Psyllid ID: psy15816


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MDCKIIYTGEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNTPKISDDVELAKKEAEPLKKISS
cccEEEEcccccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHccccccccc
ccccEEEcccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEEcccHHHccccEccccccHcHHHHHHHHHHHHHcHHccHcHHEHHHEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHcccc
mdckiiytgedpIFAVAMFTLALTFNGAVtagylgngldiapnfsedpIFAVAMFTLALTFNGAVtagylgngldiapnfsgtIFGLANTLssfggfvssHIVGvltdgdkvrhfrpwQYVFMVLTTTYTVGAIVFLIFgtgqlqpwntpkisdDVELAKKEaeplkkiss
MDCKIIYTGEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGtgqlqpwntpkISDDVELAkkeaeplkkiss
MDCKIIYTGEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNTPKISDDVelakkeaeplkkISS
**CKIIYTGEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNT**********************
*DCKIIYTGEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWN***********************
MDCKIIYTGEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNTPKISDDVELAKK**********
*DCKIIYTGEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQL***************************
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDCKIIYTGEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNTPKISDDVELAKKEAEPLKKISS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query171 2.2.26 [Sep-21-2011]
Q5W8I8584 Vesicular glutamate trans no N/A 0.637 0.186 0.339 2e-13
Q03567493 Uncharacterized transport yes N/A 0.742 0.257 0.314 4e-13
Q05B21576 Vesicular glutamate trans no N/A 0.596 0.177 0.333 6e-13
Q6INC8576 Vesicular glutamate trans N/A N/A 0.637 0.189 0.330 7e-13
Q62634560 Vesicular glutamate trans yes N/A 0.614 0.187 0.324 1e-12
A4FV52560 Vesicular glutamate trans yes N/A 0.614 0.187 0.324 2e-12
Q3TXX4560 Vesicular glutamate trans yes N/A 0.614 0.187 0.324 2e-12
A6QLI1582 Vesicular glutamate trans no N/A 0.596 0.175 0.333 2e-12
Q9P2U7560 Vesicular glutamate trans yes N/A 0.614 0.187 0.324 2e-12
Q9P2U8582 Vesicular glutamate trans no N/A 0.596 0.175 0.333 2e-12
>sp|Q5W8I8|VGL2A_DANRE Vesicular glutamate transporter 2.1 OS=Danio rerio GN=slc17a6b PE=2 SV=2 Back     alignment and function desciption
 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 63/112 (56%), Gaps = 3/112 (2%)

Query: 44  FSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSSHIV 103
           +S     A++   LA+ F+G   +G+  N LDIAP ++  + G++N + +  G V   IV
Sbjct: 405 YSHSKGVAISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPLIV 464

Query: 104 GVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNTPKISDD 155
           G +T   K R    WQYVF++ +  +  G I + IF +G+ QPW  P+++ D
Sbjct: 465 GAMTK-HKTR--EEWQYVFLIASLVHYGGVIFYGIFASGEKQPWADPELTSD 513




Mediates the uptake of glutamate into synaptic vesicles at presynaptic nerve terminals of excitatory neural cells. Required for glutamate release by retinotectal synapses and visual acuity.
Danio rerio (taxid: 7955)
>sp|Q03567|YLD2_CAEEL Uncharacterized transporter C38C10.2 OS=Caenorhabditis elegans GN=C38C10.2 PE=1 SV=2 Back     alignment and function description
>sp|Q05B21|VGLU1_XENTR Vesicular glutamate transporter 1 OS=Xenopus tropicalis GN=slc17a7 PE=2 SV=1 Back     alignment and function description
>sp|Q6INC8|VGLU1_XENLA Vesicular glutamate transporter 1 OS=Xenopus laevis GN=slc17a7 PE=2 SV=1 Back     alignment and function description
>sp|Q62634|VGLU1_RAT Vesicular glutamate transporter 1 OS=Rattus norvegicus GN=Slc17a7 PE=1 SV=1 Back     alignment and function description
>sp|A4FV52|VGLU1_BOVIN Vesicular glutamate transporter 1 OS=Bos taurus GN=SLC17A7 PE=2 SV=1 Back     alignment and function description
>sp|Q3TXX4|VGLU1_MOUSE Vesicular glutamate transporter 1 OS=Mus musculus GN=Slc17a7 PE=2 SV=2 Back     alignment and function description
>sp|A6QLI1|VGLU2_BOVIN Vesicular glutamate transporter 2 OS=Bos taurus GN=SLC17A6 PE=2 SV=1 Back     alignment and function description
>sp|Q9P2U7|VGLU1_HUMAN Vesicular glutamate transporter 1 OS=Homo sapiens GN=SLC17A7 PE=1 SV=1 Back     alignment and function description
>sp|Q9P2U8|VGLU2_HUMAN Vesicular glutamate transporter 2 OS=Homo sapiens GN=SLC17A6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
312381697150 hypothetical protein AND_05949 [Anophele 0.713 0.813 0.577 1e-33
195437382 494 GK24471 [Drosophila willistoni] gi|19416 0.684 0.236 0.611 1e-32
189240168 472 PREDICTED: similar to sodium-dependent p 0.812 0.294 0.510 1e-32
270012290 471 hypothetical protein TcasGA2_TC006413 [T 0.812 0.295 0.510 1e-32
157113576 527 sodium-dependent phosphate transporter [ 0.707 0.229 0.585 6e-32
170032365 492 sodium-dependent phosphate transporter [ 0.707 0.245 0.588 7e-32
357620735 459 sodium-dependent phosphate transporter [ 0.690 0.257 0.558 2e-31
194766031 501 GF23558 [Drosophila ananassae] gi|190617 0.684 0.233 0.603 3e-31
195148128 494 GL18642 [Drosophila persimilis] gi|19410 0.684 0.236 0.587 4e-31
198474532 494 GA15786 [Drosophila pseudoobscura pseudo 0.684 0.236 0.587 4e-31
>gi|312381697|gb|EFR27386.1| hypothetical protein AND_05949 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/123 (57%), Positives = 93/123 (75%), Gaps = 1/123 (0%)

Query: 46  EDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSSHIVGV 105
           E+  +AVA+FTL+L  NGAVTAGYLGNGLDIAPNFSGTIFG+ANTLSSFGGFVS+++VGV
Sbjct: 15  ENRTWAVAIFTLSLFLNGAVTAGYLGNGLDIAPNFSGTIFGMANTLSSFGGFVSAYMVGV 74

Query: 106 LTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNTPKISDDVELAKKEAEP 165
           LT+ +  + +  WQ VF +L   Y VG+  +++ GTG+LQ WN P   DD ++  +E  P
Sbjct: 75  LTN-ENPKSYAQWQIVFWILAVIYIVGSSAYVLMGTGELQAWNNPPEKDDAKVETEEGVP 133

Query: 166 LKK 168
           L +
Sbjct: 134 LNE 136




Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195437382|ref|XP_002066619.1| GK24471 [Drosophila willistoni] gi|194162704|gb|EDW77605.1| GK24471 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|189240168|ref|XP_975071.2| PREDICTED: similar to sodium-dependent phosphate transporter [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270012290|gb|EFA08738.1| hypothetical protein TcasGA2_TC006413 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157113576|ref|XP_001652004.1| sodium-dependent phosphate transporter [Aedes aegypti] gi|108877650|gb|EAT41875.1| AAEL006514-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170032365|ref|XP_001844052.1| sodium-dependent phosphate transporter [Culex quinquefasciatus] gi|167872338|gb|EDS35721.1| sodium-dependent phosphate transporter [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|357620735|gb|EHJ72819.1| sodium-dependent phosphate transporter [Danaus plexippus] Back     alignment and taxonomy information
>gi|194766031|ref|XP_001965128.1| GF23558 [Drosophila ananassae] gi|190617738|gb|EDV33262.1| GF23558 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195148128|ref|XP_002015026.1| GL18642 [Drosophila persimilis] gi|194106979|gb|EDW29022.1| GL18642 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198474532|ref|XP_001356729.2| GA15786 [Drosophila pseudoobscura pseudoobscura] gi|198138431|gb|EAL33794.2| GA15786 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
FB|FBgn0031645493 CG3036 [Drosophila melanogaste 0.619 0.215 0.616 6.9e-31
FB|FBgn0034490465 CG9864 [Drosophila melanogaste 0.637 0.234 0.378 3.8e-17
ZFIN|ZDB-GENE-030616-554584 slc17a6b "solute carrier famil 0.637 0.186 0.339 8.7e-14
UNIPROTKB|Q5ZL94484 SLC17A5 "Uncharacterized prote 0.549 0.194 0.371 1.9e-13
FB|FBgn0031307512 MFS3 "Major Facilitator Superf 0.578 0.193 0.355 2.4e-13
WB|WBGene00008000493 C38C10.2 [Caenorhabditis elega 0.695 0.241 0.330 2.8e-13
UNIPROTKB|A6QLI1582 SLC17A6 "Vesicular glutamate t 0.573 0.168 0.356 6.3e-13
UNIPROTKB|Q9P2U8582 SLC17A6 "Vesicular glutamate t 0.573 0.168 0.356 6.3e-13
UNIPROTKB|F1SFZ2582 SLC17A6 "Uncharacterized prote 0.573 0.168 0.356 6.3e-13
UNIPROTKB|F1PBW6583 SLC17A6 "Uncharacterized prote 0.573 0.168 0.356 6.3e-13
FB|FBgn0031645 CG3036 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 340 (124.7 bits), Expect = 6.9e-31, P = 6.9e-31
 Identities = 69/112 (61%), Positives = 83/112 (74%)

Query:    47 DPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSSHIVGVL 106
             D  ++V +F+LAL  +GAVTAGYLGNGLDIAPNF GTIFGLANTLSSFGGF+S+ +VG L
Sbjct:   371 DATWSVTIFSLALFAHGAVTAGYLGNGLDIAPNFGGTIFGLANTLSSFGGFLSTSMVGAL 430

Query:   107 TDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNTP----KISD 154
             T  D+   F  WQ VF +L  TY   A+VF I G+G+LQPWN P    +ISD
Sbjct:   431 TYKDQ--SFHSWQIVFWILAATYISAAVVFAILGSGELQPWNNPPERVRISD 480


GO:0005436 "sodium:phosphate symporter activity" evidence=ISS
GO:0006817 "phosphate ion transport" evidence=ISS
GO:0016021 "integral to membrane" evidence=ISS
GO:0055085 "transmembrane transport" evidence=IEA
FB|FBgn0034490 CG9864 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-554 slc17a6b "solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZL94 SLC17A5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0031307 MFS3 "Major Facilitator Superfamily Transporter 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00008000 C38C10.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|A6QLI1 SLC17A6 "Vesicular glutamate transporter 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P2U8 SLC17A6 "Vesicular glutamate transporter 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SFZ2 SLC17A6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PBW6 SLC17A6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
TIGR00894465 TIGR00894, 2A0114euk, Na(+)-dependent inorganic ph 2e-12
>gnl|CDD|129972 TIGR00894, 2A0114euk, Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
 Score = 63.6 bits (155), Expect = 2e-12
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 5/112 (4%)

Query: 41  APNFSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFGGFVSS 100
            P  S      + + TLA   +    AG L N LD+AP F G I G+       GG ++S
Sbjct: 354 LPYLSAAFYLTIIILTLANAVSSGPLAGVLINSLDLAPRFLGFIKGITGLPGFIGGLIAS 413

Query: 101 HIVG-VLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNTPK 151
            + G +L+   K      W  VF+++     +  I +LIFG+ + Q W   +
Sbjct: 414 TLAGNILSQDSK----NVWLIVFLIMAFVNILCVIFYLIFGSAERQDWAKEE 461


[Transport and binding proteins, Anions]. Length = 465

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 171
KOG2532|consensus466 99.85
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.38
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 98.39
PLN00028476 nitrate transmembrane transporter; Provisional 98.16
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.14
TIGR00900 365 2A0121 H+ Antiporter protein. 97.99
PRK11663 434 regulatory protein UhpC; Provisional 97.99
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 97.98
TIGR00893 399 2A0114 d-galactonate transporter. 97.97
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 97.91
TIGR00880141 2_A_01_02 Multidrug resistance protein. 97.85
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 97.79
PRK03699 394 putative transporter; Provisional 97.75
PRK11010491 ampG muropeptide transporter; Validated 97.75
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.73
TIGR00892455 2A0113 monocarboxylate transporter 1. 97.72
TIGR00895 398 2A0115 benzoate transport. 97.72
TIGR00893399 2A0114 d-galactonate transporter. 97.69
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 97.69
PRK09874 408 drug efflux system protein MdtG; Provisional 97.68
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 97.67
PRK09952438 shikimate transporter; Provisional 97.63
PRK10473 392 multidrug efflux system protein MdtL; Provisional 97.63
PRK10054 395 putative transporter; Provisional 97.63
TIGR00891 405 2A0112 putative sialic acid transporter. 97.62
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 97.61
PRK09705393 cynX putative cyanate transporter; Provisional 97.61
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 97.58
PRK05122399 major facilitator superfamily transporter; Provisi 97.55
PRK10642490 proline/glycine betaine transporter; Provisional 97.52
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 97.51
KOG2504|consensus509 97.51
PRK09874408 drug efflux system protein MdtG; Provisional 97.51
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 97.5
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 97.49
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 97.48
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 97.48
PRK15011393 sugar efflux transporter B; Provisional 97.45
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 97.45
KOG2532|consensus 466 97.39
TIGR00889418 2A0110 nucleoside transporter. This family of prot 97.37
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 97.36
PRK11663434 regulatory protein UhpC; Provisional 97.35
PRK15403 413 multidrug efflux system protein MdtM; Provisional 97.34
PRK10489417 enterobactin exporter EntS; Provisional 97.34
PRK15462 493 dipeptide/tripeptide permease D; Provisional 97.33
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 97.33
PRK11646 400 multidrug resistance protein MdtH; Provisional 97.31
PRK03545 390 putative arabinose transporter; Provisional 97.31
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 97.31
TIGR00898505 2A0119 cation transport protein. 97.3
TIGR00896 355 CynX cyanate transporter. This family of proteins 97.3
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 97.28
PRK12382392 putative transporter; Provisional 97.27
PRK03545390 putative arabinose transporter; Provisional 97.25
PRK09705 393 cynX putative cyanate transporter; Provisional 97.25
PRK03893496 putative sialic acid transporter; Provisional 97.24
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.23
PRK10213 394 nepI ribonucleoside transporter; Reviewed 97.23
PRK10504 471 putative transporter; Provisional 97.23
PRK14995 495 methyl viologen resistance protein SmvA; Provision 97.23
PLN00028 476 nitrate transmembrane transporter; Provisional 97.19
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 97.18
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 97.17
PRK09528420 lacY galactoside permease; Reviewed 97.16
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 97.16
PRK12307 426 putative sialic acid transporter; Provisional 97.14
TIGR00901 356 2A0125 AmpG-related permease. 97.13
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 97.13
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 97.13
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 97.12
TIGR00898 505 2A0119 cation transport protein. 97.12
PRK11043 401 putative transporter; Provisional 97.12
PRK03893 496 putative sialic acid transporter; Provisional 97.11
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.1
PRK10406432 alpha-ketoglutarate transporter; Provisional 97.07
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 97.04
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 97.03
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 97.03
KOG2533|consensus 495 97.03
PRK10077479 xylE D-xylose transporter XylE; Provisional 97.03
KOG4686|consensus459 97.0
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 97.0
TIGR00897402 2A0118 polyol permease family. This family of prot 96.97
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 96.93
TIGR00892 455 2A0113 monocarboxylate transporter 1. 96.93
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 96.93
PRK09584 500 tppB putative tripeptide transporter permease; Rev 96.92
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 96.92
PRK10207 489 dipeptide/tripeptide permease B; Provisional 96.91
PRK10091 382 MFS transport protein AraJ; Provisional 96.9
PRK11652 394 emrD multidrug resistance protein D; Provisional 96.88
PRK03633381 putative MFS family transporter protein; Provision 96.87
PRK11902 402 ampG muropeptide transporter; Reviewed 96.86
PRK03699394 putative transporter; Provisional 96.8
PRK10489 417 enterobactin exporter EntS; Provisional 96.76
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 96.71
PRK15011 393 sugar efflux transporter B; Provisional 96.62
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 96.58
PRK09528 420 lacY galactoside permease; Reviewed 96.58
PRK10054395 putative transporter; Provisional 96.58
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 96.57
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 96.51
TIGR00891405 2A0112 putative sialic acid transporter. 96.51
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 96.47
PRK10642 490 proline/glycine betaine transporter; Provisional 96.46
KOG0255|consensus 521 96.46
PRK10077 479 xylE D-xylose transporter XylE; Provisional 96.44
KOG0252|consensus538 96.4
PTZ00207 591 hypothetical protein; Provisional 96.39
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 96.39
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 96.38
PRK12307426 putative sialic acid transporter; Provisional 96.34
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 96.32
PRK09952 438 shikimate transporter; Provisional 96.3
TIGR00897 402 2A0118 polyol permease family. This family of prot 96.3
PRK11646400 multidrug resistance protein MdtH; Provisional 96.28
PRK10091382 MFS transport protein AraJ; Provisional 96.27
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 96.23
PRK11010 491 ampG muropeptide transporter; Validated 96.16
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 96.07
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 96.06
KOG2615|consensus 451 96.04
PF13347 428 MFS_2: MFS/sugar transport protein 96.04
PRK10406 432 alpha-ketoglutarate transporter; Provisional 96.0
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 95.99
PRK11195 393 lysophospholipid transporter LplT; Provisional 95.99
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 95.96
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 95.85
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 95.78
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 95.77
PRK11195393 lysophospholipid transporter LplT; Provisional 95.7
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 95.7
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 95.41
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 95.41
PRK10133 438 L-fucose transporter; Provisional 95.41
TIGR00805 633 oat sodium-independent organic anion transporter. 95.39
TIGR01272310 gluP glucose/galactose transporter. Disruption of 95.35
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 95.31
PRK11043401 putative transporter; Provisional 95.21
PRK12382 392 putative transporter; Provisional 95.17
PRK15075 434 citrate-proton symporter; Provisional 95.17
TIGR00895398 2A0115 benzoate transport. 95.16
KOG1330|consensus 493 95.09
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 94.95
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 94.89
KOG3764|consensus 464 94.84
PRK10504471 putative transporter; Provisional 94.82
PRK15075434 citrate-proton symporter; Provisional 94.76
TIGR00900365 2A0121 H+ Antiporter protein. 94.73
PRK11902402 ampG muropeptide transporter; Reviewed 94.65
PRK05122 399 major facilitator superfamily transporter; Provisi 94.57
PRK15402406 multidrug efflux system translocase MdfA; Provisio 94.46
KOG0569|consensus 485 94.4
PRK11652394 emrD multidrug resistance protein D; Provisional 94.39
KOG0253|consensus528 94.24
TIGR00881379 2A0104 phosphoglycerate transporter family protein 94.0
PRK10429473 melibiose:sodium symporter; Provisional 93.89
TIGR00788468 fbt folate/biopterin transporter. The only functio 93.85
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 93.85
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 93.83
KOG2504|consensus 509 93.81
PRK03633 381 putative MFS family transporter protein; Provision 93.79
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 93.58
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 93.43
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 93.33
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 93.19
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 93.17
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 93.11
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 92.94
PRK09669 444 putative symporter YagG; Provisional 92.81
TIGR00896355 CynX cyanate transporter. This family of proteins 92.81
TIGR00902382 2A0127 phenyl proprionate permease family protein. 92.74
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 92.7
PRK10213394 nepI ribonucleoside transporter; Reviewed 92.52
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 92.32
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 92.13
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 91.98
COG2807395 CynX Cyanate permease [Inorganic ion transport and 91.94
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 91.9
COG2270438 Permeases of the major facilitator superfamily [Ge 91.79
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 91.55
PRK10429 473 melibiose:sodium symporter; Provisional 91.54
PRK10133438 L-fucose transporter; Provisional 91.48
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 91.13
KOG0255|consensus521 90.9
PRK10473392 multidrug efflux system protein MdtL; Provisional 90.12
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 89.62
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 89.61
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 89.57
PRK10207489 dipeptide/tripeptide permease B; Provisional 89.56
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 88.81
KOG0254|consensus 513 88.59
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 88.42
TIGR00788 468 fbt folate/biopterin transporter. The only functio 88.21
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 88.04
KOG2816|consensus 463 88.03
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 86.94
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 86.51
PRK11462 460 putative transporter; Provisional 85.82
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 85.62
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 85.22
PRK09848448 glucuronide transporter; Provisional 85.1
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 84.91
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 84.71
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 82.68
PRK09669444 putative symporter YagG; Provisional 82.29
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 81.33
PRK14995495 methyl viologen resistance protein SmvA; Provision 80.74
>KOG2532|consensus Back     alignment and domain information
Probab=99.85  E-value=2.5e-21  Score=168.62  Aligned_cols=134  Identities=25%  Similarity=0.550  Sum_probs=120.4

Q ss_pred             HHHHHHHHHHHHHhhHHHHhhh--hccCCc-chHHHHHHHHHHHHhhhhcchhhhhhhhccccchHHHHHHHHHHHHhhh
Q psy15816         19 FTLALTFNGAVTAGYLGNGLDI--APNFSE-DPIFAVAMFTLALTFNGAVTAGYLGNGLDIAPNFSGTIFGLANTLSSFG   95 (171)
Q Consensus        19 l~l~~ark~~~~~G~~~~~l~l--~~~~~~-~~~~av~ll~la~~~~~~~~~g~~~~~~diap~~ag~v~gi~n~~g~l~   95 (171)
                      ++.+..||.++++++.++++.+  +++..+ +...++++++++.++.|++.+|+..+++|.+|||+|+++|+.|+.++++
T Consensus       326 ls~t~~rkifn~i~~~~~ai~l~~l~~~~~~~~~~a~~~l~~~~~~~g~~~~Gf~~~~~~~apq~a~~l~g~~~~~~~~~  405 (466)
T KOG2532|consen  326 LSETTVRKIFNTIAFGGPAVFLLVLAFTSDEHRLLAVILLTIAIGLSGFNISGFYKNHQDIAPQHAGFVMGIINFVGALA  405 (466)
T ss_pred             CchHhHHHHHHhHHHHHHHHHHHeeeecCCCcchHHHHHHHHHHHHcccchhhhHhhhhhccchHHHHHHHHHHHHHHHH
Confidence            6788899999999999999765  455544 4468999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhhhheeecCCCccccCChhHHHHHHHHHHHHHHHhhhheecccccCCCCCCCCcc
Q psy15816         96 GFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQPWNTPKISDD  155 (171)
Q Consensus        96 gii~p~i~G~iv~~~~~~~~~~w~~vF~i~a~i~~~g~i~~~~~~~~e~q~w~~~~~~~~  155 (171)
                      ++++|.++|.+++++   +.++|+.+|.+.++++++++++|.+++++|+|+|++++++++
T Consensus       406 ~~~~P~~vg~~~~~~---t~~eW~~VF~i~a~i~~~~~i~f~~f~s~e~~~w~~~~~~~~  462 (466)
T KOG2532|consen  406 GFIAPLLVGIIVTDN---TREEWRIVFLIAAGILIVGNIIFLFFGSGEPAPWTKSEEKEE  462 (466)
T ss_pred             HHHHHHheeeEeCCC---CHHHHHHHHHHHHHHHHHhchheeEeecCcccCccCCccccc
Confidence            999999999999743   567999999999999999999999999999999999655433



>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 98.25
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 98.24
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 98.12
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 97.88
2cfq_A417 Lactose permease; transport, transport mechanism, 97.68
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 97.43
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 97.37
2xut_A 524 Proton/peptide symporter family protein; transport 97.28
2xut_A524 Proton/peptide symporter family protein; transport 97.15
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 97.09
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 96.97
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 94.28
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 94.2
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
Probab=98.25  E-value=5.3e-06  Score=69.70  Aligned_cols=117  Identities=14%  Similarity=0.071  Sum_probs=76.3

Q ss_pred             HHHHH-HHHHHHHHHhhHHHHhhh--hccCCcchHHHHHHHHHHHHhhhhcchhhhhhhhcccc-ch--HHHHHHHHHHH
Q psy15816         18 MFTLA-LTFNGAVTAGYLGNGLDI--APNFSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAP-NF--SGTIFGLANTL   91 (171)
Q Consensus        18 ~l~l~-~ark~~~~~G~~~~~l~l--~~~~~~~~~~av~ll~la~~~~~~~~~g~~~~~~diap-~~--ag~v~gi~n~~   91 (171)
                      .++.+ ..||.....|.....+..  .++ ..+...-.....+.-...+...+...+...|..| +.  .+..+++.+..
T Consensus        76 ~l~dr~~g~r~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~l~g~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~  154 (491)
T 4aps_A           76 FVADRIIGARPAVFWGGVLIMLGHIVLAL-PFGASALFGSIILIIIGTGFLKPNVSTLVGTLYDEHDRRRDAGFSIFVFG  154 (491)
T ss_dssp             HHHHHTSCHHHHHHHHHHHHHHHHHHHHS-CCSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHSSSCTTHHHHHHHHHHHH
T ss_pred             HHHhccccchHHHHHHHHHHHHHHHHHHH-hhhHHHHHHHHHHHHHHHHhccchHHHHHHHHcCcccccceeeehHHHHH
Confidence            45667 678888877776665432  222 2333322222222222223333444555567665 44  68899999999


Q ss_pred             HhhhhhhhhhhhheeecCCCccccCChhHHHHHHHHHHHHHHHhhhheec
Q psy15816         92 SSFGGFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGT  141 (171)
Q Consensus        92 g~l~gii~p~i~G~iv~~~~~~~~~~w~~vF~i~a~i~~~g~i~~~~~~~  141 (171)
                      .+++.+++|.+.|++.+.      .+|+..|++.+.+.+++.+.+.+..+
T Consensus       155 ~~~g~~~~~~~~~~l~~~------~g~~~~f~~~~~~~~~~~~~~~~~~~  198 (491)
T 4aps_A          155 INLGAFIAPLIVGAAQEA------AGYHVAFSLAAIGMFIGLLVYYFGGK  198 (491)
T ss_dssp             HHHHHHHHHHHHHHHHHH------SCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHhh------hhHHHHHHHHHHHHHHHHHHHHHhCc
Confidence            999999999999998775      46999999988888777776665543



>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 98.2
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 98.14
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 98.1
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 84.96
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=98.20  E-value=9.9e-07  Score=70.36  Aligned_cols=124  Identities=10%  Similarity=-0.021  Sum_probs=77.3

Q ss_pred             HHHHHHHHHHHHHHhhHHHHhhh--hcc---CCcchHHHHHHHHHHHHhhhhcchhhhhhhhcccc-chHHHHHHHHHHH
Q psy15816         18 MFTLALTFNGAVTAGYLGNGLDI--APN---FSEDPIFAVAMFTLALTFNGAVTAGYLGNGLDIAP-NFSGTIFGLANTL   91 (171)
Q Consensus        18 ~l~l~~ark~~~~~G~~~~~l~l--~~~---~~~~~~~av~ll~la~~~~~~~~~g~~~~~~diap-~~ag~v~gi~n~~   91 (171)
                      .++.+..||.....|.+...+..  .++   ...+...-.+...+.....+...+.......|..| ++.+..+|+.+..
T Consensus        81 ~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~  160 (447)
T d1pw4a_          81 SVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATSSIAVMFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCA  160 (447)
T ss_dssp             HHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHSSSSHHHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHH
T ss_pred             HHHHHcCchHHHHHHHHHHHHHHhhccccchhhhhHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHhhcccccccccccc
Confidence            45566678887777776655432  111   11222222222222222233333444455566666 6689999999999


Q ss_pred             HhhhhhhhhhhhheeecCCCccccCChhHHHHHHHHHHHHHHHhhhheecccccC
Q psy15816         92 SSFGGFVSSHIVGVLTDGDKVRHFRPWQYVFMVLTTTYTVGAIVFLIFGTGQLQP  146 (171)
Q Consensus        92 g~l~gii~p~i~G~iv~~~~~~~~~~w~~vF~i~a~i~~~g~i~~~~~~~~e~q~  146 (171)
                      ..++++++|.+.+.+....     ++|+..|.+.+.+.++..++...+.+..+++
T Consensus       161 ~~~g~~i~~~~~~~~~~~~-----~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~  210 (447)
T d1pw4a_         161 HNVGGGIPPLLFLLGMAWF-----NDWHAALYMPAFCAILVALFAFAMMRDTPQS  210 (447)
T ss_dssp             HHHHHTSHHHHHHHHHHHT-----CCSTTCTHHHHHHHHHHHHHHHHHCCCSSTT
T ss_pred             cchhhhhhhhhhhhHhhhh-----hcccccchhhhhhHHHHHHHHHHhcccchhh
Confidence            9999999999988777653     5799999988887776666655554444333



>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure