Psyllid ID: psy15800
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 109 | ||||||
| 317575680 | 327 | glyoxylate reductase/hydroxypyruvate red | 0.660 | 0.220 | 0.513 | 3e-12 | |
| 47215537 | 319 | unnamed protein product [Tetraodon nigro | 0.660 | 0.225 | 0.5 | 5e-12 | |
| 392881520 | 355 | glyoxylate reductase/hydroxypyruvate red | 0.541 | 0.166 | 0.610 | 6e-12 | |
| 392883490 | 355 | glyoxylate reductase/hydroxypyruvate red | 0.541 | 0.166 | 0.610 | 6e-12 | |
| 387914882 | 355 | glyoxylate reductase/hydroxypyruvate red | 0.541 | 0.166 | 0.610 | 6e-12 | |
| 66472696 | 327 | glyoxylate reductase/hydroxypyruvate red | 0.605 | 0.201 | 0.530 | 8e-12 | |
| 33468556 | 327 | novel protein similar to human glyoxylat | 0.605 | 0.201 | 0.530 | 8e-12 | |
| 392876574 | 355 | glyoxylate reductase/hydroxypyruvate red | 0.541 | 0.166 | 0.610 | 1e-11 | |
| 225706132 | 328 | Glyoxylate reductase/hydroxypyruvate red | 0.605 | 0.201 | 0.530 | 2e-11 | |
| 348514536 | 328 | PREDICTED: glyoxylate reductase/hydroxyp | 0.605 | 0.201 | 0.530 | 6e-11 |
| >gi|317575680|ref|NP_001187384.1| glyoxylate reductase/hydroxypyruvate reductase [Ictalurus punctatus] gi|308322871|gb|ADO28573.1| glyoxylate reductase/hydroxypyruvate reductase [Ictalurus punctatus] | Back alignment and taxonomy information |
|---|
Score = 75.9 bits (185), Expect = 3e-12, Method: Compositional matrix adjust.
Identities = 37/72 (51%), Positives = 46/72 (63%)
Query: 5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGH 64
AG NLKVIST SVG DHL +D+IK RGIRVG V +DA AE + L +A +RR +G
Sbjct: 71 AGPNLKVISTMSVGFDHLAIDEIKKRGIRVGYTPDVLTDATAELTVALLLATARRLPEGI 130
Query: 65 NCIASGTEKSQQ 76
+ SG S +
Sbjct: 131 QEVKSGGWSSWK 142
|
Source: Ictalurus punctatus Species: Ictalurus punctatus Genus: Ictalurus Family: Ictaluridae Order: Siluriformes Class: Actinopterygii Phylum: Chordata Superkingdom: Eukaryota |
| >gi|47215537|emb|CAG06267.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
| >gi|392881520|gb|AFM89592.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] | Back alignment and taxonomy information |
|---|
| >gi|392883490|gb|AFM90577.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] | Back alignment and taxonomy information |
|---|
| >gi|387914882|gb|AFK11050.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] gi|392876936|gb|AFM87300.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] gi|392877568|gb|AFM87616.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] gi|392877738|gb|AFM87701.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] gi|392882350|gb|AFM90007.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] | Back alignment and taxonomy information |
|---|
| >gi|66472696|ref|NP_001018361.1| glyoxylate reductase/hydroxypyruvate reductase [Danio rerio] gi|63100524|gb|AAH95040.1| Glyoxylate reductase/hydroxypyruvate reductase [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|33468556|emb|CAE30406.1| novel protein similar to human glyoxylate reductase/hydroxypyruvate reductase (GRHPR) [Danio rerio] | Back alignment and taxonomy information |
|---|
| >gi|392876574|gb|AFM87119.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] | Back alignment and taxonomy information |
|---|
| >gi|225706132|gb|ACO08912.1| Glyoxylate reductase/hydroxypyruvate reductase [Osmerus mordax] | Back alignment and taxonomy information |
|---|
| >gi|348514536|ref|XP_003444796.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 109 | ||||||
| ZFIN|ZDB-GENE-040724-230 | 327 | grhpra "glyoxylate reductase/h | 0.605 | 0.201 | 0.530 | 3.5e-12 | |
| UNIPROTKB|F1NX57 | 345 | GRHPR "Uncharacterized protein | 0.605 | 0.191 | 0.515 | 4e-11 | |
| UNIPROTKB|F1MB84 | 328 | GRHPR "Uncharacterized protein | 0.605 | 0.201 | 0.515 | 1.6e-10 | |
| UNIPROTKB|Q9UBQ7 | 328 | GRHPR "Glyoxylate reductase/hy | 0.605 | 0.201 | 0.5 | 3.5e-10 | |
| MGI|MGI:1923488 | 328 | Grhpr "glyoxylate reductase/hy | 0.605 | 0.201 | 0.5 | 3.5e-10 | |
| UNIPROTKB|Q5T946 | 395 | GRHPR "Glyoxylate reductase/hy | 0.605 | 0.167 | 0.5 | 5.4e-10 | |
| UNIPROTKB|F1PJS0 | 328 | GRHPR "Uncharacterized protein | 0.605 | 0.201 | 0.5 | 5.8e-10 | |
| RGD|1308851 | 328 | Grhpr "glyoxylate reductase/hy | 0.532 | 0.176 | 0.551 | 5.8e-10 | |
| UNIPROTKB|E9PSJ6 | 335 | Grhpr "Protein Grhpr" [Rattus | 0.532 | 0.173 | 0.551 | 6.1e-10 | |
| UNIPROTKB|D4A6S1 | 336 | Grhpr "Protein Grhpr" [Rattus | 0.532 | 0.172 | 0.551 | 6.2e-10 |
| ZFIN|ZDB-GENE-040724-230 grhpra "glyoxylate reductase/hydroxypyruvate reductase a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 168 (64.2 bits), Expect = 3.5e-12, P = 3.5e-12
Identities = 35/66 (53%), Positives = 44/66 (66%)
Query: 5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGH 64
AG NLKVIST SVG DHL +D+IK RGIRVG V +DA AE + L +A +RR +G
Sbjct: 71 AGPNLKVISTLSVGFDHLAIDEIKKRGIRVGYTPDVLTDATAELTVALLLATARRLPEGV 130
Query: 65 NCIASG 70
+ +G
Sbjct: 131 EEVKNG 136
|
|
| UNIPROTKB|F1NX57 GRHPR "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MB84 GRHPR "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UBQ7 GRHPR "Glyoxylate reductase/hydroxypyruvate reductase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1923488 Grhpr "glyoxylate reductase/hydroxypyruvate reductase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5T946 GRHPR "Glyoxylate reductase/hydroxypyruvate reductase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PJS0 GRHPR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1308851 Grhpr "glyoxylate reductase/hydroxypyruvate reductase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PSJ6 Grhpr "Protein Grhpr" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A6S1 Grhpr "Protein Grhpr" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 109 | |||
| cd05301 | 309 | cd05301, GDH, D-glycerate dehydrogenase/hydroxypyr | 3e-17 | |
| pfam00389 | 312 | pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxy | 6e-16 | |
| COG1052 | 324 | COG1052, LdhA, Lactate dehydrogenase and related d | 1e-15 | |
| cd12156 | 301 | cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, | 2e-14 | |
| cd05198 | 302 | cd05198, formate_dh_like, Formate/glycerate and re | 3e-13 | |
| cd12172 | 306 | cd12172, PGDH_like_2, Putative D-3-Phosphoglycerat | 7e-12 | |
| COG0111 | 324 | COG0111, SerA, Phosphoglycerate dehydrogenase and | 2e-11 | |
| cd12161 | 315 | cd12161, GDH_like_1, Putative glycerate dehydrogen | 4e-11 | |
| cd12178 | 317 | cd12178, 2-Hacid_dh_13, Putative D-isomer specific | 3e-10 | |
| cd12175 | 311 | cd12175, 2-Hacid_dh_11, Putative D-isomer specific | 4e-10 | |
| cd05303 | 301 | cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P | 7e-10 | |
| cd01619 | 323 | cd01619, LDH_like, D-Lactate and related Dehydroge | 7e-10 | |
| cd12187 | 329 | cd12187, LDH_like_1, D-Lactate and related Dehydro | 6e-09 | |
| cd12165 | 314 | cd12165, 2-Hacid_dh_6, Putative D-isomer specific | 9e-08 | |
| cd12173 | 304 | cd12173, PGDH_4, Phosphoglycerate dehydrogenases, | 1e-07 | |
| cd12157 | 318 | cd12157, PTDH, Thermostable Phosphite Dehydrogenas | 7e-07 | |
| cd12168 | 321 | cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-l | 2e-06 | |
| cd12169 | 308 | cd12169, PGDH_like_1, Putative D-3-Phosphoglycerat | 2e-06 | |
| cd05299 | 312 | cd05299, CtBP_dh, C-terminal binding protein (CtBP | 3e-06 | |
| PRK13243 | 333 | PRK13243, PRK13243, glyoxylate reductase; Reviewed | 3e-06 | |
| cd12185 | 322 | cd12185, HGDH_LDH_like, Putative Lactate dehydroge | 4e-06 | |
| cd12177 | 321 | cd12177, 2-Hacid_dh_12, Putative D-isomer specific | 2e-05 | |
| cd12171 | 310 | cd12171, 2-Hacid_dh_10, Putative D-isomer specific | 2e-05 | |
| cd12183 | 328 | cd12183, LDH_like_2, D-Lactate and related Dehydro | 4e-05 | |
| cd12186 | 329 | cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydr | 6e-05 | |
| PRK07574 | 385 | PRK07574, PRK07574, formate dehydrogenase; Provisi | 7e-05 | |
| cd12155 | 314 | cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2 | 3e-04 | |
| cd12184 | 330 | cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydro | 3e-04 | |
| cd12162 | 307 | cd12162, 2-Hacid_dh_4, Putative D-isomer specific | 4e-04 | |
| cd12174 | 305 | cd12174, PGDH_like_3, Putative D-3-Phosphoglycerat | 5e-04 | |
| cd05302 | 348 | cd05302, FDH, NAD-dependent Formate Dehydrogenase | 0.002 | |
| TIGR01327 | 525 | TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenas | 0.003 | |
| cd05300 | 313 | cd05300, 2-Hacid_dh_1, Putative D-isomer specific | 0.003 |
| >gnl|CDD|240626 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH) | Back alignment and domain information |
|---|
Score = 74.4 bits (184), Expect = 3e-17
Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 2/67 (2%)
Query: 5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVG-TVGPVSSDAVAEFNIGLAIAVSRRFQQG 63
A LKVI+ +SVG+DH+ +D K+RGI V T V +DA A+ L +A +RR +G
Sbjct: 62 AAPPLKVIANYSVGYDHIDVDAAKARGIPVTNTPD-VLTDATADLAFALLLAAARRVVEG 120
Query: 64 HNCIASG 70
+ +G
Sbjct: 121 DRFVRAG 127
|
D-glycerate dehydrogenase (GDH, also known as hydroxypyruvate reductase, HPR) catalyzes the reversible reaction of (R)-glycerate + NAD+ to hydroxypyruvate + NADH + H+. In humans, HPR deficiency causes primary hyperoxaluria type 2, characterized by over-excretion of L-glycerate and oxalate in the urine, possibly due to an imbalance in competition with L-lactate dehydrogenase, another formate dehydrogenase (FDH)-like enzyme. GDH, like FDH and other members of the D-specific hydroxyacid dehydrogenase family that also includes L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase, typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann-fold NAD+ binding form, despite often low sequence identity. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric. Length = 309 |
| >gnl|CDD|215893 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|223980 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240633 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, D-isomer-specific 2-hydroxyacid-related dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family | Back alignment and domain information |
|---|
| >gnl|CDD|240649 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|240638 cd12161, GDH_like_1, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family | Back alignment and domain information |
|---|
| >gnl|CDD|240655 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240652 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240620 cd01619, LDH_like, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240663 cd12187, LDH_like_1, D-Lactate and related Dehydrogenase like proteins, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240650 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240634 cd12157, PTDH, Thermostable Phosphite Dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|240645 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-like dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240646 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240624 cd05299, CtBP_dh, C-terminal binding protein (CtBP), D-isomer-specific 2-hydroxyacid dehydrogenases related repressor | Back alignment and domain information |
|---|
| >gnl|CDD|183914 PRK13243, PRK13243, glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240661 cd12185, HGDH_LDH_like, Putative Lactate dehydrogenase and (R)-2-Hydroxyglutarate Dehydrogenase-like proteins, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240654 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240659 cd12183, LDH_like_2, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240662 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydroxyisocaproic acid dehydrogenase (D-HicDH), NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|181041 PRK07574, PRK07574, formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240632 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2-hydroxyacid dehydrogenase family | Back alignment and domain information |
|---|
| >gnl|CDD|240660 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydrogenase and related dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240639 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2-hydroxyacid dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240651 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains | Back alignment and domain information |
|---|
| >gnl|CDD|240627 cd05302, FDH, NAD-dependent Formate Dehydrogenase (FDH) | Back alignment and domain information |
|---|
| >gnl|CDD|233358 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 100.0 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 99.97 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 99.97 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 99.97 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 99.97 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 99.96 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 99.96 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 99.96 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 99.96 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 99.96 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 99.95 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 99.95 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 99.95 | |
| PLN02928 | 347 | oxidoreductase family protein | 99.94 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 99.94 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 99.94 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 99.93 | |
| KOG0069|consensus | 336 | 99.93 | ||
| KOG0068|consensus | 406 | 99.93 | ||
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 99.9 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 99.9 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 99.88 | |
| PF00389 | 133 | 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydr | 99.56 | |
| KOG0067|consensus | 435 | 99.45 | ||
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 99.38 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 99.12 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 98.75 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 98.13 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 95.98 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 95.82 | |
| PLN02494 | 477 | adenosylhomocysteinase | 95.35 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 94.49 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 93.52 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 93.01 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 91.1 | |
| COG0027 | 394 | PurT Formate-dependent phosphoribosylglycinamide f | 89.55 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 87.19 | |
| TIGR02964 | 246 | xanthine_xdhC xanthine dehydrogenase accessory pro | 85.61 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 84.01 | |
| PF03720 | 106 | UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen | 82.94 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 82.82 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 82.69 | |
| PLN02712 | 667 | arogenate dehydrogenase | 81.76 | |
| PLN02256 | 304 | arogenate dehydrogenase | 80.87 | |
| TIGR02114 | 227 | coaB_strep phosphopantothenate--cysteine ligase, s | 80.21 |
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-32 Score=200.36 Aligned_cols=106 Identities=27% Similarity=0.312 Sum_probs=96.5
Q ss_pred cccCCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCccc----c
Q psy15800 2 SSRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQ----H 77 (109)
Q Consensus 2 l~~~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~----~ 77 (109)
|+ .+|+||+|++.|+||||||+++++++||.|+|+|++++++||||+++++|++.|++.+.++.+++|+|..+. .
T Consensus 61 l~-~~p~LKlIa~~~~G~D~vDl~aa~~~gI~Vtnvp~~~t~sVAe~~~aLiLa~~R~~~~~~~~~r~g~w~~~~~~~~~ 139 (324)
T COG1052 61 LE-KLPGLKLIATRSAGYDNVDLEAAKERGITVTNVPGYSTEAVAEHAVALILALARRIHEGDRRVREGNWSLSGGPDPL 139 (324)
T ss_pred HH-hCCCcEEEEEeccccCcccHHHHHHCCcEEEeCCCCCchHHHHHHHHHHHHHhhchHHHHHHHhcCcccccCCcccc
Confidence 44 569999999999999999999999999999999999999999999999999999999999999999997653 2
Q ss_pred hhhhhc---------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800 78 AITELI---------TQSDTNHTQRCLASIMQLVYSTCYN 108 (109)
Q Consensus 78 ~~~~l~---------G~IG~~va~~~~~fg~~V~~~~r~~ 108 (109)
.+.++. |+||+++|+++++|||+|+||||++
T Consensus 140 ~~~~l~gktvGIiG~GrIG~avA~r~~~Fgm~v~y~~~~~ 179 (324)
T COG1052 140 LGFDLRGKTLGIIGLGRIGQAVARRLKGFGMKVLYYDRSP 179 (324)
T ss_pred cccCCCCCEEEEECCCHHHHHHHHHHhcCCCEEEEECCCC
Confidence 233332 7999999999999999999999986
|
|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG0069|consensus | Back alignment and domain information |
|---|
| >KOG0068|consensus | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF00389 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain; InterPro: IPR006139 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >KOG0067|consensus | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 109 | ||||
| 2gcg_A | 330 | Ternary Crystal Structure Of Human Glyoxylate Reduc | 1e-11 | ||
| 2h1s_A | 328 | Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE RE | 2e-11 | ||
| 1gdh_A | 320 | Crystal Structure Of A Nad-Dependent D-Glycerate De | 5e-08 | ||
| 2d0i_A | 333 | Crystal Structure Ph0520 Protein From Pyrococcus Ho | 1e-07 | ||
| 3ba1_A | 333 | Structure Of Hydroxyphenylpyruvate Reductase From C | 9e-06 | ||
| 4g2n_A | 345 | Crystal Structure Of Putative D-Isomer Specific 2-H | 2e-04 | ||
| 2ekl_A | 313 | Structure Of St1218 Protein From Sulfolobus Tokodai | 2e-04 | ||
| 3kb6_A | 334 | Crystal Structure Of D-lactate Dehydrogenase From A | 3e-04 | ||
| 1wwk_A | 307 | Crystal Structure Of Phosphoglycerate Dehydrogenase | 5e-04 |
| >pdb|2GCG|A Chain A, Ternary Crystal Structure Of Human Glyoxylate ReductaseHYDROXYPYRUVATE REDUCTASE Length = 330 | Back alignment and structure |
|
| >pdb|2H1S|A Chain A, Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE REDUCTASE FROM HOMO Sapiens Length = 328 | Back alignment and structure |
| >pdb|1GDH|A Chain A, Crystal Structure Of A Nad-Dependent D-Glycerate Dehydrogenase At 2.4 Angstroms Resolution Length = 320 | Back alignment and structure |
| >pdb|2D0I|A Chain A, Crystal Structure Ph0520 Protein From Pyrococcus Horikoshii Ot3 Length = 333 | Back alignment and structure |
| >pdb|3BA1|A Chain A, Structure Of Hydroxyphenylpyruvate Reductase From Coleus Blu Length = 333 | Back alignment and structure |
| >pdb|4G2N|A Chain A, Crystal Structure Of Putative D-Isomer Specific 2-Hydroxyacid Dehydrogenase, Nad-Binding From Polaromonas Sp. Js6 66 Length = 345 | Back alignment and structure |
| >pdb|2EKL|A Chain A, Structure Of St1218 Protein From Sulfolobus Tokodaii Length = 313 | Back alignment and structure |
| >pdb|3KB6|A Chain A, Crystal Structure Of D-lactate Dehydrogenase From Aquifex Aeolicus Complexed With Nad And Lactic Acid Length = 334 | Back alignment and structure |
| >pdb|1WWK|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 307 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 109 | |||
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 3e-18 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 2e-17 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 7e-17 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 2e-16 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 3e-16 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 1e-15 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 2e-15 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 9e-15 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 2e-14 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 2e-13 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 2e-13 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 8e-13 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 3e-12 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 6e-12 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 2e-11 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 3e-11 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 6e-11 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 2e-10 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 9e-10 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 1e-08 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 7e-08 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 8e-08 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 5e-07 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 7e-07 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 9e-07 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 3e-06 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 1e-05 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 1e-05 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 2e-04 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 2e-04 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 3e-04 |
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Length = 330 | Back alignment and structure |
|---|
Score = 76.4 bits (189), Expect = 3e-18
Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 2/69 (2%)
Query: 3 SRAGENLKVISTFSVGHDHLHLDQIKSRGIRVG-TVGPVSSDAVAEFNIGLAIAVSRRFQ 61
AG NLKVIST SVG DHL LD+IK RGIRVG T V +D AE + L + RR
Sbjct: 71 DAAGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPD-VLTDTTAELAVSLLLTTCRRLP 129
Query: 62 QGHNCIASG 70
+ + +G
Sbjct: 130 EAIEEVKNG 138
|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Length = 320 | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Length = 311 | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Length = 345 | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Length = 334 | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Length = 348 | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Length = 330 | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Length = 333 | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Length = 340 | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Length = 303 | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Length = 393 | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Length = 290 | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Length = 333 | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Length = 333 | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Length = 333 | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Length = 351 | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Length = 331 | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Length = 364 | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Length = 347 | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Length = 307 | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Length = 352 | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Length = 313 | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Length = 380 | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Length = 335 | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Length = 529 | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Length = 324 | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Length = 416 | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Length = 404 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 99.97 | |
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 99.97 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 99.96 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 99.96 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 99.96 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 99.96 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 99.96 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 99.96 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 99.96 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 99.96 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 99.95 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 99.95 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 99.95 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 99.95 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 99.95 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 99.95 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 99.95 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 99.95 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 99.95 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 99.95 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 99.95 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 99.95 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 99.95 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 99.95 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 99.94 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 99.94 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 99.94 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 99.94 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 99.94 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 99.94 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 99.94 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 99.93 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 99.93 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 99.87 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 99.87 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 99.61 | |
| 1v8b_A | 479 | Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 | 99.34 | |
| 3d64_A | 494 | Adenosylhomocysteinase; structural genomics, ssgci | 99.3 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 99.25 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 98.61 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 98.59 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 98.56 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 98.19 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 98.17 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 97.81 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 97.71 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 96.96 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 96.03 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 95.63 | |
| 1gtm_A | 419 | Glutamate dehydrogenase; oxidoreductase, NAD, NADP | 95.37 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 95.03 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 94.14 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 92.99 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 92.41 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 92.3 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 91.75 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 91.14 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 90.67 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 90.55 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 89.42 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 89.05 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 88.34 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 88.15 | |
| 3h9e_O | 346 | Glyceraldehyde-3-phosphate dehydrogenase, testis-; | 87.72 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 87.63 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 87.59 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 87.46 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 87.42 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 87.36 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 87.23 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 87.19 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 86.62 | |
| 3q2o_A | 389 | Phosphoribosylaminoimidazole carboxylase, ATPase; | 86.6 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 86.56 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 86.53 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 86.5 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 85.72 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 85.65 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 85.49 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 85.08 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 85.06 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 84.61 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 84.45 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 84.38 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 83.85 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 83.42 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 82.85 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 82.77 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 82.74 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 82.73 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 82.7 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 82.64 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 82.2 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 81.99 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 81.6 | |
| 3orq_A | 377 | N5-carboxyaminoimidazole ribonucleotide synthetas; | 81.59 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 81.18 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 80.87 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 80.85 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 80.31 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 80.18 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 80.18 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 80.17 | |
| 2we8_A | 386 | Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc | 80.08 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 80.03 |
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 | Back alignment and structure |
|---|
| >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 109 | ||||
| d1dxya2 | 131 | c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproa | 2e-10 | |
| d1mx3a2 | 133 | c.23.12.1 (A:27-125,A:319-352) Transcription corep | 2e-09 | |
| d1gdha2 | 129 | c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrog | 5e-08 | |
| d1j4aa2 | 134 | c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogen | 2e-07 | |
| d2naca2 | 186 | c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenas | 2e-06 | |
| d1ygya2 | 130 | c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehy | 8e-06 | |
| d1qp8a2 | 121 | c.23.12.1 (A:1-82,A:264-302) Putative formate dehy | 6e-04 | |
| d1gdha1 | 191 | c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyp | 0.001 | |
| d1mx3a1 | 193 | c.2.1.4 (A:126-318) Transcription corepressor CtbP | 0.001 | |
| d1dxya1 | 199 | c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydro | 0.002 | |
| d1j4aa1 | 197 | c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lacto | 0.002 | |
| d1qp8a1 | 181 | c.2.1.4 (A:83-263) Putative formate dehydrogenase | 0.004 |
| >d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 131 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Formate/glycerate dehydrogenase catalytic domain-like family: Formate/glycerate dehydrogenases, substrate-binding domain domain: D-2-hydroxyisocaproate dehydrogenase species: Lactobacillus casei [TaxId: 1582]
Score = 51.6 bits (123), Expect = 2e-10
Identities = 12/57 (21%), Positives = 24/57 (42%)
Query: 8 NLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGH 64
+K ++ +VG D++ + +K GIR+ V + AV + +G
Sbjct: 68 GIKFLTIRNVGTDNIDMTAMKQYGIRLSNVPAYTETAVHNMVYFSLQHLVDFLTKGE 124
|
| >d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 129 | Back information, alignment and structure |
|---|
| >d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 134 | Back information, alignment and structure |
|---|
| >d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 186 | Back information, alignment and structure |
|---|
| >d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 130 | Back information, alignment and structure |
|---|
| >d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 121 | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 191 | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 193 | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 199 | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 197 | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 181 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| d1ygya2 | 130 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 99.89 | |
| d1qp8a2 | 121 | Putative formate dehydrogenase {Archaeon Pyrobacul | 99.83 | |
| d1mx3a2 | 133 | Transcription corepressor CtbP {Human (Homo sapien | 99.82 | |
| d1dxya2 | 131 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 99.81 | |
| d2naca2 | 186 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 99.8 | |
| d1sc6a2 | 132 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 99.74 | |
| d1j4aa2 | 134 | D-lactate dehydrogenase {Lactobacillus helveticus | 99.71 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 99.69 | |
| d1gdha2 | 129 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 99.68 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 99.68 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 99.68 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 99.66 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 99.66 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 99.62 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 99.61 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 99.56 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 97.3 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 93.9 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 92.82 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 91.0 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 90.66 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 90.54 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 90.47 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 89.18 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 87.18 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 86.85 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 85.1 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 84.86 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 83.87 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 83.4 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 83.3 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 83.21 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 82.9 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 81.77 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 81.67 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 81.59 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 81.12 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 81.05 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 80.75 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 80.64 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 80.64 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 80.59 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 80.58 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 80.43 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 80.16 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 80.02 |
| >d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: Formate/glycerate dehydrogenase catalytic domain-like family: Formate/glycerate dehydrogenases, substrate-binding domain domain: Phosphoglycerate dehydrogenase species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.89 E-value=2.7e-24 Score=136.29 Aligned_cols=70 Identities=24% Similarity=0.330 Sum_probs=67.0
Q ss_pred cccCCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCC
Q psy15800 2 SSRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTE 72 (109)
Q Consensus 2 l~~~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w 72 (109)
|+ .+|+||+|+..|+|+||||+++|+++||.|+|+||+++.+||||+++++|++.|++..+.+.+++|.|
T Consensus 59 l~-~~p~Lk~I~~~g~G~d~IDl~~~~~~gI~V~n~p~~~~~~VAE~~~~l~L~l~R~i~~a~~~vr~g~~ 128 (130)
T d1ygya2 59 LA-AAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSASTAEAQDRAGTDVAESVRLALAGEFVPDAVN 128 (130)
T ss_dssp HH-TCTTCCEEEESSSCCTTBCHHHHHHTTCEEECCTTSSCBHHHHHHHHHHHHHHHHHHHTTCCCTTBCS
T ss_pred Hh-hcccceEEeeecccccchhHHHHHHCCceEEecCCCCcHHHHHHHHHHHHHHHhhHHHHhhhcccCcc
Confidence 45 68999999999999999999999999999999999999999999999999999999999998888888
|
| >d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|