Psyllid ID: psy15800


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MSSRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELITQSDTNHTQRCLASIMQLVYSTCYNQ
cccccccccEEEEEcccccccccHHHHHHcccEEcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccccccccccccccEEEEEEcccEEEEEccccc
ccHcccccccEEEEEccccccEcHHHHHHcccEEEccccccHHHHHHHHHHHHHHHHccHHHHHHHHHccccccccHHHHHHHcccccccHHHEEEEHHHHHHHccccc
mssragenlKVISTFsvghdhlhldqiksrgirvgtvgpvssdaVAEFNIGLAIAVSRRFqqghnciasgtekSQQHAITELITQSDTNHTQRCLASIMQLVYSTCYNQ
mssragenLKVIstfsvghdhlhldqiksrgiRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELITQSDTNHTQRCLASIMQLVYSTCYNQ
MSSRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELITQSDTNHTQRCLASIMQLVYSTCYNQ
********LKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASG*******AITELITQSDTNHTQRCLASIMQLVYSTCY**
*SS*AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELITQSDTNHTQRCLASIMQLVYS*C***
MSSRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELITQSDTNHTQRCLASIMQLVYSTCYNQ
*****GENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELITQSDTNHTQRCLASIMQLVYSTCYNQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQHAITELITQSDTNHTQRCLASIMQLVYSTCYNQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
Q91Z53 328 Glyoxylate reductase/hydr yes N/A 0.605 0.201 0.5 1e-10
Q9UBQ7 328 Glyoxylate reductase/hydr yes N/A 0.605 0.201 0.5 2e-10
A1RYE4 339 Glyoxylate reductase OS=T yes N/A 0.605 0.194 0.484 3e-10
P36234 322 Glycerate dehydrogenase O N/A N/A 0.788 0.267 0.352 7e-07
Q2FVW4 317 Putative 2-hydroxyacid de yes N/A 0.541 0.186 0.322 0.0001
Q6GEC9 317 Putative 2-hydroxyacid de yes N/A 0.541 0.186 0.322 0.0001
Q5HDQ4 317 Putative 2-hydroxyacid de yes N/A 0.541 0.186 0.322 0.0001
Q2FEI9 317 Putative 2-hydroxyacid de N/A N/A 0.541 0.186 0.322 0.0001
Q8NV80 317 Putative 2-hydroxyacid de yes N/A 0.541 0.186 0.322 0.0001
Q6G716 317 Putative 2-hydroxyacid de yes N/A 0.541 0.186 0.322 0.0001
>sp|Q91Z53|GRHPR_MOUSE Glyoxylate reductase/hydroxypyruvate reductase OS=Mus musculus GN=Grhpr PE=1 SV=1 Back     alignment and function desciption
 Score = 65.1 bits (157), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 33/66 (50%), Positives = 41/66 (62%)

Query: 5   AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGH 64
           AG NL+VIST SVG DHL LD+IK RGIRVG    V +DA AE  + L +   RR  +  
Sbjct: 71  AGANLRVISTLSVGVDHLALDEIKKRGIRVGYTPGVLTDATAELAVSLLLTTCRRLPEAI 130

Query: 65  NCIASG 70
             + +G
Sbjct: 131 EEVKNG 136




Enzyme with hydroxy-pyruvate reductase, glyoxylate reductase and D-glycerate dehydrogenase enzymatic activities. Reduces hydroxypyruvate to D-glycerate, glyoxylate to glycolate oxidizes D-glycerate to hydroxypyruvate.
Mus musculus (taxid: 10090)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 8EC: 1
>sp|Q9UBQ7|GRHPR_HUMAN Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens GN=GRHPR PE=1 SV=1 Back     alignment and function description
>sp|A1RYE4|GYAR_THEPD Glyoxylate reductase OS=Thermofilum pendens (strain Hrk 5) GN=gyaR PE=3 SV=1 Back     alignment and function description
>sp|P36234|DHGY_HYPME Glycerate dehydrogenase OS=Hyphomicrobium methylovorum PE=1 SV=2 Back     alignment and function description
>sp|Q2FVW4|Y2577_STAA8 Putative 2-hydroxyacid dehydrogenase SAOUHSC_02577 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02577 PE=3 SV=1 Back     alignment and function description
>sp|Q6GEC9|Y2389_STAAR Putative 2-hydroxyacid dehydrogenase SAR2389 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2389 PE=3 SV=1 Back     alignment and function description
>sp|Q5HDQ4|Y2296_STAAC Putative 2-hydroxyacid dehydrogenase SACOL2296 OS=Staphylococcus aureus (strain COL) GN=SACOL2296 PE=3 SV=1 Back     alignment and function description
>sp|Q2FEI9|Y2254_STAA3 Putative 2-hydroxyacid dehydrogenase SAUSA300_2254 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2254 PE=3 SV=1 Back     alignment and function description
>sp|Q8NV80|Y2224_STAAW Putative 2-hydroxyacid dehydrogenase MW2224 OS=Staphylococcus aureus (strain MW2) GN=MW2224 PE=3 SV=1 Back     alignment and function description
>sp|Q6G716|Y2196_STAAS Putative 2-hydroxyacid dehydrogenase SAS2196 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2196 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
317575680 327 glyoxylate reductase/hydroxypyruvate red 0.660 0.220 0.513 3e-12
47215537 319 unnamed protein product [Tetraodon nigro 0.660 0.225 0.5 5e-12
392881520 355 glyoxylate reductase/hydroxypyruvate red 0.541 0.166 0.610 6e-12
392883490 355 glyoxylate reductase/hydroxypyruvate red 0.541 0.166 0.610 6e-12
387914882 355 glyoxylate reductase/hydroxypyruvate red 0.541 0.166 0.610 6e-12
66472696 327 glyoxylate reductase/hydroxypyruvate red 0.605 0.201 0.530 8e-12
33468556 327 novel protein similar to human glyoxylat 0.605 0.201 0.530 8e-12
392876574 355 glyoxylate reductase/hydroxypyruvate red 0.541 0.166 0.610 1e-11
225706132 328 Glyoxylate reductase/hydroxypyruvate red 0.605 0.201 0.530 2e-11
348514536 328 PREDICTED: glyoxylate reductase/hydroxyp 0.605 0.201 0.530 6e-11
>gi|317575680|ref|NP_001187384.1| glyoxylate reductase/hydroxypyruvate reductase [Ictalurus punctatus] gi|308322871|gb|ADO28573.1| glyoxylate reductase/hydroxypyruvate reductase [Ictalurus punctatus] Back     alignment and taxonomy information
 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 46/72 (63%)

Query: 5   AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGH 64
           AG NLKVIST SVG DHL +D+IK RGIRVG    V +DA AE  + L +A +RR  +G 
Sbjct: 71  AGPNLKVISTMSVGFDHLAIDEIKKRGIRVGYTPDVLTDATAELTVALLLATARRLPEGI 130

Query: 65  NCIASGTEKSQQ 76
             + SG   S +
Sbjct: 131 QEVKSGGWSSWK 142




Source: Ictalurus punctatus

Species: Ictalurus punctatus

Genus: Ictalurus

Family: Ictaluridae

Order: Siluriformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|47215537|emb|CAG06267.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|392881520|gb|AFM89592.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] Back     alignment and taxonomy information
>gi|392883490|gb|AFM90577.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] Back     alignment and taxonomy information
>gi|387914882|gb|AFK11050.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] gi|392876936|gb|AFM87300.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] gi|392877568|gb|AFM87616.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] gi|392877738|gb|AFM87701.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] gi|392882350|gb|AFM90007.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] Back     alignment and taxonomy information
>gi|66472696|ref|NP_001018361.1| glyoxylate reductase/hydroxypyruvate reductase [Danio rerio] gi|63100524|gb|AAH95040.1| Glyoxylate reductase/hydroxypyruvate reductase [Danio rerio] Back     alignment and taxonomy information
>gi|33468556|emb|CAE30406.1| novel protein similar to human glyoxylate reductase/hydroxypyruvate reductase (GRHPR) [Danio rerio] Back     alignment and taxonomy information
>gi|392876574|gb|AFM87119.1| glyoxylate reductase/hydroxypyruvate reductase [Callorhinchus milii] Back     alignment and taxonomy information
>gi|225706132|gb|ACO08912.1| Glyoxylate reductase/hydroxypyruvate reductase [Osmerus mordax] Back     alignment and taxonomy information
>gi|348514536|ref|XP_003444796.1| PREDICTED: glyoxylate reductase/hydroxypyruvate reductase-like [Oreochromis niloticus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
ZFIN|ZDB-GENE-040724-230 327 grhpra "glyoxylate reductase/h 0.605 0.201 0.530 3.5e-12
UNIPROTKB|F1NX57 345 GRHPR "Uncharacterized protein 0.605 0.191 0.515 4e-11
UNIPROTKB|F1MB84 328 GRHPR "Uncharacterized protein 0.605 0.201 0.515 1.6e-10
UNIPROTKB|Q9UBQ7 328 GRHPR "Glyoxylate reductase/hy 0.605 0.201 0.5 3.5e-10
MGI|MGI:1923488 328 Grhpr "glyoxylate reductase/hy 0.605 0.201 0.5 3.5e-10
UNIPROTKB|Q5T946 395 GRHPR "Glyoxylate reductase/hy 0.605 0.167 0.5 5.4e-10
UNIPROTKB|F1PJS0 328 GRHPR "Uncharacterized protein 0.605 0.201 0.5 5.8e-10
RGD|1308851 328 Grhpr "glyoxylate reductase/hy 0.532 0.176 0.551 5.8e-10
UNIPROTKB|E9PSJ6 335 Grhpr "Protein Grhpr" [Rattus 0.532 0.173 0.551 6.1e-10
UNIPROTKB|D4A6S1 336 Grhpr "Protein Grhpr" [Rattus 0.532 0.172 0.551 6.2e-10
ZFIN|ZDB-GENE-040724-230 grhpra "glyoxylate reductase/hydroxypyruvate reductase a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 168 (64.2 bits), Expect = 3.5e-12, P = 3.5e-12
 Identities = 35/66 (53%), Positives = 44/66 (66%)

Query:     5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGH 64
             AG NLKVIST SVG DHL +D+IK RGIRVG    V +DA AE  + L +A +RR  +G 
Sbjct:    71 AGPNLKVISTLSVGFDHLAIDEIKKRGIRVGYTPDVLTDATAELTVALLLATARRLPEGV 130

Query:    65 NCIASG 70
               + +G
Sbjct:   131 EEVKNG 136




GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0048037 "cofactor binding" evidence=IEA
UNIPROTKB|F1NX57 GRHPR "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MB84 GRHPR "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UBQ7 GRHPR "Glyoxylate reductase/hydroxypyruvate reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1923488 Grhpr "glyoxylate reductase/hydroxypyruvate reductase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5T946 GRHPR "Glyoxylate reductase/hydroxypyruvate reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PJS0 GRHPR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1308851 Grhpr "glyoxylate reductase/hydroxypyruvate reductase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSJ6 Grhpr "Protein Grhpr" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A6S1 Grhpr "Protein Grhpr" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
cd05301 309 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyr 3e-17
pfam00389 312 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxy 6e-16
COG1052 324 COG1052, LdhA, Lactate dehydrogenase and related d 1e-15
cd12156 301 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, 2e-14
cd05198 302 cd05198, formate_dh_like, Formate/glycerate and re 3e-13
cd12172 306 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerat 7e-12
COG0111 324 COG0111, SerA, Phosphoglycerate dehydrogenase and 2e-11
cd12161 315 cd12161, GDH_like_1, Putative glycerate dehydrogen 4e-11
cd12178 317 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 3e-10
cd12175 311 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 4e-10
cd05303 301 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (P 7e-10
cd01619 323 cd01619, LDH_like, D-Lactate and related Dehydroge 7e-10
cd12187 329 cd12187, LDH_like_1, D-Lactate and related Dehydro 6e-09
cd12165 314 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 9e-08
cd12173 304 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, 1e-07
cd12157 318 cd12157, PTDH, Thermostable Phosphite Dehydrogenas 7e-07
cd12168 321 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-l 2e-06
cd12169 308 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerat 2e-06
cd05299 312 cd05299, CtBP_dh, C-terminal binding protein (CtBP 3e-06
PRK13243 333 PRK13243, PRK13243, glyoxylate reductase; Reviewed 3e-06
cd12185 322 cd12185, HGDH_LDH_like, Putative Lactate dehydroge 4e-06
cd12177 321 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2e-05
cd12171 310 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2e-05
cd12183 328 cd12183, LDH_like_2, D-Lactate and related Dehydro 4e-05
cd12186 329 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydr 6e-05
PRK07574 385 PRK07574, PRK07574, formate dehydrogenase; Provisi 7e-05
cd12155 314 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2 3e-04
cd12184 330 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydro 3e-04
cd12162 307 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 4e-04
cd12174 305 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerat 5e-04
cd05302 348 cd05302, FDH, NAD-dependent Formate Dehydrogenase 0.002
TIGR01327 525 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenas 0.003
cd05300 313 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 0.003
>gnl|CDD|240626 cd05301, GDH, D-glycerate dehydrogenase/hydroxypyruvate reductase (GDH) Back     alignment and domain information
 Score = 74.4 bits (184), Expect = 3e-17
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 5   AGENLKVISTFSVGHDHLHLDQIKSRGIRVG-TVGPVSSDAVAEFNIGLAIAVSRRFQQG 63
           A   LKVI+ +SVG+DH+ +D  K+RGI V  T   V +DA A+    L +A +RR  +G
Sbjct: 62  AAPPLKVIANYSVGYDHIDVDAAKARGIPVTNTPD-VLTDATADLAFALLLAAARRVVEG 120

Query: 64  HNCIASG 70
              + +G
Sbjct: 121 DRFVRAG 127


D-glycerate dehydrogenase (GDH, also known as hydroxypyruvate reductase, HPR) catalyzes the reversible reaction of (R)-glycerate + NAD+ to hydroxypyruvate + NADH + H+. In humans, HPR deficiency causes primary hyperoxaluria type 2, characterized by over-excretion of L-glycerate and oxalate in the urine, possibly due to an imbalance in competition with L-lactate dehydrogenase, another formate dehydrogenase (FDH)-like enzyme. GDH, like FDH and other members of the D-specific hydroxyacid dehydrogenase family that also includes L-alanine dehydrogenase and S-adenosylhomocysteine hydrolase, typically have a characteristic arrangement of 2 similar subdomains of the alpha/beta Rossmann-fold NAD+ binding form, despite often low sequence identity. The NAD+ binding domain is inserted within the linear sequence of the mostly N-terminal catalytic domain, which has a similar domain structure to the internal NAD binding domain. Structurally, these domains are connected by extended alpha helices and create a cleft in which NAD is bound, primarily to the C-terminal portion of the 2nd (internal) domain. Some related proteins have similar structural subdomain but with a tandem arrangement of the catalytic and NAD-binding subdomains in the linear sequence. While many members of this family are dimeric, alanine DH is hexameric and phosphoglycerate DH is tetrameric. Length = 309

>gnl|CDD|215893 pfam00389, 2-Hacid_dh, D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain Back     alignment and domain information
>gnl|CDD|223980 COG1052, LdhA, Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|240633 cd12156, HPPR, Hydroxy(phenyl)pyruvate Reductase, D-isomer-specific 2-hydroxyacid-related dehydrogenase Back     alignment and domain information
>gnl|CDD|240622 cd05198, formate_dh_like, Formate/glycerate and related dehydrogenases of the D-specific 2-hydroxy acid dehydrogenase family Back     alignment and domain information
>gnl|CDD|240649 cd12172, PGDH_like_2, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|223189 COG0111, SerA, Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240638 cd12161, GDH_like_1, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family Back     alignment and domain information
>gnl|CDD|240655 cd12178, 2-Hacid_dh_13, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240652 cd12175, 2-Hacid_dh_11, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240628 cd05303, PGDH_2, Phosphoglycerate dehydrogenase (PGDH) NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240620 cd01619, LDH_like, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240663 cd12187, LDH_like_1, D-Lactate and related Dehydrogenase like proteins, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240642 cd12165, 2-Hacid_dh_6, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240650 cd12173, PGDH_4, Phosphoglycerate dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240634 cd12157, PTDH, Thermostable Phosphite Dehydrogenase Back     alignment and domain information
>gnl|CDD|240645 cd12168, Mand_dh_like, D-Mandelate Dehydrogenase-like dehydrogenases Back     alignment and domain information
>gnl|CDD|240646 cd12169, PGDH_like_1, Putative D-3-Phosphoglycerate Dehydrogenases Back     alignment and domain information
>gnl|CDD|240624 cd05299, CtBP_dh, C-terminal binding protein (CtBP), D-isomer-specific 2-hydroxyacid dehydrogenases related repressor Back     alignment and domain information
>gnl|CDD|183914 PRK13243, PRK13243, glyoxylate reductase; Reviewed Back     alignment and domain information
>gnl|CDD|240661 cd12185, HGDH_LDH_like, Putative Lactate dehydrogenase and (R)-2-Hydroxyglutarate Dehydrogenase-like proteins, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240654 cd12177, 2-Hacid_dh_12, Putative D-isomer specific 2-hydroxyacid dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240648 cd12171, 2-Hacid_dh_10, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240659 cd12183, LDH_like_2, D-Lactate and related Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240662 cd12186, LDH, D-Lactate dehydrogenase and D-2-Hydroxyisocaproic acid dehydrogenase (D-HicDH), NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|181041 PRK07574, PRK07574, formate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240632 cd12155, PGDH_1, Phosphoglycerate Dehydrogenase, 2-hydroxyacid dehydrogenase family Back     alignment and domain information
>gnl|CDD|240660 cd12184, HGDH_like, (R)-2-Hydroxyglutarate Dehydrogenase and related dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240639 cd12162, 2-Hacid_dh_4, Putative D-isomer specific 2-hydroxyacid dehydrogenases Back     alignment and domain information
>gnl|CDD|240651 cd12174, PGDH_like_3, Putative D-3-Phosphoglycerate Dehydrogenases, NAD-binding and catalytic domains Back     alignment and domain information
>gnl|CDD|240627 cd05302, FDH, NAD-dependent Formate Dehydrogenase (FDH) Back     alignment and domain information
>gnl|CDD|233358 TIGR01327, PGDH, D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>gnl|CDD|240625 cd05300, 2-Hacid_dh_1, Putative D-isomer specific 2-hydroxyacid dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
COG1052 324 LdhA Lactate dehydrogenase and related dehydrogena 100.0
PRK08410 311 2-hydroxyacid dehydrogenase; Provisional 99.97
COG0111 324 SerA Phosphoglycerate dehydrogenase and related de 99.97
PRK06487 317 glycerate dehydrogenase; Provisional 99.97
PRK15409 323 bifunctional glyoxylate/hydroxypyruvate reductase 99.97
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 99.96
PRK13243 333 glyoxylate reductase; Reviewed 99.96
PRK06932 314 glycerate dehydrogenase; Provisional 99.96
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 99.96
PLN03139 386 formate dehydrogenase; Provisional 99.96
PRK07574 385 formate dehydrogenase; Provisional 99.95
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 99.95
PLN02306 386 hydroxypyruvate reductase 99.95
PLN02928 347 oxidoreductase family protein 99.94
PRK12480 330 D-lactate dehydrogenase; Provisional 99.94
PRK06436 303 glycerate dehydrogenase; Provisional 99.94
PRK08605 332 D-lactate dehydrogenase; Validated 99.93
KOG0069|consensus 336 99.93
KOG0068|consensus 406 99.93
PRK15469 312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 99.9
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 99.9
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 99.88
PF00389133 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydr 99.56
KOG0067|consensus 435 99.45
PF02826 178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 99.38
TIGR02853 287 spore_dpaA dipicolinic acid synthetase, A subunit. 99.12
PTZ00075 476 Adenosylhomocysteinase; Provisional 98.75
PRK08306 296 dipicolinate synthase subunit A; Reviewed 98.13
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 95.98
PRK13403 335 ketol-acid reductoisomerase; Provisional 95.82
PLN02494 477 adenosylhomocysteinase 95.35
PF00670 162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 94.49
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 93.52
cd01075 200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 93.01
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 91.1
COG0027 394 PurT Formate-dependent phosphoribosylglycinamide f 89.55
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 87.19
TIGR02964 246 xanthine_xdhC xanthine dehydrogenase accessory pro 85.61
PRK05479 330 ketol-acid reductoisomerase; Provisional 84.01
PF03720106 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogen 82.94
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 82.82
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 82.69
PLN02712 667 arogenate dehydrogenase 81.76
PLN02256 304 arogenate dehydrogenase 80.87
TIGR02114 227 coaB_strep phosphopantothenate--cysteine ligase, s 80.21
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=1.2e-32  Score=200.36  Aligned_cols=106  Identities=27%  Similarity=0.312  Sum_probs=96.5

Q ss_pred             cccCCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCCCccc----c
Q psy15800          2 SSRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTEKSQQ----H   77 (109)
Q Consensus         2 l~~~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w~~~~----~   77 (109)
                      |+ .+|+||+|++.|+||||||+++++++||.|+|+|++++++||||+++++|++.|++.+.++.+++|+|..+.    .
T Consensus        61 l~-~~p~LKlIa~~~~G~D~vDl~aa~~~gI~Vtnvp~~~t~sVAe~~~aLiLa~~R~~~~~~~~~r~g~w~~~~~~~~~  139 (324)
T COG1052          61 LE-KLPGLKLIATRSAGYDNVDLEAAKERGITVTNVPGYSTEAVAEHAVALILALARRIHEGDRRVREGNWSLSGGPDPL  139 (324)
T ss_pred             HH-hCCCcEEEEEeccccCcccHHHHHHCCcEEEeCCCCCchHHHHHHHHHHHHHhhchHHHHHHHhcCcccccCCcccc
Confidence            44 569999999999999999999999999999999999999999999999999999999999999999997653    2


Q ss_pred             hhhhhc---------cchHHHHHHHHhhcCCEEEEEcccc
Q psy15800         78 AITELI---------TQSDTNHTQRCLASIMQLVYSTCYN  108 (109)
Q Consensus        78 ~~~~l~---------G~IG~~va~~~~~fg~~V~~~~r~~  108 (109)
                      .+.++.         |+||+++|+++++|||+|+||||++
T Consensus       140 ~~~~l~gktvGIiG~GrIG~avA~r~~~Fgm~v~y~~~~~  179 (324)
T COG1052         140 LGFDLRGKTLGIIGLGRIGQAVARRLKGFGMKVLYYDRSP  179 (324)
T ss_pred             cccCCCCCEEEEECCCHHHHHHHHHHhcCCCEEEEECCCC
Confidence            233332         7999999999999999999999986



>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>KOG0069|consensus Back     alignment and domain information
>KOG0068|consensus Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PF00389 2-Hacid_dh: D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain; InterPro: IPR006139 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>KOG0067|consensus Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PF03720 UDPG_MGDP_dh_C: UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain; InterPro: IPR014027 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2gcg_A 330 Ternary Crystal Structure Of Human Glyoxylate Reduc 1e-11
2h1s_A 328 Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE RE 2e-11
1gdh_A 320 Crystal Structure Of A Nad-Dependent D-Glycerate De 5e-08
2d0i_A 333 Crystal Structure Ph0520 Protein From Pyrococcus Ho 1e-07
3ba1_A 333 Structure Of Hydroxyphenylpyruvate Reductase From C 9e-06
4g2n_A 345 Crystal Structure Of Putative D-Isomer Specific 2-H 2e-04
2ekl_A 313 Structure Of St1218 Protein From Sulfolobus Tokodai 2e-04
3kb6_A 334 Crystal Structure Of D-lactate Dehydrogenase From A 3e-04
1wwk_A 307 Crystal Structure Of Phosphoglycerate Dehydrogenase 5e-04
>pdb|2GCG|A Chain A, Ternary Crystal Structure Of Human Glyoxylate ReductaseHYDROXYPYRUVATE REDUCTASE Length = 330 Back     alignment and structure

Iteration: 1

Score = 64.7 bits (156), Expect = 1e-11, Method: Composition-based stats. Identities = 33/66 (50%), Positives = 40/66 (60%) Query: 5 AGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGH 64 AG NLKVIST SVG DHL LD+IK RGIRVG V +D AE + L + RR + Sbjct: 73 AGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAI 132 Query: 65 NCIASG 70 + +G Sbjct: 133 EEVKNG 138
>pdb|2H1S|A Chain A, Crystal Structure Of A GlyoxylateHYDROXYPYRUVATE REDUCTASE FROM HOMO Sapiens Length = 328 Back     alignment and structure
>pdb|1GDH|A Chain A, Crystal Structure Of A Nad-Dependent D-Glycerate Dehydrogenase At 2.4 Angstroms Resolution Length = 320 Back     alignment and structure
>pdb|2D0I|A Chain A, Crystal Structure Ph0520 Protein From Pyrococcus Horikoshii Ot3 Length = 333 Back     alignment and structure
>pdb|3BA1|A Chain A, Structure Of Hydroxyphenylpyruvate Reductase From Coleus Blu Length = 333 Back     alignment and structure
>pdb|4G2N|A Chain A, Crystal Structure Of Putative D-Isomer Specific 2-Hydroxyacid Dehydrogenase, Nad-Binding From Polaromonas Sp. Js6 66 Length = 345 Back     alignment and structure
>pdb|2EKL|A Chain A, Structure Of St1218 Protein From Sulfolobus Tokodaii Length = 313 Back     alignment and structure
>pdb|3KB6|A Chain A, Crystal Structure Of D-lactate Dehydrogenase From Aquifex Aeolicus Complexed With Nad And Lactic Acid Length = 334 Back     alignment and structure
>pdb|1WWK|A Chain A, Crystal Structure Of Phosphoglycerate Dehydrogenase From Pyrococcus Horikoshii Ot3 Length = 307 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 3e-18
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 2e-17
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 7e-17
4g2n_A 345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 2e-16
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 3e-16
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 1e-15
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 2e-15
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 9e-15
4dgs_A 340 Dehydrogenase; structural genomics, PSI-biology, N 2e-14
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 2e-13
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 2e-13
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 8e-13
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, 3e-12
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 6e-12
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 2e-11
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 3e-11
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 6e-11
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 2e-10
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 9e-10
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 1e-08
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 7e-08
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural g 8e-08
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 5e-07
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 7e-07
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 9e-07
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 3e-06
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 1e-05
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 1e-05
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 2e-04
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 2e-04
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 3e-04
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Length = 330 Back     alignment and structure
 Score = 76.4 bits (189), Expect = 3e-18
 Identities = 34/69 (49%), Positives = 41/69 (59%), Gaps = 2/69 (2%)

Query: 3   SRAGENLKVISTFSVGHDHLHLDQIKSRGIRVG-TVGPVSSDAVAEFNIGLAIAVSRRFQ 61
             AG NLKVIST SVG DHL LD+IK RGIRVG T   V +D  AE  + L +   RR  
Sbjct: 71  DAAGANLKVISTMSVGIDHLALDEIKKRGIRVGYTPD-VLTDTTAELAVSLLLTTCRRLP 129

Query: 62  QGHNCIASG 70
           +    + +G
Sbjct: 130 EAIEEVKNG 138


>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Length = 320 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Length = 311 Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Length = 345 Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Length = 334 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Length = 348 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Length = 330 Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Length = 333 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Length = 340 Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Length = 303 Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Length = 393 Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Length = 290 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Length = 333 Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Length = 324 Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Length = 333 Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Length = 333 Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Length = 351 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Length = 331 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Length = 364 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Length = 347 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Length = 307 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Length = 352 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Length = 313 Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Length = 381 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Length = 380 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Length = 335 Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Length = 529 Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Length = 324 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Length = 416 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Length = 404 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.97
3kb6_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 99.97
4g2n_A 345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 99.96
4dgs_A 340 Dehydrogenase; structural genomics, PSI-biology, N 99.96
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 99.96
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 99.96
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 99.96
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 99.96
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 99.96
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural g 99.96
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 99.95
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 99.95
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 99.95
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 99.95
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 99.95
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 99.95
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 99.95
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 99.95
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 99.95
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 99.95
2yq5_A 343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 99.95
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 99.95
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 99.95
4hy3_A 365 Phosphoglycerate oxidoreductase; PSI-biology, stru 99.95
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 99.94
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 99.94
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 99.94
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 99.94
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 99.94
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 99.94
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 99.94
3pp8_A 315 Glyoxylate/hydroxypyruvate reductase A; structural 99.93
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, 99.93
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 99.87
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 99.87
3d4o_A 293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.61
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 99.34
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 99.3
2rir_A 300 Dipicolinate synthase, A chain; structural genomic 99.25
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 98.61
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.59
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 98.56
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.19
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 98.17
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 97.81
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.71
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 96.96
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 96.03
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 95.63
1gtm_A 419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 95.37
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 95.03
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 94.14
3p2y_A 381 Alanine dehydrogenase/pyridine nucleotide transhy; 92.99
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 92.41
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 92.3
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 91.75
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 91.14
2g1u_A 155 Hypothetical protein TM1088A; structural genomics, 90.67
3llv_A 141 Exopolyphosphatase-related protein; NAD(P)-binding 90.55
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 89.42
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 89.05
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 88.34
3qha_A 296 Putative oxidoreductase; seattle structural genomi 88.15
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 87.72
1lss_A 140 TRK system potassium uptake protein TRKA homolog; 87.63
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 87.59
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 87.46
2hmt_A 144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 87.42
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 87.36
2yjz_A 201 Metalloreductase steap4; oxidoreductase, metabolic 87.23
3c85_A 183 Putative glutathione-regulated potassium-efflux S 87.19
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 86.62
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 86.6
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 86.56
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 86.53
4ezb_A 317 Uncharacterized conserved protein; structural geno 86.5
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 85.72
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 85.65
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 85.49
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 85.08
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 85.06
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 84.61
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 84.45
1id1_A 153 Putative potassium channel protein; RCK domain, E. 84.38
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 83.85
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 83.42
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 82.85
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 82.77
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 82.74
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 82.73
1ooe_A 236 Dihydropteridine reductase; structural genomics, P 82.7
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 82.64
1hdo_A 206 Biliverdin IX beta reductase; foetal metabolism, H 82.2
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 81.99
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 81.6
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 81.59
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 81.18
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 80.87
2d5c_A 263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 80.85
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 80.31
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 80.18
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 80.18
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 80.17
2we8_A 386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 80.08
3d7l_A 202 LIN1944 protein; APC89317, structural genomics, PS 80.03
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d1dxya2131 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproa 2e-10
d1mx3a2133 c.23.12.1 (A:27-125,A:319-352) Transcription corep 2e-09
d1gdha2129 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrog 5e-08
d1j4aa2134 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogen 2e-07
d2naca2186 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenas 2e-06
d1ygya2130 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehy 8e-06
d1qp8a2121 c.23.12.1 (A:1-82,A:264-302) Putative formate dehy 6e-04
d1gdha1 191 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyp 0.001
d1mx3a1 193 c.2.1.4 (A:126-318) Transcription corepressor CtbP 0.001
d1dxya1 199 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydro 0.002
d1j4aa1 197 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lacto 0.002
d1qp8a1 181 c.2.1.4 (A:83-263) Putative formate dehydrogenase 0.004
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 131 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: Formate/glycerate dehydrogenases, substrate-binding domain
domain: D-2-hydroxyisocaproate dehydrogenase
species: Lactobacillus casei [TaxId: 1582]
 Score = 51.6 bits (123), Expect = 2e-10
 Identities = 12/57 (21%), Positives = 24/57 (42%)

Query: 8   NLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGH 64
            +K ++  +VG D++ +  +K  GIR+  V   +  AV          +     +G 
Sbjct: 68  GIKFLTIRNVGTDNIDMTAMKQYGIRLSNVPAYTETAVHNMVYFSLQHLVDFLTKGE 124


>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 129 Back     information, alignment and structure
>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 134 Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Length = 186 Back     information, alignment and structure
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 130 Back     information, alignment and structure
>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 121 Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Length = 191 Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Length = 193 Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 199 Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Length = 197 Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 181 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1ygya2130 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.89
d1qp8a2121 Putative formate dehydrogenase {Archaeon Pyrobacul 99.83
d1mx3a2133 Transcription corepressor CtbP {Human (Homo sapien 99.82
d1dxya2131 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.81
d2naca2186 Formate dehydrogenase {Pseudomonas sp., strain 101 99.8
d1sc6a2132 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.74
d1j4aa2134 D-lactate dehydrogenase {Lactobacillus helveticus 99.71
d1ygya1 184 Phosphoglycerate dehydrogenase {Mycobacterium tube 99.69
d1gdha2129 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.68
d1j4aa1 197 D-lactate dehydrogenase {Lactobacillus helveticus 99.68
d1dxya1 199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 99.68
d1mx3a1 193 Transcription corepressor CtbP {Human (Homo sapien 99.66
d1sc6a1 188 Phosphoglycerate dehydrogenase {Escherichia coli [ 99.66
d1qp8a1 181 Putative formate dehydrogenase {Archaeon Pyrobacul 99.62
d1gdha1 191 D-glycerate dehydrogenase {Hyphomicrobium methylov 99.61
d2naca1 188 Formate dehydrogenase {Pseudomonas sp., strain 101 99.56
d1li4a1 163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.3
d1v8ba1 163 S-adenosylhomocystein hydrolase {Plasmodium falcip 93.9
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 92.82
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 91.0
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.66
d1c1da1 201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 90.54
d2pv7a2 152 Prephenate dehydrogenase TyrA {Haemophilus influen 90.47
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 89.18
d1f0ya2 192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 87.18
d1piwa2 168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 86.85
d1wdka3 186 Fatty oxidation complex alpha subunit, middle doma 85.1
d1luaa1 191 Methylene-tetrahydromethanopterin dehydrogenase {M 84.86
d1ooea_ 235 Dihydropteridin reductase (pteridine reductase) {N 83.87
d1e3ja2 170 Ketose reductase (sorbitol dehydrogenase) {Silverl 83.4
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 83.3
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 83.21
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 82.9
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 81.77
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 81.67
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 81.59
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 81.12
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 81.05
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 80.75
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 80.64
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 80.64
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 80.59
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 80.58
d1uzma1 237 beta-keto acyl carrier protein reductase {Mycobact 80.43
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 80.16
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 80.02
>d1ygya2 c.23.12.1 (A:3-98,A:283-316) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: Formate/glycerate dehydrogenase catalytic domain-like
family: Formate/glycerate dehydrogenases, substrate-binding domain
domain: Phosphoglycerate dehydrogenase
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.89  E-value=2.7e-24  Score=136.29  Aligned_cols=70  Identities=24%  Similarity=0.330  Sum_probs=67.0

Q ss_pred             cccCCCCceEEEecCccCCcccHHHHhhcCcEEEecCCCCccchHHHHHHHHHHHhcCchHhHHHHHcCCC
Q psy15800          2 SSRAGENLKVISTFSVGHDHLHLDQIKSRGIRVGTVGPVSSDAVAEFNIGLAIAVSRRFQQGHNCIASGTE   72 (109)
Q Consensus         2 l~~~~p~Lk~i~~~~~G~d~id~~~~~~~gi~v~n~~g~~~~~vAE~~l~~~L~l~R~~~~~~~~~~~g~w   72 (109)
                      |+ .+|+||+|+..|+|+||||+++|+++||.|+|+||+++.+||||+++++|++.|++..+.+.+++|.|
T Consensus        59 l~-~~p~Lk~I~~~g~G~d~IDl~~~~~~gI~V~n~p~~~~~~VAE~~~~l~L~l~R~i~~a~~~vr~g~~  128 (130)
T d1ygya2          59 LA-AAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSASTAEAQDRAGTDVAESVRLALAGEFVPDAVN  128 (130)
T ss_dssp             HH-TCTTCCEEEESSSCCTTBCHHHHHHTTCEEECCTTSSCBHHHHHHHHHHHHHHHHHHHTTCCCTTBCS
T ss_pred             Hh-hcccceEEeeecccccchhHHHHHHCCceEEecCCCCcHHHHHHHHHHHHHHHhhHHHHhhhcccCcc
Confidence            45 68999999999999999999999999999999999999999999999999999999999998888888



>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mx3a2 c.23.12.1 (A:27-125,A:319-352) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1dxya2 c.23.12.1 (A:1-100,A:300-330) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2naca2 c.23.12.1 (A:1-147,A:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1sc6a2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa2 c.23.12.1 (A:2-103,A:301-332) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure