hzh_H457 IGG, immunoglobulin heavy chain; antibody, immune 96.24
1qok_A282 MFE-23 recombinant antibody fragment; immunoglobul 96.24
1nfd_E212 H57 FAB; complex (immunoreceptor-immunoglobulin), 96.23
2c1o_A254 IGK-C protein; FAB fragment, enantioselective, fin 96.21
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 96.21
2zg1_A214 Sialic acid-binding IG-like lectin 5; siglec-5 inh 96.2
1svz_A247 Immunoglobulin;, single-chain FV fragment 1696; an 96.2
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 96.11
3oq3_B 329 IFN-alpha/beta binding protein C12R; mousepox viru 96.11
3sob_L237 Antibody light chain; beta propeller, protein bind 96.07
3p3y_A 404 Neurofascin; IG domains, cell adhesion; HET: NAG; 96.07
3bqu_C233 3H6 FAB light chain; beta sheet, immune system; 3. 96.06
3ux9_B256 SCFV antibody; five helices, long loop connecting 96.04
2znx_A242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 96.04
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 96.03
2nzi_A 305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 96.02
2xqy_G261 A13-D6.3 monoclonal antibody, envelope glycoprotei 96.02
2wv3_A 190 Neuroplastin; igcam, membrane, glycoprotein, cell 96.0
2fbj_H220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 95.97
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 95.97
2c5d_C 195 AXL oncogene, tyrosine-protein kinase receptor UFO 95.96
1fnl_A 175 Low affinity immunoglobulin gamma FC region recept 95.94
1gl4_B98 Basement membrane-specific heparan sulfate proteog 95.93
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 95.92
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 95.91
2aty_A376 Complement receptor chimeric conjugate CR2-IG; imm 95.9
4fqp_A 313 Poliovirus receptor; immunoglobulin-like domain, I 95.82
2v5m_A 388 Dscam; neurobiology SPL immunoglobulin domain, cel 95.82
1dn0_B232 IGM-kappa cold agglutinin (heavy chain); FAB, anti 95.77
3qhz_H232 Human monoclonal antibody DEL2D1, FAB heavy chain; 95.75
1qgc_4 438 Protein (immunoglobulin); virus-antibody complex, 95.72
1hzh_H 457 IGG, immunoglobulin heavy chain; antibody, immune 95.71
3omz_A259 Human vdelta1 gamma delta T cell receptor delta1A; 95.71
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 95.71
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 95.7
4acp_A240 IG gamma-1 chain C region; immune system, antibody 95.7
1waa_A93 Titin; metal binding protein, calmodulin-binding, 95.67
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 95.66
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 95.6
4dzb_B246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 95.58
2gki_A291 Nuclease; anti-DNA antibody, catalytic antibody, i 95.58
1f97_A 212 Junction adhesion molecule; immunoglobulin superfa 95.57
1rhf_A 182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 95.56
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 95.56
2w59_A231 IGY FCU3-4; immunoglobulin, avian, immune system; 95.55
1mq8_A291 ICAM-1, intercellular adhesion molecule-1, CD54 an 95.51
3bkj_L252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 95.49
4fmk_A 225 Poliovirus receptor-related protein 2; immunoglobu 95.48
1iga_A475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 95.47
1igt_B 444 IGG2A intact antibody - MAB231; intact immunoglobu 95.44
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 95.44
3kld_A 384 Contactin 4, axcam, BIG-2; cell adhesion, protein 95.43
3auv_A 276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 95.43
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 95.43
3o4o_C 339 Interleukin-1 receptor type 2; cytokine-receptor c 95.42
1cs6_A 382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 95.42
2j6e_L234 IGM, FAB light chain; autoimmune complex human IGM 95.42
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 95.42
4dep_C 349 Interleukin-1 receptor accessory protein; B-trefoi 95.39
1bec_A238 14.3.D T cell antigen receptor; T cell receptor; 1 95.39
1f2q_A 176 High affinity immunoglobulin epsilon receptor ALP 95.38
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 95.37
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 95.34
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 95.29
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 95.27
3nl4_L 213 Antigen binding fragment, immunoglobulin IGG - LI; 95.19
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 95.18
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 95.18
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 95.18
3rjd_A 262 High affinity immunoglobulin gamma FC receptor I; 95.16
3r06_A 213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 95.15
3o3u_N581 Maltose-binding periplasmic protein, advanced Gly 95.13
1jhl_L108 IGG1-kappa D11.15 FV (light chain); complex(antibo 95.1
4f80_A 226 Butyrophilin subfamily 3 member A1; B7 superfamily 95.09
2v5t_A 189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 95.08
3nfj_J245 T cell receptor beta chain; immunoglobulin family, 95.04
3bn9_D257 E2 FAB heavy chain; antibody-protease complex, pro 95.02
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 95.02
1epf_A 191 NCAM, protein (neural cell adhesion molecule); imm 94.97
3esu_F250 Antibody 14B7* light chain and antibody 14B7* heav 94.94
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 94.92
3ry4_A 170 Low affinity immunoglobulin gamma FC region recep; 94.89
1iga_A 475 IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg 94.88
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 94.88
3bn3_B196 ICAM-5, intercellular adhesion molecule 5, telence 94.84
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 94.82
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 94.82
1ccz_A171 Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.8 94.8
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 94.79
2q20_A109 VK1 O18/O8 germline light chain variable domain; A 94.76
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 94.68
3m8o_H221 Immunoglobulin A1 heavy chain; immunoglobulin fold 94.68
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 94.67
3sgj_C 204 Human FCG3A receptor; receptor complex, FC recepto 94.64
3ojm_B 231 Fibroblast growth factor receptor 2; beta trefoil 94.62
1itb_B 315 Type 1 interleukin-1 receptor; immunoglobulin fold 94.6
3vh8_G 316 Killer cell immunoglobulin-like receptor 3DL1; imm 94.53
2gi7_A 184 GPVI protein; IG-like domains, blood clotting, cel 94.48
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 94.41
4ei6_B245 Vbeta16 XV19 type II natural killer T cell recept 94.4
3k0w_A 218 Mucosa-associated lymphoid tissue lymphoma translo 94.35
1nbq_A 209 JAM, junctional adhesion molecule 1, PAM-1; reovir 94.3
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 94.26
3mj8_L 213 Stimulatory hamster antibody HL4E10 FAB light CHA; 94.26
2gjj_A264 A21 single-chain antibody fragment against ERBB2; 94.24
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 94.24
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 94.17
3q5y_A240 TCR N15 beta; IG, T cell receptor, antigen peptide 94.16
3mjg_X 289 Beta-type platelet-derived growth factor receptor; 94.09
3u2s_H248 PG9 heavy chain; greek KEY, immunoglobulin, immune 94.06
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 94.05
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 94.05
3s96_B 218 3B5H10 FAB light chain; huntingtin, immune system; 94.05
3n9g_H230 FAB fragment of MAB CR4354, heavy chain; human neu 94.03
3fku_X 280 Neutralizing antibody F10; influenza, hemagglutini 94.02
1qfw_M108 FV, antibody (anti beta subunit) (light chain); gl 93.94
1vca_A 202 VCAM-D1,2, human vascular cell adhesion molecule-1 93.93
4fom_A 308 Poliovirus receptor-related protein 3; immunoglobu 93.87
3mlr_H226 Human monoclonal anti-HIV-1 GP120 V3 antibody 255 93.84
3d9a_L 213 Light chain of hyhel10 antibody fragment (FAB); ly 93.81
2e27_L119 Anti-ciguatoxin antibody, light chain; immunoglobu 93.81
3omz_A 259 Human vdelta1 gamma delta T cell receptor delta1A; 93.8
1lk2_B99 Beta-2-microglobulin; class I MHC-peptide complex, 93.76
2y25_A 317 Myomesin; structural protein, sarcomere, M-BAND, i 93.71
3qib_D270 2B4 beta chain; IG domain, immune system; HET: NAG 93.69
1x9q_A268 SCFV, 4M5.3 anti-fluorescein single chain antibody 93.66
1i8k_A107 Epidermal growth factor receptor antibody MR1SCFV 93.65
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 93.64
1mq8_A 291 ICAM-1, intercellular adhesion molecule-1, CD54 an 93.64
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 93.63
1k5n_B100 Beta-2-microglobulin, light chain; MHC(major histo 93.56
3tv3_H239 PGT128 heavy chain, IG gamma-1 chain C region; FAB 93.54
1oga_E252 TRBC1, T-cell receptor beta chain C region; immune 93.52
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 93.5
3s35_X122 Vascular endothelial growth factor receptor 2; ant 93.49
1ugn_A 198 LIR1, leukocyte immunoglobulin-like receptor 1; im 93.45
3esu_F 250 Antibody 14B7* light chain and antibody 14B7* heav 93.44
2d3v_A 196 Leukocyte immunoglobulin-like receptor subfamily A 93.41
3sob_L 237 Antibody light chain; beta propeller, protein bind 93.27
1mqk_L120 Antibody 7E2 FV fragment, light chain; membrane pr 93.26
2vsd_A105 CHIR AB1; immune system receptor, FC receptor; HET 93.21
3p2t_A 196 Leukocyte immunoglobulin-like receptor subfamily 4 93.2
2znx_A 242 SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, s 93.2
2ywz_A111 NEW antigen receptor variable domain; IG VNAR, imm 93.08
1i3g_L111 Antibody FV fragment; antibiotic; 2.44A {Mus muscu 93.04
2wbj_D279 OB TCR; transmembrane, immune response, T cell rec 93.03
4dzb_B 246 Vbeta2 (MAIT T cell receptor); immune system; 1.70 92.99
3nfj_J 245 T cell receptor beta chain; immunoglobulin family, 92.97
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 92.92
1zvo_C512 Myeloma immunoglobulin D delta; immunoglobulin fol 92.92
3f8u_B401 Tapasin; endoplasmic reticulum, glycoprotein, immu 92.67
1eaj_A126 Coxsackie virus and adenovirus receptor; virus/vir 92.44
1hxm_B242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 92.33
1bii_B119 Beta-2 microglobulin, MHC class I H-2DD; complex ( 92.3
3auv_A 276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 92.27
4ffy_L126 DENV1-E111 single chain variable fragment (light; 92.26
4frw_A 218 Poliovirus receptor-related protein 4; immunoglobu 92.16
3mj6_A 268 Junctional adhesion molecule-like; immunoglobulin 92.09
4gos_A125 V-SET domain-containing T-cell activation inhibit; 92.05
2rgs_A 218 I, IG gamma-2B heavy chain; FC-fragment, immunoglo 92.04
2ghw_B 247 Anti-SARS SCFV antibody, 80R; S protein, neutraliz 91.98
1oll_A 188 NK receptor; immune system/receptor, NK cell trigg 91.95
3to4_D253 NKT vbeta2 (mouse variable domain, human constant; 91.9
3sob_H256 Antibody heavy chain, low-density lipoprotein rece 91.87
2yz1_A120 Tyrosine-protein phosphatase non-receptor type sub 91.81
1ntl_A551 CRRY-IG; immunology, complement, glycoprotein, SCR 91.76
3tf7_C 256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 91.75
3bp6_B 202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 91.71
3bqu_C 233 3H6 FAB light chain; beta sheet, immune system; 3. 91.68
3grw_A 241 Fibroblast growth factor receptor 3; FGFR3, protei 91.61
1l6x_A 207 Immunoglobulin gamma-1 heavy chain constant regio; 91.59
2fbo_J 250 V1V2;, variable region-containing chitin-binding p 91.52
1lk3_L 210 9D7 light chain; antigen-antibody complex, immune 91.48
3p73_B99 Beta-2-microglobulin; IG-like C1-type (immunoglobu 91.39
2wqr_A 323 IG epsilon chain C region; immune system, immunogl 91.38
2v44_A 189 NCAM2, neural cell adhesion molecule 2; phosphoryl 91.35
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 91.24
1sq2_N113 Novel antigen receptor; immunoglobulin fold, prote 91.22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 91.04
1uct_A 218 Immunoglobulin alpha FC receptor; beta stands, imm 90.99
1p6f_A 242 NKP46, natural cytotoxicity triggering receptor 1; 90.97
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 90.86
1moe_A 240 Anti-CEA MAB T84.66; anti carcinoembryonic antigen 90.85
3sbw_C 222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 90.82
3bkj_L 252 WO2 IGG2A FAB fragment light chain kappa; abeta, F 90.79
1pko_A139 Myelin oligodendrocyte glycoprotein; IGV-domain, i 90.73
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 90.62
3iu4_H 263 CHP3 FAB heavy chain; antibody, ganglioside, idiot 90.55
2ny1_B 184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 90.52
3juy_B 256 3B3 single chain variant HIV-1 antibody; envelope 90.47
1j05_L111 T84.66 antibody, anti-CEA MAB T84.66, light chain; 90.41
2wbj_D 279 OB TCR; transmembrane, immune response, T cell rec 90.33
1b6u_A 257 KIR2DL3, P58 killer cell inhibitory receptor; natu 90.25
1eeq_A114 Kappa-4 immunoglobulin (light chain); protein stab 90.08
2coq_A108 NEW antigen receptor variable domain; IG VNAR, nat 90.05
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 89.96
2yc1_B146 Single chain antibody fragment 9004G; immune syste 89.92
1h5b_A113 Murine T cell receptor (TCR) valpha domain; immune 89.76
1nkr_A 201 P58-CL42 KIR; inhibitory receptor, natural killer 89.71
1svz_A 247 Immunoglobulin;, single-chain FV fragment 1696; an 89.64
3pv7_A 248 B7-H6, IG-like domain-containing protein DKFZP686O 89.63
1nez_G128 T-cell surface glycoprotein CD8 alpha chain; immun 89.6
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 89.59
3o81_A119 Beta-2-microglobulin; IG-like C1-type (immunoglobu 89.47
1ypz_F230 T-cell receptor gamma chain, beta-2-microglobulin; 89.47
2p1y_A 238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 89.44
2jju_A127 Signal regulatory protein beta-1; immunoglobulin d 89.4
2gjj_A 264 A21 single-chain antibody fragment against ERBB2; 89.28
1i1c_A 239 IGG2A, IG gamma-2A chain C region; FC, immune syst 89.04
3jts_B119 Beta-2-microglobulin; alpha helix, beta sheet, bet 88.99
3jz7_A 214 MCAR, CAR, coxsackievirus and adenovirus receptor 88.94
1hxm_B 242 Gamma-delta T-cell receptor; IG domain, TCR, GDTCR 88.85
2x1w_L 213 Vascular endothelial growth factor receptor 2; hor 88.78
3udw_C118 Poliovirus receptor; PVR tigit IGSF signal transdu 88.73
1x9q_A 268 SCFV, 4M5.3 anti-fluorescein single chain antibody 88.55
3moq_A126 NEW antigen receptor variable domain, P3(40) PEPT 88.52
3r4d_A 208 CEA-related cell adhesion molecule 1, isoform 1/2; 88.48
3tv3_L 211 PGT128 light chain, IG lambda-2 chain C regions; F 88.33
1zxq_A192 ICAM-2, intercellular adhesion molecule-2; immunog 88.25
1xt5_A135 Variable region-containing chitin-binding protein 88.22
1q0x_L 212 FAB 9B1, light chain; anti-morphine antibody, FAB 88.14
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 88.06
4ei6_B 245 Vbeta16 XV19 type II natural killer T cell recept 88.05
1dlf_L113 Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 87.88
2d9c_A136 Signal-regulatory protein beta-1; beta-sandwich, S 87.86
4hwn_A108 FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG 87.77
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 87.53
3q5y_A 240 TCR N15 beta; IG, T cell receptor, antigen peptide 87.38
3umt_A 256 SCFV heavy chain and light chain; stability engine 87.31
1f3r_B 257 FV antibody fragment; IG-fold, immuno complex, ant 87.1
4gjt_B123 Poliovirus receptor-related protein 4; six-bladed 87.03
4fa8_A 203 Secreted protein BARF1; immunoglobulin-like domain 86.97
1p6f_A 242 NKP46, natural cytotoxicity triggering receptor 1; 86.91
1gsm_A 210 Madcam-1, mucosal addressin cell adhesion molecule 86.8
3gbl_A97 BETA2-microglobulin; immune response, immunoglobul 86.78
2z35_A112 T-cell receptor alpha-chain; immune receptor, immu 86.76
2vol_A 207 Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, 86.72
1nfd_E 212 H57 FAB; complex (immunoreceptor-immunoglobulin), 86.71
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 86.67
3c5j_B190 MHC class II antigen; HLA, MHC class II, glycoprot 86.6
3u1s_H267 FAB PGT145 heavy chain; IGG, broadly neutralizing 86.45
2w59_A 231 IGY FCU3-4; immunoglobulin, avian, immune system; 86.42
1u3h_A110 T-cell receptor alpha-chain; complex, immune syste 86.25
1uvq_B198 HLA class II histocompatibility antigen; immunolog 86.14
1fo0_B112 Protein (BM3.3 T cell receptor beta-chain); class 86.12
1zvo_C 512 Myeloma immunoglobulin D delta; immunoglobulin fol 85.76
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 85.54
2bnu_A203 TCR alpha chain, T-cell receptor alpha chain C reg 85.51
3ux9_B 256 SCFV antibody; five helices, long loop connecting 85.39
1oaq_L120 Light chain; antibody, allergy, IGE, conformationa 85.35
3gkz_A 257 Anti-methamphetamine single chain FV; therapeutic 85.35
3b5h_A 184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 84.99
3c5j_A181 HLA class II histocompatibility antigen, DR alpha; 84.57
3s97_C 201 Contactin-1; carbonic anhdyrase like immunoglobuli 84.44
3s6c_A 392 Beta-2-microglobulin, T-cell surface glycoprotein 84.41
2bc4_B211 HLA class II histocompatibility antigen, DM beta c 84.38
2fbj_H 220 IGA-kappa J539 FAB (heavy chain); immunoglobulin; 84.21
3r0n_A128 Poliovirus receptor-related protein 2; IG-domain, 84.19
3to4_D 253 NKT vbeta2 (mouse variable domain, human constant; 84.19
1op3_H 225 FAB 2G12, heavy chain; domain-swapped FAB 2G12, an 84.0
3khq_A133 B-cell antigen receptor complex-associated protei 83.88
1tvd_A116 T cell receptor, ES204 V delta; immunoreceptor, TC 83.44
3qib_D 270 2B4 beta chain; IG domain, immune system; HET: NAG 83.44
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 83.4
3t0v_A123 Immunoglobulin variable lambda domain; immunoglobu 83.35
1k5n_A276 Major histocompatibility complex molecule HLA-B*2; 83.28
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 83.25
1ow0_A 214 IG alpha-1 chain C region; IGA1, fcari, CD89, anti 83.21
1n4x_H120 Immunoglobulin heavy chain variable region; immune 83.17
1a2y_B116 IGG1-kappa D1.3 FV (heavy chain); complex (immunog 83.04
1p4b_L135 Antibody variable light chain; FV antibody, antige 83.01
1lp9_E194 T-cell receptor alpha chain; immunoregulatory comp 82.9
2oyp_A109 Hepatitis A virus cellular receptor 2; TIM-3, T-ce 82.8
3kgr_A106 LAIR-1, hlair1, leukocyte-associated immunoglobuli 82.79
1ncn_A110 T lymphocyte activation antigen CD86; IG V, beta s 82.49
1fo0_A116 Protein (BM3.3 T cell receptor alpha-chain); class 82.49
3u6r_L 143 Antibody 1:7 (light chain); IG-like domain, neutra 82.47
1c1e_H 219 Catalytic antibody 1E9 (heavy chain); diels-alder, 82.33
1nqb_A 256 Single-chain antibody fragment; multivalent antibo 82.32
3r08_E82 T-cell surface glycoprotein CD3 epsilon chain; ant 82.29
3q0h_A117 T cell immunoreceptor with IG and ITIM domains; im 82.17
2i24_N121 NEW antigen receptor PBLA8; immunoglobulin fold, i 81.98
1mju_H 227 Immunoglobulin MS6-12; catalytic antibody, ester h 81.81
3b9v_A120 Heavy chain variable domain; antibody engineering, 81.78
2atp_B115 T-cell surface glycoprotein CD8 beta chain; CD8AB, 81.77
1uvq_A197 HLA class II histocompatibility antigen; immunolog 81.58
3uzq_A 253 Anti-dengue MAB 4E11; dengue antibody neutralizati 81.46
3s35_X122 Vascular endothelial growth factor receptor 2; ant 81.39
1onq_A283 T-cell surface glycoprotein CD1A; protein-glycolip 81.34
1pew_A109 JTO2, A lambda-6 type immunoglobulin light chain, 81.24
3pl6_D 268 MBP peptide / T-cell receptor beta chain chimera; 81.22
3r8b_B125 G5-8, enterotoxin type B; immunoglobulin-like, OB- 81.17
2ak4_D211 SB27 T cell receptor alpha chain; bulged epitopes, 80.83
2xt1_B121 Camelid VHH 9; viral protein-immune system complex 80.76
2yc1_A117 Single chain antibody fragment 9004G; immune syste 80.67
1j05_H121 T84.66 antibody, anti-CEA MAB T84.66, heavy chain; 80.52
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 80.43
3tpk_A136 Immunoglobulin heavy chain antibody variable DOMA; 80.27
2pet_A 231 Lutheran blood group glycoprotein; immunoglobulin 80.07
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
Probab=98.39  E-value=2.3e-07  Score=61.43  Aligned_cols=54  Identities=15%  Similarity=0.113  Sum_probs=49.8

Q ss_pred             hcCcCCCccceeeeEEEEeecCCeEEEecceEEeccCCcEEEEEEEeeeCCCCC
Q psy15736         16 EEEPEKDKEEVRRRRRRNQKNLPEIEVERSWVHSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        16 ~~~~~~~~~pvs~~I~L~V~ypPeI~v~~~~Vha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      .|.+.+....++..+.|.|..||.+....+.+...+|..++|.|.+.|.|.|.|
T Consensus        85 ~C~a~n~~g~~~~~~~l~V~~p~~~~~~~~~~~v~~g~~~~l~C~~~G~P~P~v  138 (203)
T 4fa8_A           85 LCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHV  138 (203)
T ss_dssp             EEEEEETTEEEEEEEEEEEEEEEEEEEEEEECCSSCSCCEEEEEEEEEESCCEE
T ss_pred             EEEEEcCCCcEEEEEEEEecCCceeeecceeEEEcCCCEEEEEEEcCCCCCCEE
Confidence            488888888899999999999999999988888899999999999999999975



>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>3d9a_H Heavy chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_H 1gpo_H 3ks0_H* 1dqd_H 1ndm_B 1nak_H 1dqq_B 1dqm_H 1dqj_B 1nby_B 1nbz_B 1xgu_B 1ndg_B 1xgt_B 1xgp_B 1xgq_B 1xgr_B 1s5i_H 1f8t_H 1f90_H ... Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>1c5d_H Monoclonal antibody against the main immunogenic the human muscle acetylcholine receptor...; immunoglobulin, immune system; 2.40A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 2arj_H 3b9k_H* 2gk0_H 2gjz_H 1fn4_B 3mj8_H 3mj9_H* Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>1q9r_B S25-2 FAB (IGG1K) heavy chain; antigen-binding fragment, anti-carbohydrate, anti-LPS, antibody, immunoglobulin, KDO, complex, immune system; HET: KDA KDO; 1.45A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q9l_B 1q9k_B* 1q9q_B* 1q9v_B* 2r1w_B* 2r1x_B* 2r1y_B* 2r2b_B* 2r2e_B* 2r2h_B* 3bpc_B* 3sy0_B* 3t4y_B* 3t65_B* 2r23_B* 1q9t_B* 3t77_B* 3okl_B* 3okk_B* 3okm_B ... Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>3bae_H WO2 IGG2A FAB fragment heavy chain; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} SCOP: b.1.1.2 PDB: 3bkc_H 3bkj_H 3bkm_H 3mck_H 2r0w_H* 2iqa_H 2iq9_H 1ggi_H 1ggb_H 1ggc_H 3eys_H* 2ipt_H 2ipu_H 3eyu_H* 2r0z_H* 3rkd_H 1r0a_H* 1n5y_H* 1n6q_H* 1t03_H* ... Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>1dee_B IGM RF 2A2; FAB-IBP complex 2.7A resolution binding outside the antigen combining site superantigen FAB VH3 specificity; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1hez_B 1adq_H Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>2wng_A Tyrosine-protein phosphatase non-receptor type substrate 1; signal regulatory protein alpha, immunoglobulin superfamily, phosphoprotein; HET: NAG; 2.49A {Homo sapiens} Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>3liz_H 4C3 monoclonal antibody heavy chain; hydrolase-immune system complex; HET: NAG BMA MAN; 1.80A {Mus musculus} PDB: 3rvv_D* 3rvu_D 3rvt_D* 3rvw_D* 3rvx_D 1lo4_H 1ub6_H 3r06_B 3r08_H Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1za6_B IGG heavy chain; immunoglobulin fold, CH2-domain-deletion, immune system; 2.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 Back     alignment and structure
>1iam_A ICAM-1, CD54, intercellular adhesion molecule-1; rhinovirus receptor, cell adhesion, integrin ligand, glycopr LFA-1 ligand, immunoglobulin fold; HET: NAG; 2.10A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ic1_A* 1d3l_A 1d3e_I 1d3i_I 3tcx_A Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>1igy_B IGG1 intact antibody MAB61.1.3; intact immunoglobulin, V region, C region, hinge region, immunoglobulin; HET: NAG FUL NDG BMA MAN GAL FUC; 3.20A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>2rcj_C Light chain; immunoglobulin M, polymeric antibodies, immunology, X-RAY solution scattering, constrained modelling, immune system; NMR {Homo sapiens} Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>1qok_A MFE-23 recombinant antibody fragment; immunoglobulin, single-chain FV, anti-carcinoembryonic antigen; 2.4A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2c1o_A IGK-C protein; FAB fragment, enantioselective, finrozole, immune system, antibody, ENA11His antibody, immunoglobulin domain; 2.75A {Mus musculus} Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>2zg1_A Sialic acid-binding IG-like lectin 5; siglec-5 inhibitory receptor, two-domain structure, V-SET, C2-SET, IG-like domain, 6'-sialyllactose complex; HET: SIA; 2.70A {Homo sapiens} PDB: 2zg3_A* 2zg2_A Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2xqy_G A13-D6.3 monoclonal antibody, envelope glycoprotein H; immune system-viral protein complex, envelope protein; HET: NAG; 2.05A {Mus musculus} Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>1dn0_B IGM-kappa cold agglutinin (heavy chain); FAB, antibody, human, immune system; 2.28A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1qlr_B* 2j6e_H* 2agj_H* 2h32_H Back     alignment and structure
>3qhz_H Human monoclonal antibody DEL2D1, FAB heavy chain; immunoglobulin, immune recognition, influenza A hemagglutini system; 1.55A {Homo sapiens} PDB: 3lzf_H* 3qrg_H* 3mod_H 3mob_H 3moa_H 3lev_H* 3idg_B 3d0l_B 3d0v_B 3idi_B 3idj_B 3idm_B* 3idn_B* 1tjg_H* 1tjh_H* 1tji_H* 2pr4_H 3drq_B 2p8m_B 2p8p_B ... Back     alignment and structure
>1qgc_4 Protein (immunoglobulin); virus-antibody complex, icosahedral virus, virus-immune SYST complex; 30.00A {Mus musculus} SCOP: i.6.1.1 Back     alignment and structure
>1hzh_H IGG, immunoglobulin heavy chain; antibody, immune system; HET: NAG BMA MAN GAL FUC; 2.70A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 PDB: 2ig2_H 1mco_H* Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4acp_A IG gamma-1 chain C region; immune system, antibody, kifunensine; HET: NAG; 2.49A {Homo sapiens} PDB: 2j6e_A* Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>2gki_A Nuclease; anti-DNA antibody, catalytic antibody, immune system; 2.88A {Mus musculus} Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>1igt_B IGG2A intact antibody - MAB231; intact immunoglobulin V region C region, immunoglobulin; HET: NAG FUL BMA MAN GAL FUC; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 b.1.1.2 b.1.1.2 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2j6e_L IGM, FAB light chain; autoimmune complex human IGM rheumatoid factor IGG1-FC, immunoglobulin C region, membrane, glycoprotein, transmembrane; HET: NAG FUL BMA MAN NDG GAL; 3.0A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>1bec_A 14.3.D T cell antigen receptor; T cell receptor; 1.70A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1jck_A 1l0x_A 1sbb_A 1l0y_A 3c6l_B 1mwa_B* 1g6r_B* 1tcr_B* 2ckb_B 2q86_B* 1lp9_F 2j8u_F 2jcc_F 2uwe_F 3mbe_D* 1d9k_B* 2aq3_A 3mc0_A 3byt_A 3bzd_A ... Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>1jhl_L IGG1-kappa D11.15 FV (light chain); complex(antibody-antigen); 2.40A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>3bn9_D E2 FAB heavy chain; antibody-protease complex, protein-protein complex, enzyme- inhibitor complex, disease mutation, glycoprotein, hydrolase; 2.17A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kr3_H 2xtj_E Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>1iga_A IGA1; immunoglobulin; NMR {Homo sapiens} PDB: 2esg_A 2qtj_A 3chn_A 1r70_B 3cm9_A Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>3bn3_B ICAM-5, intercellular adhesion molecule 5, telencephalin; I domain, integrin, allosteric mobility, cell adhesi immune system; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1ccz_A Protein (CD58); LFA-3, glycoprotein; HET: NAG; 1.80A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1ci5_A 1qa9_B Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>2q20_A VK1 O18/O8 germline light chain variable domain; Al, light chain amyloidosis, amyloid, immunoglobulin, protein fibril; 1.30A {Homo sapiens} PDB: 2kqm_A 3cdf_A 3cdc_A 2kqn_A 3cdy_A 2q1e_A 3dvi_A 1igm_L 1bww_A 1b0w_A 1bre_A 1qp1_A 3dvf_A 1rei_A 1wtl_A 1ar2_A 1fgv_L 2bx5_A 2uzi_L* 1bvk_A ... Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3m8o_H Immunoglobulin A1 heavy chain; immunoglobulin fold, immune system; 1.55A {Homo sapiens} PDB: 3qnx_B 3qny_B Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3u2s_H PG9 heavy chain; greek KEY, immunoglobulin, immune recognition, immune system; HET: PCA TYS BU3 NAG BMA MAN; 1.80A {Homo sapiens} PDB: 3u4e_H* 3u36_H 3mug_B* 3lrs_H* 3mme_H* 2qsc_H* Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>3s96_B 3B5H10 FAB light chain; huntingtin, immune system; 1.90A {Mus musculus} PDB: 2qhr_L 3ffd_B 4dcq_A Back     alignment and structure
>3n9g_H FAB fragment of MAB CR4354, heavy chain; human neutralizing antibody, immun anti-WEST NIle virus; 1.43A {Homo sapiens} PDB: 3iyw_H 3qeh_A 3sqo_H 4hk0_A 4hk3_J 4hkx_A* 3u0t_D 3c08_H 3lmj_H 3lqa_H* 3c09_H* 4dn3_H 3pp4_H 3pp3_H 4hkb_J 2jb5_H* 2jb6_B* 2eh7_H 2eh8_H 3jwd_H* ... Back     alignment and structure
>3fku_X Neutralizing antibody F10; influenza, hemagglutinin, SCFV, F membrane, envelope protein, fusion protein, membrane, trans virion; HET: NAG BMA; 3.20A {Homo sapiens} Back     alignment and structure
>1qfw_M FV, antibody (anti beta subunit) (light chain); glycoprotein hormone; HET: NAG; 3.50A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>3mlr_H Human monoclonal anti-HIV-1 GP120 V3 antibody 255 heavy chain; human monoclonal antibody, FAB, third variable antibody-antigen interaction; 1.80A {Homo sapiens} PDB: 3mls_H 3mlt_H 3mlu_H 3mlv_H Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>2e27_L Anti-ciguatoxin antibody, light chain; immunoglobulin fold, immune system; HET: AB0; 1.70A {Mus musculus} PDB: 3iy1_A Back     alignment and structure
>3omz_A Human vdelta1 gamma delta T cell receptor delta1A; immunoglobulin fold, immune surveillance of cell stress PROT A/B, MIC-A/B binding, epithelium; 3.04A {Homo sapiens} Back     alignment and structure
>1lk2_B Beta-2-microglobulin; class I MHC-peptide complex, high resolution, anisotropic AN refinement, immune system; HET: NAG FUC; 1.35A {Mus musculus} SCOP: b.1.1.2 PDB: 1bqh_B 1cd1_B 1fo0_L* 1fzj_B* 1fzm_B* 1fzo_B* 1g6r_L 1fzk_B* 1g7q_B* 1hoc_B 1inq_B 1juf_B 1k8d_B 1kbg_L* 1kj2_L* 1kj3_L 1kpu_B* 1kpv_B* 1ld9_B 1ldp_L* ... Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>1i8k_A Epidermal growth factor receptor antibody MR1SCFV light chain; antibody-peptide complex, immunoglobulin fold, type II' beta turn., immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 PDB: 1i8i_A Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>1mq8_A ICAM-1, intercellular adhesion molecule-1, CD54 antigen; IG superfamily, rossmann fold, metal mediated protein interf immune system; HET: NAG; 3.30A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>1k5n_B Beta-2-microglobulin, light chain; MHC(major histocompatibility complex), HLA(human leukocyte A immune system; 1.09A {Homo sapiens} SCOP: b.1.1.2 PDB: 1a9b_B 1b0g_B 1b0r_B 1bd2_B 1cg9_B 1a9e_B 1duy_B 1eey_B 1eez_B 1efx_B 1gzp_B* 1gzq_B* 1hhg_B 1hhh_B 1hhi_B 1hhj_B 1hhk_B 1i1f_B 1i1y_B 1duz_B* ... Back     alignment and structure
>3tv3_H PGT128 heavy chain, IG gamma-1 chain C region; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_H* 3twc_H* 3tje_H* 3thm_H* 4fqq_H 2xzc_H* 2xza_H* 3b2u_H* 3b2v_H* 3mly_H 3mlz_H 4fq2_H 2ykl_H* 3tnm_H 4fqc_H* 4fq1_H* 2yk1_H* 3mlx_H 2jix_D 2vxq_H ... Back     alignment and structure
>1oga_E TRBC1, T-cell receptor beta chain C region; immune system/receptor, immune system/receptor/complex, TCR, MHC, immunodominance, FLU, complex; 1.40A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 2vlm_E 2vlk_E 2vlj_E 2vlr_E 2xna_B 2xn9_B 2axh_A 2axj_A 3scm_D* 3sda_D* 3sdc_D* 3sdd_D* 3qi9_D* 3mff_B* 2ak4_E 3he7_D* 2eyr_B 3pqy_E 3kxf_E 2cde_B ... Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3esu_F Antibody 14B7* light chain and antibody 14B7* heavy chain linked with A synthetic...; single-chain FV, monoclonal antibody, immunoglobulin; 1.30A {Mus musculus} PDB: 3et9_F 3esv_F 3etb_F 1h8n_A 1h8s_A* 1h8o_A* Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>3sob_L Antibody light chain; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_A 3u1s_L* Back     alignment and structure
>1mqk_L Antibody 7E2 FV fragment, light chain; membrane protein, cytochrome C oxidase, high- resolution structure, immune system; 1.28A {Mus musculus} SCOP: b.1.1.1 PDB: 1ar1_D 3ehb_D* 3hb3_D* 1qle_L* 1f6l_L 3iy2_A 1vfa_A 1dvf_A 1kir_A 1g7i_A 1g7j_A 1a2y_A 1kip_A 1kiq_A 1vfb_A 1g7h_A 1a7o_L 1g7l_A 1g7m_A 1a7n_L ... Back     alignment and structure
>2vsd_A CHIR AB1; immune system receptor, FC receptor; HET: NAG NDG MAN; 1.82A {Gallus gallus} Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>2znx_A SCFV; fluorotryptohpan, 5-fluorotryptophan, 19F, single chain FV, allergen, antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase; HET: FTR 1PG; 2.30A {Homo sapiens} PDB: 2znw_A* Back     alignment and structure
>2ywz_A NEW antigen receptor variable domain; IG VNAR, immune system; 2.21A {Orectolobus maculatus} PDB: 2ywy_A Back     alignment and structure
>1i3g_L Antibody FV fragment; antibiotic; 2.44A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy6_A Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>4dzb_B Vbeta2 (MAIT T cell receptor); immune system; 1.70A {Homo sapiens} PDB: 1ymm_E* 3o4l_E* 3o6f_D 3t0e_D 1ktk_E 3mfg_B 2ij0_E Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>3f8u_B Tapasin; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1bii_B Beta-2 microglobulin, MHC class I H-2DD; complex (MHC I/peptide), major histocompatibility complex class I DD, transmembrane, glycoprotein; 2.40A {Mus musculus} SCOP: b.1.1.2 Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>4ffy_L DENV1-E111 single chain variable fragment (light; viral envelope proteins, structural genomics, antibody epito flavivirus, niaid; 2.50A {Mus musculus} Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>4gos_A V-SET domain-containing T-cell activation inhibit; immunoglobulin domain, glycoprotein, disulfide bond, immunit adaptive immunity; HET: NAG BMA MAN; 1.59A {Homo sapiens} Back     alignment and structure
>2rgs_A I, IG gamma-2B heavy chain; FC-fragment, immunoglobulin, glycosylation, immune system; HET: NAG FUC MAN GAL; 2.13A {Mus musculus} Back     alignment and structure
>2ghw_B Anti-SARS SCFV antibody, 80R; S protein, neutralizing antibody, virus/viral protein/antibiotic complex; 2.30A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>3sob_H Antibody heavy chain, low-density lipoprotein receptor-related protein; beta propeller, protein binding-immune system complex; 1.90A {Homo sapiens} PDB: 1pkq_B 3uls_H 3ulu_D* 3ulv_D* Back     alignment and structure
>2yz1_A Tyrosine-protein phosphatase non-receptor type substrate 1; beta-sandwich, structural genomics, NPPSFA; 1.40A {Mus musculus} Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>3bqu_C 3H6 FAB light chain; beta sheet, immune system; 3.00A {Mus musculus} Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1l6x_A Immunoglobulin gamma-1 heavy chain constant regio; IGG1 FC, FC complex, immune system; HET: NAG BMA MAN GAL FUL; 1.65A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2iwg_A* 3v7m_A* 3d6g_A* 3agv_A* 1oqo_A* 1oqx_A* 3v95_A* 2wah_A* 3sgj_A* 3sgk_A* 2dtq_A* 2dts_A* 3ave_A* 3ay4_A* 3do3_A* 2gj7_A* 1t83_A* 1t89_A* 1dn2_A* 3dnk_A ... Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>1lk3_L 9D7 light chain; antigen-antibody complex, immune system; 1.91A {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.2 PDB: 1fn4_A 1c5d_L 1bfo_A 3b9k_L* Back     alignment and structure
>3p73_B Beta-2-microglobulin; IG-like C1-type (immunoglobulin-like) domain, histocompatibi antigen, immune system; HET: 16A; 1.32A {Gallus gallus} SCOP: b.1.1.0 PDB: 3p77_B* 4g43_B 4g42_B 4e0r_B 3bev_B 3bew_B 3jvg_C* 2yez_B 2yf5_B 2yf6_B 2yf1_B* Back     alignment and structure
>2wqr_A IG epsilon chain C region; immune system, immunoglobulin domain, glycoprotein; HET: NAG BMA MAN PG4; 1.90A {Homo sapiens} PDB: 2y7q_B* 1o0v_A* 3h9y_A* 3h9z_A* 3ha0_A* 1fp5_A 1f6a_B 1g84_A Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sq2_N Novel antigen receptor; immunoglobulin fold, protein-protein complex, hydrolase/immune system complex; 1.45A {Ginglymostoma cirratum} SCOP: b.1.1.1 PDB: 1t6v_N Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>1moe_A Anti-CEA MAB T84.66; anti carcinoembryonic antigen, diabody, dimer, SCFV, variable domain, immune system; 2.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>3bkj_L WO2 IGG2A FAB fragment light chain kappa; abeta, FAB, WO2, alzheimer'S disease, immunotherapies, APP, immune system; 1.59A {Mus musculus} PDB: 3bkc_L 3bkm_L 2zuq_B* 1h3p_L Back     alignment and structure
>1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>3juy_B 3B3 single chain variant HIV-1 antibody; envelope protein GP120, broadly neutralizing antibody, 3B3 single chain variable fragment, immune system; 2.50A {Homo sapiens} Back     alignment and structure
>1j05_L T84.66 antibody, anti-CEA MAB T84.66, light chain; immunoglobulin, immune system; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1qfw_L* 1qnz_L 3iy3_A 3iy4_A Back     alignment and structure
>2wbj_D OB TCR; transmembrane, immune response, T cell receptor, MHC II, MEM receptor, molecular mimicry, multiple sclerosis, immune SYS autoimmunity; HET: NAG BMA MAN; 3.00A {Homo sapiens} Back     alignment and structure
>1b6u_A KIR2DL3, P58 killer cell inhibitory receptor; natural killer cell, HLA, major histocompatibility complex class I (MHC class I); 3.00A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1eeq_A Kappa-4 immunoglobulin (light chain); protein stability, hydrogen bonds, immune system; 1.50A {Homo sapiens} SCOP: b.1.1.1 PDB: 1eeu_A 1lve_A 2lve_A 3lve_A 5lve_A 4lve_A 1efq_A 1qac_A 1ek3_A 2imm_A 1mvu_A 2ap2_A 1ap2_A 3bd3_A* 3bd4_A* 3bd5_A* 2imn_A 3dus_A* 3duu_A* 3dv4_A* ... Back     alignment and structure
>2coq_A NEW antigen receptor variable domain; IG VNAR, natural TYPE2, immune system; 2.10A {Orectolobus maculatus} Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yc1_B Single chain antibody fragment 9004G; immune system-toxin complex, scorpion toxin; 1.90A {Homo sapiens} PDB: 2ybr_B 3lh2_L 3h3p_L 3lhp_L Back     alignment and structure
>1h5b_A Murine T cell receptor (TCR) valpha domain; immune response, immunoglobulin fold; 1.85A {Mus musculus} SCOP: b.1.1.1 PDB: 1h5b_C 1h5b_B Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>1svz_A Immunoglobulin;, single-chain FV fragment 1696; antibody-antigen complex, HIV inhibiting antibody; 1.89A {Mus musculus} PDB: 1jp5_A Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>1nez_G T-cell surface glycoprotein CD8 alpha chain; immune system; HET: NAG; 2.10A {Synthetic} SCOP: b.1.1.1 PDB: 1bqh_G* 3b9k_A* 2atp_A* 2arj_R Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3o81_A Beta-2-microglobulin; IG-like C1-type (immunoglobulin-like) domain, histocompatibi antigen, MHC class I molecule from B21 chicken, immune SYST; 2.00A {Gallus gallus} Back     alignment and structure
>1ypz_F T-cell receptor gamma chain, beta-2-microglobulin; H2-T22 protein, T cell receptor delta, immune system; HET: NAG MAN FUC; 3.40A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>2jju_A Signal regulatory protein beta-1; immunoglobulin domain, immunoglobulin superfamily, immune system, transmembrane, paired receptor; 1.19A {Homo sapiens} PDB: 2jjv_A 2uv3_A* 2jjt_A* 2jjs_A* 2jjw_A Back     alignment and structure
>2gjj_A A21 single-chain antibody fragment against ERBB2; IG family, SCFV, immune system; 2.10A {Mus musculus} PDB: 3h3b_C Back     alignment and structure
>1i1c_A IGG2A, IG gamma-2A chain C region; FC, immune system; HET: NAG FUL BMA MAN FUC; 2.70A {Rattus norvegicus} SCOP: b.1.1.2 b.1.1.2 PDB: 1i1a_D* Back     alignment and structure
>3jts_B Beta-2-microglobulin; alpha helix, beta sheet, beta barrel, immune response, MHC I membrane, transmembrane, disease mutation; 2.80A {Homo sapiens} Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>1hxm_B Gamma-delta T-cell receptor; IG domain, TCR, GDTCR, immune system; 3.12A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>3udw_C Poliovirus receptor; PVR tigit IGSF signal transduction immunology, IGSF, cell SU receptor signalling, glycosylation, membrane protein; HET: NAG; 2.90A {Homo sapiens} Back     alignment and structure
>1x9q_A SCFV, 4M5.3 anti-fluorescein single chain antibody fragment; VERY high affinity, antibody binding, electrostatics, directed evolution; HET: FLU; 1.50A {Homo sapiens} Back     alignment and structure
>3moq_A NEW antigen receptor variable domain, P3(40) PEPT amyloid beta A4 protein; AB-ignar, AB-12Y-2, glycoprotein, membran protease inhibitor; 2.05A {Orectolobus maculatus} PDB: 2z8w_C 2z8v_C 1ves_A 1ver_A Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>1zxq_A ICAM-2, intercellular adhesion molecule-2; immunoglobulin fold, cell adhesion, glycoprotein, transmembr; HET: NAG; 2.20A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 Back     alignment and structure
>1xt5_A Variable region-containing chitin-binding protein 3; innate immunity, VCBP, primordial antigen receptor, florida lancelet, amphioxus; 1.15A {Branchiostoma floridae} Back     alignment and structure
>1q0x_L FAB 9B1, light chain; anti-morphine antibody, FAB fragment, immune system; HET: PG4; 1.60A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1q0y_L* 1ngp_L* 1ngq_L 3ks0_L* 1gig_L 2vir_A 2vis_A* 2vit_A 1sm3_L 4a6y_L 1ind_L* 1ine_L* 1yuh_L* 2zpk_L 3rhw_K* 3ri5_K* 3ria_K* 3rif_K* 1mfe_L* 1mfb_L* ... Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>4ei6_B Vbeta16 XV19 type II natural killer T cell recept variable domain, human constant...; natural killer T cell receptor, immune system; 1.60A {Mus musculus} PDB: 4ei5_D 4elk_B 4elm_F* 2esv_E 3ffc_E 3utt_E 3utp_E* 3uts_E 3qjf_B 3qjh_B 3qiw_D* 3qiu_D Back     alignment and structure
>1dlf_L Anti-dansyl immunoglobulin IGG2A(S); FV fragment; 1.45A {Mus musculus} SCOP: b.1.1.1 PDB: 1wz1_L* 2dlf_L 1maj_A 1mak_A 1ktr_L 2cju_L* 2uud_K* 1dsf_L 3nn8_B 1n4x_L 1bfv_L* 1cfv_L* 2bfv_L* 1wt5_C Back     alignment and structure
>2d9c_A Signal-regulatory protein beta-1; beta-sandwich, SIRP-beta-1, CD172B antigen, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4hwn_A FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG superfamily, immune system, ST genomics, PSI-biology; 2.01A {Homo sapiens} Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>3q5y_A TCR N15 beta; IG, T cell receptor, antigen peptide/MHC, membrane, immune S; HET: EPE; 1.90A {Mus musculus} PDB: 1nfd_B* 3q5t_A Back     alignment and structure
>3umt_A SCFV heavy chain and light chain; stability engineering, anthrax, anti-BCLA antibody, immunoglobulin fold (VH and VL domains), antibody, immune S; HET: NHE; 1.80A {Mus musculus} PDB: 1xiw_D Back     alignment and structure
>1f3r_B FV antibody fragment; IG-fold, immuno complex, antibody-antigen, beta-turn, immune system; HET: NLE; NMR {Rattus norvegicus} SCOP: b.1.1.1 b.1.1.1 Back     alignment and structure
>4gjt_B Poliovirus receptor-related protein 4; six-bladed -propeller, IGV-like fold, viral entry, MV-H, NEC BETA4/BETA5 groove; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1gsm_A Madcam-1, mucosal addressin cell adhesion molecule-1; cell adhesion protein, immunoglobulin fold, I-SET fold, cell adhesion glycoprotein; 1.9A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1bqs_A* Back     alignment and structure
>3gbl_A BETA2-microglobulin; immune response, immunoglobulin domain, MHC I, secreted, immune system; 2.10A {Ctenopharyngodon idella} SCOP: b.1.1.0 Back     alignment and structure
>2z35_A T-cell receptor alpha-chain; immune receptor, immune system; 2.20A {Mus musculus} PDB: 2pxy_A 2z31_A 1ac6_A Back     alignment and structure
>2vol_A Murine IGG FC; FC, zinc, B30.2, nucleus, pryspry, cytoplasm, mouse IGG, zinc-finger, DNA-binding, RNA-binding, tripartite motif (TRIM) protein; HET: NAG MAN GAL FUC; 1.95A {Mus musculus} PDB: 3hkf_A 1i1a_C* 1cqk_A Back     alignment and structure
>1nfd_E H57 FAB; complex (immunoreceptor-immunoglobulin), complex (immunorece immunoglobulin) complex; HET: NAG NDG; 2.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>3c5j_B MHC class II antigen; HLA, MHC class II, glycoprotein, immune response, membrane, transmembrane, GTP-binding, methylation; HET: NAG; 1.80A {Homo sapiens} PDB: 2q6w_B 1a6a_B* 1d5m_B* 1j8h_B* 1d5z_B* 1d5x_B* 1d6e_B* 2seb_B* 2wbj_B* 1ymm_B* 3l6f_B* 3s4s_B 3s5l_B 1fyt_B* 1seb_B 1bx2_B* 1zgl_B 1fv1_B 1h15_B* 1hqr_B ... Back     alignment and structure
>3u1s_H FAB PGT145 heavy chain; IGG, broadly neutralizing antibody, HIV-1 GP120, immune SYST; HET: TYS; 2.30A {Homo sapiens} Back     alignment and structure
>2w59_A IGY FCU3-4; immunoglobulin, avian, immune system; HET: NAG MAN; 1.75A {Gallus gallus} Back     alignment and structure
>1u3h_A T-cell receptor alpha-chain; complex, immune system; 2.42A {Mus musculus} SCOP: b.1.1.1 PDB: 1b88_A 1kj2_A* 1kb5_A 1d9k_A* Back     alignment and structure
>1uvq_B HLA class II histocompatibility antigen; immunology, MHC class II, diabetes, narcolepsy, autoimmune disease, structural proteomics in europe, spine, structural genomics; HET: NAG FUC BMA; 1.8A {Homo sapiens} SCOP: b.1.1.2 d.19.1.1 PDB: 3pl6_B* 1jk8_B* 2nna_B 1s9v_B 2iad_B 1muj_B* 1d9k_D* 1iak_B* 1jl4_B 1f3j_B* 2pxy_D 1k2d_B* 1u3h_D 2z31_D 3mbe_B* 1aqd_B 3pdo_B 3pgc_B 3pgd_B 1klu_B ... Back     alignment and structure
>1fo0_B Protein (BM3.3 T cell receptor beta-chain); class I MHC, H-2KB, TCR-PMHC complex, immune system; 2.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1nam_B* 2ol3_B* 1kb5_B 1kj2_B* Back     alignment and structure
>1zvo_C Myeloma immunoglobulin D delta; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bnu_A TCR alpha chain, T-cell receptor alpha chain C region; superagonist peptide T-cell vaccines, transmembrane, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2bnq_D 2bnr_D 2f54_D 2pyf_A* 2pye_D* 2f53_D 2p5e_D* 2p5w_D* 3mv7_D 3mv8_D 3mv9_D 3utt_D 2cdg_A Back     alignment and structure
>3ux9_B SCFV antibody; five helices, long loop connecting helix, hydrophobic intera cytokine-immune system complex; 2.80A {Homo sapiens} Back     alignment and structure
>1oaq_L Light chain; antibody, allergy, IGE, conformational diversity, multispecificity; 1.50A {Rattus rattus} SCOP: b.1.1.1 PDB: 1ocw_L 2bjm_L* 1oau_L* 1oar_L* 1oaz_L 1mfa_L* 1a6v_L* 1oax_L* 1oay_L* 1a6w_L* 1a6u_L 1dl7_L* Back     alignment and structure
>3gkz_A Anti-methamphetamine single chain FV; therapeutic antibody, MDMA, IGG, immune system; HET: B40; 1.90A {Mus musculus} PDB: 3gm0_A* 1rvf_L 3ab0_C 2a0l_C 3iy5_A Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3c5j_A HLA class II histocompatibility antigen, DR alpha; HLA, MHC class II, glycoprotein, immune response, membrane, transmembrane, GTP-binding, methylation; HET: NAG; 1.80A {Homo sapiens} PDB: 1d5x_A* 1d5z_A* 1d6e_A* 1d5m_A 1fyt_A* 1hqr_A 1j8h_A* 1r5i_A 1seb_A 1zgl_A 2seb_A* 1fv1_A* 2ipk_A* 3pdo_A 3pgc_A 3pgd_A 1ymm_A* 1aqd_A 2g9h_A* 1h15_A ... Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3s6c_A Beta-2-microglobulin, T-cell surface glycoprotein membrane-associated; MHC, immunoglobulin domain, immune system, antigen presentat glycosylation; HET: NAG FUC; 2.90A {Homo sapiens} Back     alignment and structure
>2bc4_B HLA class II histocompatibility antigen, DM beta chain; MHC class II, immune system; HET: NDG BMA; 2.27A {Homo sapiens} PDB: 1hdm_B 1k8i_B* Back     alignment and structure
>2fbj_H IGA-kappa J539 FAB (heavy chain); immunoglobulin; HET: NAG FUC; 1.95A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mcp_H 2mcp_H* Back     alignment and structure
>3r0n_A Poliovirus receptor-related protein 2; IG-domain, cell-adhesion molecule, virus entry receptor, STR genomics, PSI-biology; 1.30A {Homo sapiens} PDB: 4dfh_A 4dfi_A Back     alignment and structure
>3to4_D NKT vbeta2 (mouse variable domain, human constant; mouse CD1D, mouse NKT, immune system; HET: AGH NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1op3_H FAB 2G12, heavy chain; domain-swapped FAB 2G12, anti-carbohydrate antibody, immune system; HET: MAN; 1.75A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 1om3_H* 1op5_H* 3oay_M* 1zlu_H* 1zlv_H* 1zlw_H* 2oqj_B 1zls_H* 3ob0_H* 3oau_H* 3oaz_H* 3ghe_H 3eyf_B 3eyo_B 3ghb_H 3c2a_H 1q1j_H 2fl5_H* Back     alignment and structure
>3khq_A B-cell antigen receptor complex-associated protei chain; CD79B, CD79A, IG-beta, BCR, IG domain, V-SET, immunoglobulin protein binding; HET: FLC GSH; 1.70A {Mus musculus} PDB: 3kho_A* Back     alignment and structure
>1tvd_A T cell receptor, ES204 V delta; immunoreceptor, TCR, delta chain, variable domain; 1.90A {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>3qib_D 2B4 beta chain; IG domain, immune system; HET: NAG FUC BMA; 2.70A {Mus musculus} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3t0v_A Immunoglobulin variable lambda domain; immunoglobulin fold, fluorogen activation, dimethylindole RE binding protein; HET: 1PE PE3; 1.45A {Homo sapiens} PDB: 3t0w_A* 3t0x_A* 3lrg_A 3lrh_A 2rhe_A Back     alignment and structure
>1k5n_A Major histocompatibility complex molecule HLA-B*2; MHC(major histocompatibility complex), HLA(human leukocyte A immune system; 1.09A {Homo sapiens} SCOP: b.1.1.2 d.19.1.1 PDB: 1jgd_A 1of2_A 1uxw_A 1w0w_A 3b3i_A* 3bp7_A 3czf_A* 3hcv_A* 3d18_A* 2bss_A 2bsr_A 2a83_A 1jge_A 1hsa_A 1uxs_A 1w0v_A 1ogt_A 2bst_A 3b6s_A* 3bp4_A ... Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>1ow0_A IG alpha-1 chain C region; IGA1, fcari, CD89, antibody, immunoglobulin-LIK immune system; HET: NAG FUL BMA GAL SIA FUC MAN NDG; 3.10A {Homo sapiens} SCOP: b.1.1.2 b.1.1.2 PDB: 2qej_A* Back     alignment and structure
>1n4x_H Immunoglobulin heavy chain variable region; immune system; 1.70A {Mus musculus} SCOP: b.1.1.1 PDB: 3iy4_B Back     alignment and structure
>1a2y_B IGG1-kappa D1.3 FV (heavy chain); complex (immunoglobulin/hydrolase), immunoglobulin V region, signal, hydrolase, glycosidase, bacteriolytic enzyme, egg white; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1a7r_H 1dvf_B 1g7h_B 1g7i_B 1g7j_B 1g7l_B 1g7m_B 1kir_B 1vfa_B 1vfb_B 1kiq_B 1a7o_H 1a7n_H 1a7p_H 1kip_B 1a7q_H 1dl7_H* 1bvk_B 1bvl_A 1p4i_H ... Back     alignment and structure
>1p4b_L Antibody variable light chain; FV antibody, antigen peptide binder, SCFV, picomolar binder, immune system; 2.35A {Mus musculus} SCOP: b.1.1.1 PDB: 1p4i_L Back     alignment and structure
>1lp9_E T-cell receptor alpha chain; immunoregulatory complex, class I MHC:TCR CO-crystal, immune; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 2j8u_E 2jcc_E 2uwe_E 1nfd_A* Back     alignment and structure
>2oyp_A Hepatitis A virus cellular receptor 2; TIM-3, T-cell immunoglobulin mucin, signaling protein; 1.95A {Mus musculus} PDB: 3kaa_A* Back     alignment and structure
>3kgr_A LAIR-1, hlair1, leukocyte-associated immunoglobulin-like receptor; IG-like domain, cell membrane, glycoprotein; 1.80A {Homo sapiens} PDB: 3rp1_A Back     alignment and structure
>1ncn_A T lymphocyte activation antigen CD86; IG V, beta strands, immune system; 2.70A {Homo sapiens} SCOP: b.1.1.1 PDB: 1i85_A Back     alignment and structure
>1fo0_A Protein (BM3.3 T cell receptor alpha-chain); class I MHC, H-2KB, TCR-PMHC complex, immune system; 2.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1nam_A* Back     alignment and structure
>3u6r_L Antibody 1:7 (light chain); IG-like domain, neutralizing single chain FV, immune system; 2.67A {Homo sapiens} Back     alignment and structure
>1c1e_H Catalytic antibody 1E9 (heavy chain); diels-alder, immunoglobulin, immune system; HET: ENH; 1.90A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1dbb_H* 1dba_H* 1dbj_H* 1dbk_H* 1dbm_H* 2dbl_H* 3ojd_B 1jgl_H* 1jhk_H 1ghf_H 1tet_H* 3e8u_H 1fj1_B 1cl7_H Back     alignment and structure
>1nqb_A Single-chain antibody fragment; multivalent antibody, diabody, domain SWA immunoglobulin; 2.00A {Mus musculus} SCOP: b.1.1.1 b.1.1.1 PDB: 1lmk_A 1qnz_H Back     alignment and structure
>3r08_E T-cell surface glycoprotein CD3 epsilon chain; antibody, T-cell receptor, signalling, immune SY; 4.10A {Cricetulus migratorius} Back     alignment and structure
>3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Back     alignment and structure
>2i24_N NEW antigen receptor PBLA8; immunoglobulin fold, immune system; 1.35A {Ginglymostoma cirratum} PDB: 2i25_N 2i27_N 2i26_N Back     alignment and structure
>1mju_H Immunoglobulin MS6-12; catalytic antibody, ester hydrolysis, esterolytic, FAB, immune system; 1.22A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1mjj_B 1mie_H 1mj7_H* 1mj8_H 1mh5_B* 4aeh_H 2y5t_A 2vwe_E 2op4_H 2ntf_H 3loh_C 1e4x_H 2vl5_A 1e4x_I 1e4w_H 3opz_H 3oz9_H 1plg_H 1hi6_B 1cfn_B ... Back     alignment and structure
>3b9v_A Heavy chain variable domain; antibody engineering, phage display, immune system; 1.80A {Homo sapiens} PDB: 1fvc_B 3p9w_B 1fgv_H 2vh5_H* Back     alignment and structure
>2atp_B T-cell surface glycoprotein CD8 beta chain; CD8AB, CD8AA, MHC, immune system; HET: NAG; 2.40A {Mus musculus} SCOP: b.1.1.1 PDB: 3b9k_B* Back     alignment and structure
>1uvq_A HLA class II histocompatibility antigen; immunology, MHC class II, diabetes, narcolepsy, autoimmune disease, structural proteomics in europe, spine, structural genomics; HET: NAG FUC BMA; 1.8A {Homo sapiens} SCOP: b.1.1.2 d.19.1.1 PDB: 3pl6_A* 4d8p_A 1s9v_A 2nna_A 1jk8_A* Back     alignment and structure
>3uzq_A Anti-dengue MAB 4E11; dengue antibody neutralization, immune system; HET: MES; 1.60A {Mus musculus} PDB: 3uze_A* 3uyp_A* 3uzv_B 1dzb_A Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>1onq_A T-cell surface glycoprotein CD1A; protein-glycolipid complex, beta sheet platform,, immune SYS; HET: NAG FUC SLF; 2.15A {Homo sapiens} SCOP: b.1.1.2 d.19.1.1 PDB: 1xz0_A* Back     alignment and structure
>1pew_A JTO2, A lambda-6 type immunoglobulin light chain, domain; beta sheet, immune system; 1.60A {Homo sapiens} SCOP: b.1.1.1 PDB: 1cd0_A 1pw3_A 2cd0_A 2w0k_A 3b5g_A 3bdx_A* 2w0l_A Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>3r8b_B G5-8, enterotoxin type B; immunoglobulin-like, OB-fold, toxin-immune system complex; 2.95A {Rattus norvegicus} Back     alignment and structure
>2ak4_D SB27 T cell receptor alpha chain; bulged epitopes, PMHC/TCR complex, immune system; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.2 PDB: 3kxf_D 3nfj_I 3ffc_D Back     alignment and structure
>2xt1_B Camelid VHH 9; viral protein-immune system complex; 1.32A {Vicugna pacos} PDB: 2xv6_B 2xxc_B 2xxm_B Back     alignment and structure
>2yc1_A Single chain antibody fragment 9004G; immune system-toxin complex, scorpion toxin; 1.90A {Homo sapiens} PDB: 2ybr_A 1dql_H 3cfi_C Back     alignment and structure
>1j05_H T84.66 antibody, anti-CEA MAB T84.66, heavy chain; immunoglobulin, immune system; 1.50A {Mus musculus} SCOP: b.1.1.1 PDB: 1dvf_D 1mvu_B 1ap2_B 2ap2_B Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3tpk_A Immunoglobulin heavy chain antibody variable DOMA; immunoglobulin heavy chain domains, VHH, complementarity DET regions, CDR, oligomer-specific; 1.30A {Camelidae} PDB: 3ln9_A* 1zv5_A Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query70
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.96
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.95
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 97.74
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 97.68
d2ifga192 High affinity nerve growth factor receptor TrkA, d 97.61
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 97.36
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.33
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 97.23
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 97.22
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.17
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 97.13
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 97.13
d1gxea_130 Cardiac myosin binding protein C, different domain 97.09
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 97.08
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 97.04
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 96.98
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 96.94
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 96.93
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 96.93
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 96.87
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 96.76
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 96.69
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 96.68
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 96.6
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 96.5
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 96.45
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 96.4
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 96.29
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 96.27
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 96.24
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 96.08
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 96.04
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 96.02
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 95.99
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 95.84
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 95.71
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 95.69
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 95.65
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 95.63
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 95.6
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 95.58
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 95.32
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 94.85
d2avga1110 Cardiac myosin binding protein C, different domain 94.69
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 94.54
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 93.68
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 93.62
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 93.54
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 93.4
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 93.3
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 93.22
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 93.14
d1pd6a_94 Cardiac myosin binding protein C, different domain 92.84
d1de4a194 Hemochromatosis protein Hfe, alpha-3 domain {Human 92.39
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 92.38
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 91.96
d1t7va194 Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu 91.64
d2mhaa189 Class I MHC, alpha-3 domain {Mouse (Mus musculus) 91.25
d1k5na195 Class I MHC, alpha-3 domain {Human (Homo sapiens) 90.71
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 90.0
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 89.97
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 88.26
d3frua191 Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor 88.26
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 87.29
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 86.46
d1fp5a2105 Immunoglobulin heavy chain epsilon constant domain 85.72
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 85.51
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 84.39
d1hyrc194 Class I MHC homolog, alpha-3 domain {Human (Homo s 83.41
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 83.06
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 82.91
d1rzfl2102 Immunoglobulin light chain lambda constant domain, 82.63
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 82.44
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 81.51
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 81.17
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 81.02
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 80.55
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 80.53
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 80.12
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: I set domains
domain: Neural cell adhesion molecule (NCAM)
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=97.96  E-value=2.7e-06  Score=49.05  Aligned_cols=35  Identities=23%  Similarity=0.345  Sum_probs=30.0

Q ss_pred             ecCCeEEEecceE--EeccCCcEEEEEEEeeeCCCCC
Q psy15736         35 KNLPEIEVERSWV--HSGEGYEAQLVCIVHAEPHADP   69 (70)
Q Consensus        35 ~ypPeI~v~~~~V--ha~~G~~a~L~CiV~A~P~a~V   69 (70)
                      ++||.|....+.+  .+.+|..++|.|.+.|.|.|.|
T Consensus         1 nvPP~i~~~~~~~~~t~~~G~~v~l~C~~~g~P~p~i   37 (100)
T d1qz1a3           1 NVPPTVQARQSIVNATANLGQSVTLVCDADGFPEPTM   37 (100)
T ss_dssp             EEEEEEEESCSEEEEETTSCCCEEEEEEEEEESCCEE
T ss_pred             CcCCEEEeCCCceeEEEcCCCCEEEEEEEEEecCCEE
Confidence            5799999887766  4578999999999999999875



>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure