Psyllid ID: psy15816
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 171 | ||||||
| 312381697 | 150 | hypothetical protein AND_05949 [Anophele | 0.713 | 0.813 | 0.577 | 1e-33 | |
| 195437382 | 494 | GK24471 [Drosophila willistoni] gi|19416 | 0.684 | 0.236 | 0.611 | 1e-32 | |
| 189240168 | 472 | PREDICTED: similar to sodium-dependent p | 0.812 | 0.294 | 0.510 | 1e-32 | |
| 270012290 | 471 | hypothetical protein TcasGA2_TC006413 [T | 0.812 | 0.295 | 0.510 | 1e-32 | |
| 157113576 | 527 | sodium-dependent phosphate transporter [ | 0.707 | 0.229 | 0.585 | 6e-32 | |
| 170032365 | 492 | sodium-dependent phosphate transporter [ | 0.707 | 0.245 | 0.588 | 7e-32 | |
| 357620735 | 459 | sodium-dependent phosphate transporter [ | 0.690 | 0.257 | 0.558 | 2e-31 | |
| 194766031 | 501 | GF23558 [Drosophila ananassae] gi|190617 | 0.684 | 0.233 | 0.603 | 3e-31 | |
| 195148128 | 494 | GL18642 [Drosophila persimilis] gi|19410 | 0.684 | 0.236 | 0.587 | 4e-31 | |
| 198474532 | 494 | GA15786 [Drosophila pseudoobscura pseudo | 0.684 | 0.236 | 0.587 | 4e-31 |
| >gi|312381697|gb|EFR27386.1| hypothetical protein AND_05949 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
Score = 147 bits (372), Expect = 1e-33, Method: Compositional matrix adjust.
Identities = 71/123 (57%), Positives = 93/123 (75%), Gaps = 1/123 (0%)
Query: 46 EDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSSHIVGV 105
E+ +AVA+FTL+L NGAVTAGYLGNGLDIAPNFSGTIFG+ANTLSSFGGFVS+++VGV
Sbjct: 15 ENRTWAVAIFTLSLFLNGAVTAGYLGNGLDIAPNFSGTIFGMANTLSSFGGFVSAYMVGV 74
Query: 106 LTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNTPKISDDVELAKKEAEP 165
LT+ + + + WQ VF +L Y VG+ +++ GTG+LQ WN P DD ++ +E P
Sbjct: 75 LTN-ENPKSYAQWQIVFWILAVIYIVGSSAYVLMGTGELQAWNNPPEKDDAKVETEEGVP 133
Query: 166 LKK 168
L +
Sbjct: 134 LNE 136
|
Source: Anopheles darlingi Species: Anopheles darlingi Genus: Anopheles Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195437382|ref|XP_002066619.1| GK24471 [Drosophila willistoni] gi|194162704|gb|EDW77605.1| GK24471 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|189240168|ref|XP_975071.2| PREDICTED: similar to sodium-dependent phosphate transporter [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270012290|gb|EFA08738.1| hypothetical protein TcasGA2_TC006413 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|157113576|ref|XP_001652004.1| sodium-dependent phosphate transporter [Aedes aegypti] gi|108877650|gb|EAT41875.1| AAEL006514-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170032365|ref|XP_001844052.1| sodium-dependent phosphate transporter [Culex quinquefasciatus] gi|167872338|gb|EDS35721.1| sodium-dependent phosphate transporter [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|357620735|gb|EHJ72819.1| sodium-dependent phosphate transporter [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|194766031|ref|XP_001965128.1| GF23558 [Drosophila ananassae] gi|190617738|gb|EDV33262.1| GF23558 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195148128|ref|XP_002015026.1| GL18642 [Drosophila persimilis] gi|194106979|gb|EDW29022.1| GL18642 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|198474532|ref|XP_001356729.2| GA15786 [Drosophila pseudoobscura pseudoobscura] gi|198138431|gb|EAL33794.2| GA15786 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 171 | ||||||
| FB|FBgn0031645 | 493 | CG3036 [Drosophila melanogaste | 0.619 | 0.215 | 0.616 | 6.9e-31 | |
| FB|FBgn0034490 | 465 | CG9864 [Drosophila melanogaste | 0.637 | 0.234 | 0.378 | 3.8e-17 | |
| ZFIN|ZDB-GENE-030616-554 | 584 | slc17a6b "solute carrier famil | 0.637 | 0.186 | 0.339 | 8.7e-14 | |
| UNIPROTKB|Q5ZL94 | 484 | SLC17A5 "Uncharacterized prote | 0.549 | 0.194 | 0.371 | 1.9e-13 | |
| FB|FBgn0031307 | 512 | MFS3 "Major Facilitator Superf | 0.578 | 0.193 | 0.355 | 2.4e-13 | |
| WB|WBGene00008000 | 493 | C38C10.2 [Caenorhabditis elega | 0.695 | 0.241 | 0.330 | 2.8e-13 | |
| UNIPROTKB|A6QLI1 | 582 | SLC17A6 "Vesicular glutamate t | 0.573 | 0.168 | 0.356 | 6.3e-13 | |
| UNIPROTKB|Q9P2U8 | 582 | SLC17A6 "Vesicular glutamate t | 0.573 | 0.168 | 0.356 | 6.3e-13 | |
| UNIPROTKB|F1SFZ2 | 582 | SLC17A6 "Uncharacterized prote | 0.573 | 0.168 | 0.356 | 6.3e-13 | |
| UNIPROTKB|F1PBW6 | 583 | SLC17A6 "Uncharacterized prote | 0.573 | 0.168 | 0.356 | 6.3e-13 |
| FB|FBgn0031645 CG3036 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 340 (124.7 bits), Expect = 6.9e-31, P = 6.9e-31
Identities = 69/112 (61%), Positives = 83/112 (74%)
Query: 47 DPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSSHIVGVL 106
D ++V +F+LAL +GAVTAGYLGNGLDIAPNF GTIFGLANTLSSFGGF+S+ +VG L
Sbjct: 371 DATWSVTIFSLALFAHGAVTAGYLGNGLDIAPNFGGTIFGLANTLSSFGGFLSTSMVGAL 430
Query: 107 TDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNTP----KISD 154
T D+ F WQ VF +L TY A+VF I G+G+LQPWN P +ISD
Sbjct: 431 TYKDQ--SFHSWQIVFWILAATYISAAVVFAILGSGELQPWNNPPERVRISD 480
|
|
| FB|FBgn0034490 CG9864 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030616-554 slc17a6b "solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZL94 SLC17A5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031307 MFS3 "Major Facilitator Superfamily Transporter 3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00008000 C38C10.2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QLI1 SLC17A6 "Vesicular glutamate transporter 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9P2U8 SLC17A6 "Vesicular glutamate transporter 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SFZ2 SLC17A6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PBW6 SLC17A6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 171 | |||
| TIGR00894 | 465 | TIGR00894, 2A0114euk, Na(+)-dependent inorganic ph | 2e-12 |
| >gnl|CDD|129972 TIGR00894, 2A0114euk, Na(+)-dependent inorganic phosphate cotransporter | Back alignment and domain information |
|---|
Score = 63.6 bits (155), Expect = 2e-12
Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 5/112 (4%)
Query: 41 APNFSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSS 100
P S + + TLA + AG L N LD+AP F G I G+ GG ++S
Sbjct: 354 LPYLSAAFYLTIIILTLANAVSSGPLAGVLINSLDLAPRFLGFIKGITGLPGFIGGLIAS 413
Query: 101 HIVG-VLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNTPK 151
+ G +L+ K W VF+++ + I +LIFG+ + Q W +
Sbjct: 414 TLAGNILSQDSK----NVWLIVFLIMAFVNILCVIFYLIFGSAERQDWAKEE 461
|
[Transport and binding proteins, Anions]. Length = 465 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| KOG2532|consensus | 466 | 99.85 | ||
| TIGR00894 | 465 | 2A0114euk Na(+)-dependent inorganic phosphate cotr | 99.38 | |
| COG2271 | 448 | UhpC Sugar phosphate permease [Carbohydrate transp | 98.39 | |
| PLN00028 | 476 | nitrate transmembrane transporter; Provisional | 98.16 | |
| PF07690 | 352 | MFS_1: Major Facilitator Superfamily; InterPro: IP | 98.14 | |
| TIGR00900 | 365 | 2A0121 H+ Antiporter protein. | 97.99 | |
| PRK11663 | 434 | regulatory protein UhpC; Provisional | 97.99 | |
| TIGR00881 | 379 | 2A0104 phosphoglycerate transporter family protein | 97.98 | |
| TIGR00893 | 399 | 2A0114 d-galactonate transporter. | 97.97 | |
| PRK09556 | 467 | uhpT sugar phosphate antiporter; Reviewed | 97.91 | |
| TIGR00880 | 141 | 2_A_01_02 Multidrug resistance protein. | 97.85 | |
| TIGR02332 | 412 | HpaX 4-hydroxyphenylacetate permease. This protein | 97.79 | |
| PRK03699 | 394 | putative transporter; Provisional | 97.75 | |
| PRK11010 | 491 | ampG muropeptide transporter; Validated | 97.75 | |
| TIGR01299 | 742 | synapt_SV2 synaptic vesicle protein SV2. This mode | 97.73 | |
| TIGR00892 | 455 | 2A0113 monocarboxylate transporter 1. | 97.72 | |
| TIGR00895 | 398 | 2A0115 benzoate transport. | 97.72 | |
| TIGR00893 | 399 | 2A0114 d-galactonate transporter. | 97.69 | |
| TIGR00894 | 465 | 2A0114euk Na(+)-dependent inorganic phosphate cotr | 97.69 | |
| PRK09874 | 408 | drug efflux system protein MdtG; Provisional | 97.68 | |
| TIGR00712 | 438 | glpT glycerol-3-phosphate transporter. This model | 97.67 | |
| PRK09952 | 438 | shikimate transporter; Provisional | 97.63 | |
| PRK10473 | 392 | multidrug efflux system protein MdtL; Provisional | 97.63 | |
| PRK10054 | 395 | putative transporter; Provisional | 97.63 | |
| TIGR00891 | 405 | 2A0112 putative sialic acid transporter. | 97.62 | |
| TIGR00710 | 385 | efflux_Bcr_CflA drug resistance transporter, Bcr/C | 97.61 | |
| PRK09705 | 393 | cynX putative cyanate transporter; Provisional | 97.61 | |
| PRK11102 | 377 | bicyclomycin/multidrug efflux system; Provisional | 97.58 | |
| PRK05122 | 399 | major facilitator superfamily transporter; Provisi | 97.55 | |
| PRK10642 | 490 | proline/glycine betaine transporter; Provisional | 97.52 | |
| PRK11551 | 406 | putative 3-hydroxyphenylpropionic transporter MhpT | 97.51 | |
| KOG2504|consensus | 509 | 97.51 | ||
| PRK09874 | 408 | drug efflux system protein MdtG; Provisional | 97.51 | |
| TIGR00903 | 368 | 2A0129 major facilitator 4 family protein. This fa | 97.5 | |
| TIGR00890 | 377 | 2A0111 Oxalate/Formate Antiporter. | 97.49 | |
| TIGR00924 | 475 | yjdL_sub1_fam amino acid/peptide transporter (Pept | 97.48 | |
| TIGR00899 | 375 | 2A0120 sugar efflux transporter. This family of pr | 97.48 | |
| PRK15011 | 393 | sugar efflux transporter B; Provisional | 97.45 | |
| PRK11551 | 406 | putative 3-hydroxyphenylpropionic transporter MhpT | 97.45 | |
| KOG2532|consensus | 466 | 97.39 | ||
| TIGR00889 | 418 | 2A0110 nucleoside transporter. This family of prot | 97.37 | |
| TIGR00879 | 481 | SP MFS transporter, sugar porter (SP) family. This | 97.36 | |
| PRK11663 | 434 | regulatory protein UhpC; Provisional | 97.35 | |
| PRK15403 | 413 | multidrug efflux system protein MdtM; Provisional | 97.34 | |
| PRK10489 | 417 | enterobactin exporter EntS; Provisional | 97.34 | |
| PRK15462 | 493 | dipeptide/tripeptide permease D; Provisional | 97.33 | |
| TIGR00711 | 485 | efflux_EmrB drug resistance transporter, EmrB/QacA | 97.33 | |
| PRK11646 | 400 | multidrug resistance protein MdtH; Provisional | 97.31 | |
| PRK03545 | 390 | putative arabinose transporter; Provisional | 97.31 | |
| cd06174 | 352 | MFS The Major Facilitator Superfamily (MFS) is a l | 97.31 | |
| TIGR00898 | 505 | 2A0119 cation transport protein. | 97.3 | |
| TIGR00896 | 355 | CynX cyanate transporter. This family of proteins | 97.3 | |
| TIGR00879 | 481 | SP MFS transporter, sugar porter (SP) family. This | 97.28 | |
| PRK12382 | 392 | putative transporter; Provisional | 97.27 | |
| PRK03545 | 390 | putative arabinose transporter; Provisional | 97.25 | |
| PRK09705 | 393 | cynX putative cyanate transporter; Provisional | 97.25 | |
| PRK03893 | 496 | putative sialic acid transporter; Provisional | 97.24 | |
| PRK11273 | 452 | glpT sn-glycerol-3-phosphate transporter; Provisio | 97.23 | |
| PRK10213 | 394 | nepI ribonucleoside transporter; Reviewed | 97.23 | |
| PRK10504 | 471 | putative transporter; Provisional | 97.23 | |
| PRK14995 | 495 | methyl viologen resistance protein SmvA; Provision | 97.23 | |
| PLN00028 | 476 | nitrate transmembrane transporter; Provisional | 97.19 | |
| PRK15402 | 406 | multidrug efflux system translocase MdfA; Provisio | 97.18 | |
| TIGR02332 | 412 | HpaX 4-hydroxyphenylacetate permease. This protein | 97.17 | |
| PRK09528 | 420 | lacY galactoside permease; Reviewed | 97.16 | |
| TIGR00887 | 502 | 2A0109 phosphate:H+ symporter. This model represen | 97.16 | |
| PRK12307 | 426 | putative sialic acid transporter; Provisional | 97.14 | |
| TIGR00901 | 356 | 2A0125 AmpG-related permease. | 97.13 | |
| TIGR00887 | 502 | 2A0109 phosphate:H+ symporter. This model represen | 97.13 | |
| TIGR00899 | 375 | 2A0120 sugar efflux transporter. This family of pr | 97.13 | |
| COG2223 | 417 | NarK Nitrate/nitrite transporter [Inorganic ion tr | 97.12 | |
| TIGR00898 | 505 | 2A0119 cation transport protein. | 97.12 | |
| PRK11043 | 401 | putative transporter; Provisional | 97.12 | |
| PRK03893 | 496 | putative sialic acid transporter; Provisional | 97.11 | |
| PRK11273 | 452 | glpT sn-glycerol-3-phosphate transporter; Provisio | 97.1 | |
| PRK10406 | 432 | alpha-ketoglutarate transporter; Provisional | 97.07 | |
| TIGR00903 | 368 | 2A0129 major facilitator 4 family protein. This fa | 97.04 | |
| TIGR01299 | 742 | synapt_SV2 synaptic vesicle protein SV2. This mode | 97.03 | |
| TIGR00886 | 366 | 2A0108 nitrite extrusion protein (nitrite facilita | 97.03 | |
| KOG2533|consensus | 495 | 97.03 | ||
| PRK10077 | 479 | xylE D-xylose transporter XylE; Provisional | 97.03 | |
| KOG4686|consensus | 459 | 97.0 | ||
| TIGR00890 | 377 | 2A0111 Oxalate/Formate Antiporter. | 97.0 | |
| TIGR00897 | 402 | 2A0118 polyol permease family. This family of prot | 96.97 | |
| cd06174 | 352 | MFS The Major Facilitator Superfamily (MFS) is a l | 96.93 | |
| TIGR00892 | 455 | 2A0113 monocarboxylate transporter 1. | 96.93 | |
| PRK15034 | 462 | nitrate/nitrite transport protein NarU; Provisiona | 96.93 | |
| PRK09584 | 500 | tppB putative tripeptide transporter permease; Rev | 96.92 | |
| PRK09556 | 467 | uhpT sugar phosphate antiporter; Reviewed | 96.92 | |
| PRK10207 | 489 | dipeptide/tripeptide permease B; Provisional | 96.91 | |
| PRK10091 | 382 | MFS transport protein AraJ; Provisional | 96.9 | |
| PRK11652 | 394 | emrD multidrug resistance protein D; Provisional | 96.88 | |
| PRK03633 | 381 | putative MFS family transporter protein; Provision | 96.87 | |
| PRK11902 | 402 | ampG muropeptide transporter; Reviewed | 96.86 | |
| PRK03699 | 394 | putative transporter; Provisional | 96.8 | |
| PRK10489 | 417 | enterobactin exporter EntS; Provisional | 96.76 | |
| TIGR00885 | 410 | fucP L-fucose:H+ symporter permease. This family d | 96.71 | |
| PRK15011 | 393 | sugar efflux transporter B; Provisional | 96.62 | |
| PF06609 | 599 | TRI12: Fungal trichothecene efflux pump (TRI12); I | 96.58 | |
| PRK09528 | 420 | lacY galactoside permease; Reviewed | 96.58 | |
| PRK10054 | 395 | putative transporter; Provisional | 96.58 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 96.57 | |
| TIGR00882 | 396 | 2A0105 oligosaccharide:H+ symporter. | 96.51 | |
| TIGR00891 | 405 | 2A0112 putative sialic acid transporter. | 96.51 | |
| PF05977 | 524 | MFS_3: Transmembrane secretion effector; InterPro: | 96.47 | |
| PRK10642 | 490 | proline/glycine betaine transporter; Provisional | 96.46 | |
| KOG0255|consensus | 521 | 96.46 | ||
| PRK10077 | 479 | xylE D-xylose transporter XylE; Provisional | 96.44 | |
| KOG0252|consensus | 538 | 96.4 | ||
| PTZ00207 | 591 | hypothetical protein; Provisional | 96.39 | |
| COG2814 | 394 | AraJ Arabinose efflux permease [Carbohydrate trans | 96.39 | |
| TIGR01272 | 310 | gluP glucose/galactose transporter. Disruption of | 96.38 | |
| PRK12307 | 426 | putative sialic acid transporter; Provisional | 96.34 | |
| TIGR01301 | 477 | GPH_sucrose GPH family sucrose/H+ symporter. This | 96.32 | |
| PRK09952 | 438 | shikimate transporter; Provisional | 96.3 | |
| TIGR00897 | 402 | 2A0118 polyol permease family. This family of prot | 96.3 | |
| PRK11646 | 400 | multidrug resistance protein MdtH; Provisional | 96.28 | |
| PRK10091 | 382 | MFS transport protein AraJ; Provisional | 96.27 | |
| COG2271 | 448 | UhpC Sugar phosphate permease [Carbohydrate transp | 96.23 | |
| PRK11010 | 491 | ampG muropeptide transporter; Validated | 96.16 | |
| TIGR00883 | 394 | 2A0106 metabolite-proton symporter. This model rep | 96.07 | |
| TIGR00792 | 437 | gph sugar (Glycoside-Pentoside-Hexuronide) transpo | 96.06 | |
| KOG2615|consensus | 451 | 96.04 | ||
| PF13347 | 428 | MFS_2: MFS/sugar transport protein | 96.04 | |
| PRK10406 | 432 | alpha-ketoglutarate transporter; Provisional | 96.0 | |
| PF03825 | 400 | Nuc_H_symport: Nucleoside H+ symporter | 95.99 | |
| PRK11195 | 393 | lysophospholipid transporter LplT; Provisional | 95.99 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 95.96 | |
| TIGR00712 | 438 | glpT glycerol-3-phosphate transporter. This model | 95.85 | |
| PF11700 | 477 | ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 | 95.78 | |
| TIGR02718 | 390 | sider_RhtX_FptX siderophore transporter, RhtX/FptX | 95.77 | |
| PRK11195 | 393 | lysophospholipid transporter LplT; Provisional | 95.7 | |
| TIGR00882 | 396 | 2A0105 oligosaccharide:H+ symporter. | 95.7 | |
| TIGR00902 | 382 | 2A0127 phenyl proprionate permease family protein. | 95.41 | |
| TIGR00792 | 437 | gph sugar (Glycoside-Pentoside-Hexuronide) transpo | 95.41 | |
| PRK10133 | 438 | L-fucose transporter; Provisional | 95.41 | |
| TIGR00805 | 633 | oat sodium-independent organic anion transporter. | 95.39 | |
| TIGR01272 | 310 | gluP glucose/galactose transporter. Disruption of | 95.35 | |
| PRK11128 | 382 | putative 3-phenylpropionic acid transporter; Provi | 95.31 | |
| PRK11043 | 401 | putative transporter; Provisional | 95.21 | |
| PRK12382 | 392 | putative transporter; Provisional | 95.17 | |
| PRK15075 | 434 | citrate-proton symporter; Provisional | 95.17 | |
| TIGR00895 | 398 | 2A0115 benzoate transport. | 95.16 | |
| KOG1330|consensus | 493 | 95.09 | ||
| TIGR00883 | 394 | 2A0106 metabolite-proton symporter. This model rep | 94.95 | |
| COG2814 | 394 | AraJ Arabinose efflux permease [Carbohydrate trans | 94.89 | |
| KOG3764|consensus | 464 | 94.84 | ||
| PRK10504 | 471 | putative transporter; Provisional | 94.82 | |
| PRK15075 | 434 | citrate-proton symporter; Provisional | 94.76 | |
| TIGR00900 | 365 | 2A0121 H+ Antiporter protein. | 94.73 | |
| PRK11902 | 402 | ampG muropeptide transporter; Reviewed | 94.65 | |
| PRK05122 | 399 | major facilitator superfamily transporter; Provisi | 94.57 | |
| PRK15402 | 406 | multidrug efflux system translocase MdfA; Provisio | 94.46 | |
| KOG0569|consensus | 485 | 94.4 | ||
| PRK11652 | 394 | emrD multidrug resistance protein D; Provisional | 94.39 | |
| KOG0253|consensus | 528 | 94.24 | ||
| TIGR00881 | 379 | 2A0104 phosphoglycerate transporter family protein | 94.0 | |
| PRK10429 | 473 | melibiose:sodium symporter; Provisional | 93.89 | |
| TIGR00788 | 468 | fbt folate/biopterin transporter. The only functio | 93.85 | |
| COG0738 | 422 | FucP Fucose permease [Carbohydrate transport and m | 93.85 | |
| PRK08633 | 1146 | 2-acyl-glycerophospho-ethanolamine acyltransferase | 93.83 | |
| KOG2504|consensus | 509 | 93.81 | ||
| PRK03633 | 381 | putative MFS family transporter protein; Provision | 93.79 | |
| PRK15034 | 462 | nitrate/nitrite transport protein NarU; Provisiona | 93.58 | |
| PRK06814 | 1140 | acylglycerophosphoethanolamine acyltransferase; Pr | 93.43 | |
| PF05977 | 524 | MFS_3: Transmembrane secretion effector; InterPro: | 93.33 | |
| TIGR00769 | 472 | AAA ADP/ATP carrier protein family. These proteins | 93.19 | |
| TIGR02718 | 390 | sider_RhtX_FptX siderophore transporter, RhtX/FptX | 93.17 | |
| PF00854 | 372 | PTR2: POT family; InterPro: IPR000109 This entry r | 93.11 | |
| COG2223 | 417 | NarK Nitrate/nitrite transporter [Inorganic ion tr | 92.94 | |
| PRK09669 | 444 | putative symporter YagG; Provisional | 92.81 | |
| TIGR00896 | 355 | CynX cyanate transporter. This family of proteins | 92.81 | |
| TIGR00902 | 382 | 2A0127 phenyl proprionate permease family protein. | 92.74 | |
| PRK11102 | 377 | bicyclomycin/multidrug efflux system; Provisional | 92.7 | |
| PRK10213 | 394 | nepI ribonucleoside transporter; Reviewed | 92.52 | |
| TIGR00806 | 511 | rfc RFC reduced folate carrier. Proteins of the RF | 92.32 | |
| TIGR00710 | 385 | efflux_Bcr_CflA drug resistance transporter, Bcr/C | 92.13 | |
| PRK11128 | 382 | putative 3-phenylpropionic acid transporter; Provi | 91.98 | |
| COG2807 | 395 | CynX Cyanate permease [Inorganic ion transport and | 91.94 | |
| TIGR00885 | 410 | fucP L-fucose:H+ symporter permease. This family d | 91.9 | |
| COG2270 | 438 | Permeases of the major facilitator superfamily [Ge | 91.79 | |
| TIGR00924 | 475 | yjdL_sub1_fam amino acid/peptide transporter (Pept | 91.55 | |
| PRK10429 | 473 | melibiose:sodium symporter; Provisional | 91.54 | |
| PRK10133 | 438 | L-fucose transporter; Provisional | 91.48 | |
| PF11700 | 477 | ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 | 91.13 | |
| KOG0255|consensus | 521 | 90.9 | ||
| PRK10473 | 392 | multidrug efflux system protein MdtL; Provisional | 90.12 | |
| COG3104 | 498 | PTR2 Dipeptide/tripeptide permease [Amino acid tra | 89.62 | |
| PF07690 | 352 | MFS_1: Major Facilitator Superfamily; InterPro: IP | 89.61 | |
| PF03092 | 433 | BT1: BT1 family; InterPro: IPR004324 Members of th | 89.57 | |
| PRK10207 | 489 | dipeptide/tripeptide permease B; Provisional | 89.56 | |
| PF01306 | 412 | LacY_symp: LacY proton/sugar symporter; InterPro: | 88.81 | |
| KOG0254|consensus | 513 | 88.59 | ||
| PF03219 | 491 | TLC: TLC ATP/ADP transporter; InterPro: IPR004667 | 88.42 | |
| TIGR00788 | 468 | fbt folate/biopterin transporter. The only functio | 88.21 | |
| PF01770 | 412 | Folate_carrier: Reduced folate carrier; InterPro: | 88.04 | |
| KOG2816|consensus | 463 | 88.03 | ||
| TIGR00886 | 366 | 2A0108 nitrite extrusion protein (nitrite facilita | 86.94 | |
| TIGR00711 | 485 | efflux_EmrB drug resistance transporter, EmrB/QacA | 86.51 | |
| PRK11462 | 460 | putative transporter; Provisional | 85.82 | |
| COG2807 | 395 | CynX Cyanate permease [Inorganic ion transport and | 85.62 | |
| PF06813 | 250 | Nodulin-like: Nodulin-like; InterPro: IPR010658 Th | 85.22 | |
| PRK09848 | 448 | glucuronide transporter; Provisional | 85.1 | |
| PF00083 | 451 | Sugar_tr: Sugar (and other) transporter; InterPro: | 84.91 | |
| TIGR00926 | 654 | 2A1704 Peptide:H+ symporter (also transports b-lac | 84.71 | |
| PF06609 | 599 | TRI12: Fungal trichothecene efflux pump (TRI12); I | 82.68 | |
| PRK09669 | 444 | putative symporter YagG; Provisional | 82.29 | |
| PF03209 | 403 | PUCC: PUCC protein; InterPro: IPR004896 This prote | 81.33 | |
| PRK14995 | 495 | methyl viologen resistance protein SmvA; Provision | 80.74 |
| >KOG2532|consensus | Back alignment and domain information |
|---|
Probab=99.85 E-value=2.5e-21 Score=168.62 Aligned_cols=134 Identities=25% Similarity=0.550 Sum_probs=120.4
Q ss_pred HHHHHHHHHHHHHhhHHHHhhh--hccCCc-chHHHHHHHHHHHHhhhhcchhhhhhhhccccchHHHHHHHHHHHHhhh
Q psy15816 19 FTLALTFNGAVTAGYLGNGLDI--APNFSE-DPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFG 95 (171)
Q Consensus 19 l~l~~ark~~~~~G~~~~~l~l--~~~~~~-~~~~av~ll~la~~~~~~~~~g~~~~~~diap~~ag~v~gi~n~~g~l~ 95 (171)
++.+..||.++++++.++++.+ +++..+ +...++++++++.++.|++.+|+..+++|.+|||+|+++|+.|+.++++
T Consensus 326 ls~t~~rkifn~i~~~~~ai~l~~l~~~~~~~~~~a~~~l~~~~~~~g~~~~Gf~~~~~~~apq~a~~l~g~~~~~~~~~ 405 (466)
T KOG2532|consen 326 LSETTVRKIFNTIAFGGPAVFLLVLAFTSDEHRLLAVILLTIAIGLSGFNISGFYKNHQDIAPQHAGFVMGIINFVGALA 405 (466)
T ss_pred CchHhHHHHHHhHHHHHHHHHHHeeeecCCCcchHHHHHHHHHHHHcccchhhhHhhhhhccchHHHHHHHHHHHHHHHH
Confidence 6788899999999999999765 455544 4468999999999999999999999999999999999999999999999
Q ss_pred hhhhhhhhheeecCCCccccCChhHHHHHHHHHHHHHHHhhhheecccccCCCCCCCCcc
Q psy15816 96 GFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNTPKISDD 155 (171)
Q Consensus 96 gii~p~i~G~iv~~~~~~~~~~w~~vF~i~a~i~~~g~i~~~~~~~~e~q~w~~~~~~~~ 155 (171)
++++|.++|.+++++ +.++|+.+|.+.++++++++++|.+++++|+|+|++++++++
T Consensus 406 ~~~~P~~vg~~~~~~---t~~eW~~VF~i~a~i~~~~~i~f~~f~s~e~~~w~~~~~~~~ 462 (466)
T KOG2532|consen 406 GFIAPLLVGIIVTDN---TREEWRIVFLIAAGILIVGNIIFLFFGSGEPAPWTKSEEKEE 462 (466)
T ss_pred HHHHHHheeeEeCCC---CHHHHHHHHHHHHHHHHHhchheeEeecCcccCccCCccccc
Confidence 999999999999743 567999999999999999999999999999999999655433
|
|
| >TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter | Back alignment and domain information |
|---|
| >COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00028 nitrate transmembrane transporter; Provisional | Back alignment and domain information |
|---|
| >PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms | Back alignment and domain information |
|---|
| >TIGR00900 2A0121 H+ Antiporter protein | Back alignment and domain information |
|---|
| >PRK11663 regulatory protein UhpC; Provisional | Back alignment and domain information |
|---|
| >TIGR00881 2A0104 phosphoglycerate transporter family protein | Back alignment and domain information |
|---|
| >TIGR00893 2A0114 d-galactonate transporter | Back alignment and domain information |
|---|
| >PRK09556 uhpT sugar phosphate antiporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR00880 2_A_01_02 Multidrug resistance protein | Back alignment and domain information |
|---|
| >TIGR02332 HpaX 4-hydroxyphenylacetate permease | Back alignment and domain information |
|---|
| >PRK03699 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11010 ampG muropeptide transporter; Validated | Back alignment and domain information |
|---|
| >TIGR01299 synapt_SV2 synaptic vesicle protein SV2 | Back alignment and domain information |
|---|
| >TIGR00892 2A0113 monocarboxylate transporter 1 | Back alignment and domain information |
|---|
| >TIGR00895 2A0115 benzoate transport | Back alignment and domain information |
|---|
| >TIGR00893 2A0114 d-galactonate transporter | Back alignment and domain information |
|---|
| >TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter | Back alignment and domain information |
|---|
| >PRK09874 drug efflux system protein MdtG; Provisional | Back alignment and domain information |
|---|
| >TIGR00712 glpT glycerol-3-phosphate transporter | Back alignment and domain information |
|---|
| >PRK09952 shikimate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10473 multidrug efflux system protein MdtL; Provisional | Back alignment and domain information |
|---|
| >PRK10054 putative transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00891 2A0112 putative sialic acid transporter | Back alignment and domain information |
|---|
| >TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily | Back alignment and domain information |
|---|
| >PRK09705 cynX putative cyanate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11102 bicyclomycin/multidrug efflux system; Provisional | Back alignment and domain information |
|---|
| >PRK05122 major facilitator superfamily transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10642 proline/glycine betaine transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional | Back alignment and domain information |
|---|
| >KOG2504|consensus | Back alignment and domain information |
|---|
| >PRK09874 drug efflux system protein MdtG; Provisional | Back alignment and domain information |
|---|
| >TIGR00903 2A0129 major facilitator 4 family protein | Back alignment and domain information |
|---|
| >TIGR00890 2A0111 Oxalate/Formate Antiporter | Back alignment and domain information |
|---|
| >TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial | Back alignment and domain information |
|---|
| >TIGR00899 2A0120 sugar efflux transporter | Back alignment and domain information |
|---|
| >PRK15011 sugar efflux transporter B; Provisional | Back alignment and domain information |
|---|
| >PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional | Back alignment and domain information |
|---|
| >KOG2532|consensus | Back alignment and domain information |
|---|
| >TIGR00889 2A0110 nucleoside transporter | Back alignment and domain information |
|---|
| >TIGR00879 SP MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
| >PRK11663 regulatory protein UhpC; Provisional | Back alignment and domain information |
|---|
| >PRK15403 multidrug efflux system protein MdtM; Provisional | Back alignment and domain information |
|---|
| >PRK10489 enterobactin exporter EntS; Provisional | Back alignment and domain information |
|---|
| >PRK15462 dipeptide/tripeptide permease D; Provisional | Back alignment and domain information |
|---|
| >TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily | Back alignment and domain information |
|---|
| >PRK11646 multidrug resistance protein MdtH; Provisional | Back alignment and domain information |
|---|
| >PRK03545 putative arabinose transporter; Provisional | Back alignment and domain information |
|---|
| >cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >TIGR00898 2A0119 cation transport protein | Back alignment and domain information |
|---|
| >TIGR00896 CynX cyanate transporter | Back alignment and domain information |
|---|
| >TIGR00879 SP MFS transporter, sugar porter (SP) family | Back alignment and domain information |
|---|
| >PRK12382 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK03545 putative arabinose transporter; Provisional | Back alignment and domain information |
|---|
| >PRK09705 cynX putative cyanate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK03893 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10213 nepI ribonucleoside transporter; Reviewed | Back alignment and domain information |
|---|
| >PRK10504 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK14995 methyl viologen resistance protein SmvA; Provisional | Back alignment and domain information |
|---|
| >PLN00028 nitrate transmembrane transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15402 multidrug efflux system translocase MdfA; Provisional | Back alignment and domain information |
|---|
| >TIGR02332 HpaX 4-hydroxyphenylacetate permease | Back alignment and domain information |
|---|
| >PRK09528 lacY galactoside permease; Reviewed | Back alignment and domain information |
|---|
| >TIGR00887 2A0109 phosphate:H+ symporter | Back alignment and domain information |
|---|
| >PRK12307 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00901 2A0125 AmpG-related permease | Back alignment and domain information |
|---|
| >TIGR00887 2A0109 phosphate:H+ symporter | Back alignment and domain information |
|---|
| >TIGR00899 2A0120 sugar efflux transporter | Back alignment and domain information |
|---|
| >COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00898 2A0119 cation transport protein | Back alignment and domain information |
|---|
| >PRK11043 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK03893 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10406 alpha-ketoglutarate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00903 2A0129 major facilitator 4 family protein | Back alignment and domain information |
|---|
| >TIGR01299 synapt_SV2 synaptic vesicle protein SV2 | Back alignment and domain information |
|---|
| >TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) | Back alignment and domain information |
|---|
| >KOG2533|consensus | Back alignment and domain information |
|---|
| >PRK10077 xylE D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
| >KOG4686|consensus | Back alignment and domain information |
|---|
| >TIGR00890 2A0111 Oxalate/Formate Antiporter | Back alignment and domain information |
|---|
| >TIGR00897 2A0118 polyol permease family | Back alignment and domain information |
|---|
| >cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters | Back alignment and domain information |
|---|
| >TIGR00892 2A0113 monocarboxylate transporter 1 | Back alignment and domain information |
|---|
| >PRK15034 nitrate/nitrite transport protein NarU; Provisional | Back alignment and domain information |
|---|
| >PRK09584 tppB putative tripeptide transporter permease; Reviewed | Back alignment and domain information |
|---|
| >PRK09556 uhpT sugar phosphate antiporter; Reviewed | Back alignment and domain information |
|---|
| >PRK10207 dipeptide/tripeptide permease B; Provisional | Back alignment and domain information |
|---|
| >PRK10091 MFS transport protein AraJ; Provisional | Back alignment and domain information |
|---|
| >PRK11652 emrD multidrug resistance protein D; Provisional | Back alignment and domain information |
|---|
| >PRK03633 putative MFS family transporter protein; Provisional | Back alignment and domain information |
|---|
| >PRK11902 ampG muropeptide transporter; Reviewed | Back alignment and domain information |
|---|
| >PRK03699 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK10489 enterobactin exporter EntS; Provisional | Back alignment and domain information |
|---|
| >TIGR00885 fucP L-fucose:H+ symporter permease | Back alignment and domain information |
|---|
| >PRK15011 sugar efflux transporter B; Provisional | Back alignment and domain information |
|---|
| >PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins | Back alignment and domain information |
|---|
| >PRK09528 lacY galactoside permease; Reviewed | Back alignment and domain information |
|---|
| >PRK10054 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00882 2A0105 oligosaccharide:H+ symporter | Back alignment and domain information |
|---|
| >TIGR00891 2A0112 putative sialic acid transporter | Back alignment and domain information |
|---|
| >PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily | Back alignment and domain information |
|---|
| >PRK10642 proline/glycine betaine transporter; Provisional | Back alignment and domain information |
|---|
| >KOG0255|consensus | Back alignment and domain information |
|---|
| >PRK10077 xylE D-xylose transporter XylE; Provisional | Back alignment and domain information |
|---|
| >KOG0252|consensus | Back alignment and domain information |
|---|
| >PTZ00207 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01272 gluP glucose/galactose transporter | Back alignment and domain information |
|---|
| >PRK12307 putative sialic acid transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter | Back alignment and domain information |
|---|
| >PRK09952 shikimate transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00897 2A0118 polyol permease family | Back alignment and domain information |
|---|
| >PRK11646 multidrug resistance protein MdtH; Provisional | Back alignment and domain information |
|---|
| >PRK10091 MFS transport protein AraJ; Provisional | Back alignment and domain information |
|---|
| >COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11010 ampG muropeptide transporter; Validated | Back alignment and domain information |
|---|
| >TIGR00883 2A0106 metabolite-proton symporter | Back alignment and domain information |
|---|
| >TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter | Back alignment and domain information |
|---|
| >KOG2615|consensus | Back alignment and domain information |
|---|
| >PF13347 MFS_2: MFS/sugar transport protein | Back alignment and domain information |
|---|
| >PRK10406 alpha-ketoglutarate transporter; Provisional | Back alignment and domain information |
|---|
| >PF03825 Nuc_H_symport: Nucleoside H+ symporter | Back alignment and domain information |
|---|
| >PRK11195 lysophospholipid transporter LplT; Provisional | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00712 glpT glycerol-3-phosphate transporter | Back alignment and domain information |
|---|
| >PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions | Back alignment and domain information |
|---|
| >TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family | Back alignment and domain information |
|---|
| >PRK11195 lysophospholipid transporter LplT; Provisional | Back alignment and domain information |
|---|
| >TIGR00882 2A0105 oligosaccharide:H+ symporter | Back alignment and domain information |
|---|
| >TIGR00902 2A0127 phenyl proprionate permease family protein | Back alignment and domain information |
|---|
| >TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter | Back alignment and domain information |
|---|
| >PRK10133 L-fucose transporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00805 oat sodium-independent organic anion transporter | Back alignment and domain information |
|---|
| >TIGR01272 gluP glucose/galactose transporter | Back alignment and domain information |
|---|
| >PRK11128 putative 3-phenylpropionic acid transporter; Provisional | Back alignment and domain information |
|---|
| >PRK11043 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK12382 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15075 citrate-proton symporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00895 2A0115 benzoate transport | Back alignment and domain information |
|---|
| >KOG1330|consensus | Back alignment and domain information |
|---|
| >TIGR00883 2A0106 metabolite-proton symporter | Back alignment and domain information |
|---|
| >COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3764|consensus | Back alignment and domain information |
|---|
| >PRK10504 putative transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15075 citrate-proton symporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00900 2A0121 H+ Antiporter protein | Back alignment and domain information |
|---|
| >PRK11902 ampG muropeptide transporter; Reviewed | Back alignment and domain information |
|---|
| >PRK05122 major facilitator superfamily transporter; Provisional | Back alignment and domain information |
|---|
| >PRK15402 multidrug efflux system translocase MdfA; Provisional | Back alignment and domain information |
|---|
| >KOG0569|consensus | Back alignment and domain information |
|---|
| >PRK11652 emrD multidrug resistance protein D; Provisional | Back alignment and domain information |
|---|
| >KOG0253|consensus | Back alignment and domain information |
|---|
| >TIGR00881 2A0104 phosphoglycerate transporter family protein | Back alignment and domain information |
|---|
| >PRK10429 melibiose:sodium symporter; Provisional | Back alignment and domain information |
|---|
| >TIGR00788 fbt folate/biopterin transporter | Back alignment and domain information |
|---|
| >COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated | Back alignment and domain information |
|---|
| >KOG2504|consensus | Back alignment and domain information |
|---|
| >PRK03633 putative MFS family transporter protein; Provisional | Back alignment and domain information |
|---|
| >PRK15034 nitrate/nitrite transport protein NarU; Provisional | Back alignment and domain information |
|---|
| >PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily | Back alignment and domain information |
|---|
| >TIGR00769 AAA ADP/ATP carrier protein family | Back alignment and domain information |
|---|
| >TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family | Back alignment and domain information |
|---|
| >PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters | Back alignment and domain information |
|---|
| >COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09669 putative symporter YagG; Provisional | Back alignment and domain information |
|---|
| >TIGR00896 CynX cyanate transporter | Back alignment and domain information |
|---|
| >TIGR00902 2A0127 phenyl proprionate permease family protein | Back alignment and domain information |
|---|
| >PRK11102 bicyclomycin/multidrug efflux system; Provisional | Back alignment and domain information |
|---|
| >PRK10213 nepI ribonucleoside transporter; Reviewed | Back alignment and domain information |
|---|
| >TIGR00806 rfc RFC reduced folate carrier | Back alignment and domain information |
|---|
| >TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily | Back alignment and domain information |
|---|
| >PRK11128 putative 3-phenylpropionic acid transporter; Provisional | Back alignment and domain information |
|---|
| >COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00885 fucP L-fucose:H+ symporter permease | Back alignment and domain information |
|---|
| >COG2270 Permeases of the major facilitator superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial | Back alignment and domain information |
|---|
| >PRK10429 melibiose:sodium symporter; Provisional | Back alignment and domain information |
|---|
| >PRK10133 L-fucose transporter; Provisional | Back alignment and domain information |
|---|
| >PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions | Back alignment and domain information |
|---|
| >KOG0255|consensus | Back alignment and domain information |
|---|
| >PRK10473 multidrug efflux system protein MdtL; Provisional | Back alignment and domain information |
|---|
| >COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms | Back alignment and domain information |
|---|
| >PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins | Back alignment and domain information |
|---|
| >PRK10207 dipeptide/tripeptide permease B; Provisional | Back alignment and domain information |
|---|
| >PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] | Back alignment and domain information |
|---|
| >KOG0254|consensus | Back alignment and domain information |
|---|
| >PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions | Back alignment and domain information |
|---|
| >TIGR00788 fbt folate/biopterin transporter | Back alignment and domain information |
|---|
| >PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) | Back alignment and domain information |
|---|
| >KOG2816|consensus | Back alignment and domain information |
|---|
| >TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) | Back alignment and domain information |
|---|
| >TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily | Back alignment and domain information |
|---|
| >PRK11462 putative transporter; Provisional | Back alignment and domain information |
|---|
| >COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK09848 glucuronide transporter; Provisional | Back alignment and domain information |
|---|
| >PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters | Back alignment and domain information |
|---|
| >TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) | Back alignment and domain information |
|---|
| >PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins | Back alignment and domain information |
|---|
| >PRK09669 putative symporter YagG; Provisional | Back alignment and domain information |
|---|
| >PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon | Back alignment and domain information |
|---|
| >PRK14995 methyl viologen resistance protein SmvA; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| 4aps_A | 491 | DI-OR tripeptide H+ symporter; transport protein, | 98.25 | |
| 3o7q_A | 438 | L-fucose-proton symporter; transporter, multi-PASS | 98.24 | |
| 1pw4_A | 451 | Glycerol-3-phosphate transporter; transmembrane, i | 98.12 | |
| 1pw4_A | 451 | Glycerol-3-phosphate transporter; transmembrane, i | 97.88 | |
| 2cfq_A | 417 | Lactose permease; transport, transport mechanism, | 97.68 | |
| 4gc0_A | 491 | D-xylose-proton symporter; MFS, transport protein; | 97.43 | |
| 3o7q_A | 438 | L-fucose-proton symporter; transporter, multi-PASS | 97.37 | |
| 2xut_A | 524 | Proton/peptide symporter family protein; transport | 97.28 | |
| 2xut_A | 524 | Proton/peptide symporter family protein; transport | 97.15 | |
| 4aps_A | 491 | DI-OR tripeptide H+ symporter; transport protein, | 97.09 | |
| 2gfp_A | 375 | EMRD, multidrug resistance protein D; membrane pro | 96.97 | |
| 2gfp_A | 375 | EMRD, multidrug resistance protein D; membrane pro | 94.28 | |
| 4gc0_A | 491 | D-xylose-proton symporter; MFS, transport protein; | 94.2 |
| >4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} | Back alignment and structure |
|---|
Probab=98.25 E-value=5.3e-06 Score=69.70 Aligned_cols=117 Identities=14% Similarity=0.071 Sum_probs=76.3
Q ss_pred HHHHH-HHHHHHHHHhhHHHHhhh--hccCCcchHHHHHHHHHHHHhhhhcchhhhhhhhcccc-ch--HHHHHHHHHHH
Q psy15816 18 MFTLA-LTFNGAVTAGYLGNGLDI--APNFSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAP-NF--SGTIFGLANTL 91 (171)
Q Consensus 18 ~l~l~-~ark~~~~~G~~~~~l~l--~~~~~~~~~~av~ll~la~~~~~~~~~g~~~~~~diap-~~--ag~v~gi~n~~ 91 (171)
.++.+ ..||.....|.....+.. .++ ..+...-.....+.-...+...+...+...|..| +. .+..+++.+..
T Consensus 76 ~l~dr~~g~r~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~l~g~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~ 154 (491)
T 4aps_A 76 FVADRIIGARPAVFWGGVLIMLGHIVLAL-PFGASALFGSIILIIIGTGFLKPNVSTLVGTLYDEHDRRRDAGFSIFVFG 154 (491)
T ss_dssp HHHHHTSCHHHHHHHHHHHHHHHHHHHHS-CCSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHSSSCTTHHHHHHHHHHHH
T ss_pred HHHhccccchHHHHHHHHHHHHHHHHHHH-hhhHHHHHHHHHHHHHHHHhccchHHHHHHHHcCcccccceeeehHHHHH
Confidence 45667 678888877776665432 222 2333322222222222223333444555567665 44 68899999999
Q ss_pred HhhhhhhhhhhhheeecCCCccccCChhHHHHHHHHHHHHHHHhhhheec
Q psy15816 92 SSFGGFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGT 141 (171)
Q Consensus 92 g~l~gii~p~i~G~iv~~~~~~~~~~w~~vF~i~a~i~~~g~i~~~~~~~ 141 (171)
.+++.+++|.+.|++.+. .+|+..|++.+.+.+++.+.+.+..+
T Consensus 155 ~~~g~~~~~~~~~~l~~~------~g~~~~f~~~~~~~~~~~~~~~~~~~ 198 (491)
T 4aps_A 155 INLGAFIAPLIVGAAQEA------AGYHVAFSLAAIGMFIGLLVYYFGGK 198 (491)
T ss_dssp HHHHHHHHHHHHHHHHHH------SCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHhh------hhHHHHHHHHHHHHHHHHHHHHHhCc
Confidence 999999999999998775 46999999988888777776665543
|
| >3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* | Back alignment and structure |
|---|
| >1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 | Back alignment and structure |
|---|
| >1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 | Back alignment and structure |
|---|
| >2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* | Back alignment and structure |
|---|
| >4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* | Back alignment and structure |
|---|
| >3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* | Back alignment and structure |
|---|
| >2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} | Back alignment and structure |
|---|
| >4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| d1pw4a_ | 447 | Glycerol-3-phosphate transporter {Escherichia coli | 98.2 | |
| d1pw4a_ | 447 | Glycerol-3-phosphate transporter {Escherichia coli | 98.14 | |
| d1pv7a_ | 417 | Lactose permease {Escherichia coli [TaxId: 562]} | 98.1 | |
| d1pv7a_ | 417 | Lactose permease {Escherichia coli [TaxId: 562]} | 84.96 |
| >d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: MFS general substrate transporter superfamily: MFS general substrate transporter family: Glycerol-3-phosphate transporter domain: Glycerol-3-phosphate transporter species: Escherichia coli [TaxId: 562]
Probab=98.20 E-value=9.9e-07 Score=70.36 Aligned_cols=124 Identities=10% Similarity=-0.021 Sum_probs=77.3
Q ss_pred HHHHHHHHHHHHHHhhHHHHhhh--hcc---CCcchHHHHHHHHHHHHhhhhcchhhhhhhhcccc-chHHHHHHHHHHH
Q psy15816 18 MFTLALTFNGAVTAGYLGNGLDI--APN---FSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAP-NFSGTIFGLANTL 91 (171)
Q Consensus 18 ~l~l~~ark~~~~~G~~~~~l~l--~~~---~~~~~~~av~ll~la~~~~~~~~~g~~~~~~diap-~~ag~v~gi~n~~ 91 (171)
.++.+..||.....|.+...+.. .++ ...+...-.+...+.....+...+.......|..| ++.+..+|+.+..
T Consensus 81 ~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~ 160 (447)
T d1pw4a_ 81 SVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCA 160 (447)
T ss_dssp HHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHSSSSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHH
T ss_pred HHHHHcCchHHHHHHHHHHHHHHhhccccchhhhhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHhhcccccccccccc
Confidence 45566678887777776655432 111 11222222222222222233333444455566666 6689999999999
Q ss_pred HhhhhhhhhhhhheeecCCCccccCChhHHHHHHHHHHHHHHHhhhheecccccC
Q psy15816 92 SSFGGFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQP 146 (171)
Q Consensus 92 g~l~gii~p~i~G~iv~~~~~~~~~~w~~vF~i~a~i~~~g~i~~~~~~~~e~q~ 146 (171)
..++++++|.+.+.+.... ++|+..|.+.+.+.++..++...+.+..+++
T Consensus 161 ~~~g~~i~~~~~~~~~~~~-----~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 210 (447)
T d1pw4a_ 161 HNVGGGIPPLLFLLGMAWF-----NDWHAALYMPAFCAILVALFAFAMMRDTPQS 210 (447)
T ss_dssp HHHHHTSHHHHHHHHHHHT-----CCSTTCTHHHHHHHHHHHHHHHHHCCCSSTT
T ss_pred cchhhhhhhhhhhhHhhhh-----hcccccchhhhhhHHHHHHHHHHhcccchhh
Confidence 9999999999988777653 5799999988887776666655554444333
|
| >d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|