Psyllid ID: psy15850
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 225 | ||||||
| 307215182 | 4470 | Sorbin and SH3 domain-containing protein | 0.631 | 0.031 | 0.6 | 4e-56 | |
| 345488740 | 2222 | PREDICTED: hypothetical protein LOC10012 | 0.631 | 0.063 | 0.594 | 3e-55 | |
| 380028397 | 965 | PREDICTED: uncharacterized protein LOC10 | 0.631 | 0.147 | 0.594 | 4e-54 | |
| 328780855 | 966 | PREDICTED: hypothetical protein LOC40965 | 0.631 | 0.146 | 0.594 | 4e-54 | |
| 383851627 | 963 | PREDICTED: uncharacterized protein LOC10 | 0.631 | 0.147 | 0.589 | 1e-53 | |
| 307172916 | 1065 | Sorbin and SH3 domain-containing protein | 0.631 | 0.133 | 0.586 | 2e-52 | |
| 332029655 | 1113 | Sorbin and SH3 domain-containing protein | 0.631 | 0.127 | 0.575 | 8e-52 | |
| 328714703 | 1924 | PREDICTED: hypothetical protein LOC10016 | 0.64 | 0.074 | 0.6 | 1e-51 | |
| 350409487 | 902 | PREDICTED: hypothetical protein LOC10074 | 0.631 | 0.157 | 0.589 | 1e-47 | |
| 321468642 | 438 | hypothetical protein DAPPUDRAFT_197424 [ | 0.617 | 0.317 | 0.510 | 3e-44 |
| >gi|307215182|gb|EFN89954.1| Sorbin and SH3 domain-containing protein 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 223 bits (568), Expect = 4e-56, Method: Compositional matrix adjust.
Identities = 114/190 (60%), Positives = 125/190 (65%), Gaps = 48/190 (25%)
Query: 12 PNSIVDSEVTLQYRRPVRNEIKELISEEELARRQAEAMRRIYQEERRRKYLQELHDISSR 71
P V+ EVT+ YR PVR E KE +SEEELARR AE MRR+YQEERRRKYLQELHDI SR
Sbjct: 4106 PRRYVEGEVTIHYRSPVRTEAKEPLSEEELARRSAENMRRVYQEERRRKYLQELHDIDSR 4165
Query: 72 RHTDNFT------------------------------------------------ELSFK 83
RHTDNF EL+F+
Sbjct: 4166 RHTDNFIPSQKSPIPLNRYDDFVDDLSQRSRSQDQTPEPRLVARALYNFVGQSSRELTFR 4225
Query: 84 KGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKIRTAPKKLSEGQARAKFNFVA 143
+GDIIFVRRQVDKNWYEGE+NAMIGLFPFNYVEI+PYD +RT PKK EGQARAKFNFVA
Sbjct: 4226 RGDIIFVRRQVDKNWYEGEYNAMIGLFPFNYVEILPYDGMRTTPKKAHEGQARAKFNFVA 4285
Query: 144 QTHLELSLVK 153
QT+LELSLVK
Sbjct: 4286 QTNLELSLVK 4295
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|345488740|ref|XP_001605377.2| PREDICTED: hypothetical protein LOC100121771 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|380028397|ref|XP_003697889.1| PREDICTED: uncharacterized protein LOC100867381 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328780855|ref|XP_393153.4| PREDICTED: hypothetical protein LOC409655 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383851627|ref|XP_003701333.1| PREDICTED: uncharacterized protein LOC100875671 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307172916|gb|EFN64083.1| Sorbin and SH3 domain-containing protein 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332029655|gb|EGI69544.1| Sorbin and SH3 domain-containing protein 1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|328714703|ref|XP_003245429.1| PREDICTED: hypothetical protein LOC100167639 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|350409487|ref|XP_003488756.1| PREDICTED: hypothetical protein LOC100740896, partial [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|321468642|gb|EFX79626.1| hypothetical protein DAPPUDRAFT_197424 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 225 | ||||||
| FB|FBgn0033504 | 2412 | CAP "CAP" [Drosophila melanoga | 0.333 | 0.031 | 0.68 | 1.4e-39 | |
| UNIPROTKB|E1C009 | 1006 | SORBS1 "Uncharacterized protei | 0.328 | 0.073 | 0.444 | 2.8e-19 | |
| UNIPROTKB|Q9BX66 | 1292 | SORBS1 "Sorbin and SH3 domain- | 0.328 | 0.057 | 0.444 | 1.1e-18 | |
| MGI|MGI:700014 | 1290 | Sorbs1 "sorbin and SH3 domain | 0.333 | 0.058 | 0.45 | 1.3e-18 | |
| UNIPROTKB|F1SC49 | 1293 | SORBS1 "Uncharacterized protei | 0.328 | 0.057 | 0.444 | 1.4e-18 | |
| UNIPROTKB|F1M820 | 1290 | F1M820 "Uncharacterized protei | 0.333 | 0.058 | 0.45 | 2.2e-18 | |
| UNIPROTKB|E2RDW3 | 1193 | SORBS2 "Uncharacterized protei | 0.617 | 0.116 | 0.357 | 3.3e-16 | |
| RGD|620061 | 1196 | Sorbs2 "sorbin and SH3 domain | 0.333 | 0.062 | 0.506 | 8.9e-16 | |
| UNIPROTKB|O35413 | 1196 | Sorbs2 "Sorbin and SH3 domain- | 0.333 | 0.062 | 0.506 | 8.9e-16 | |
| UNIPROTKB|F1RMA6 | 732 | SORBS3 "Uncharacterized protei | 0.426 | 0.131 | 0.4 | 9.8e-16 |
| FB|FBgn0033504 CAP "CAP" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 268 (99.4 bits), Expect = 1.4e-39, Sum P(2) = 1.4e-39
Identities = 51/75 (68%), Positives = 61/75 (81%)
Query: 79 ELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKIRTAPKKLSEGQARAK 138
ELSF+KGD I++RRQ+D NWYEGEHNAMIGL P +YVEI+ D RT K+ SEGQARAK
Sbjct: 2173 ELSFRKGDTIYIRRQIDANWYEGEHNAMIGLLPASYVEIVSRDGARTPSKRPSEGQARAK 2232
Query: 139 FNFVAQTHLELSLVK 153
+NF AQ+ +ELSL K
Sbjct: 2233 YNFQAQSGIELSLNK 2247
|
|
| UNIPROTKB|E1C009 SORBS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9BX66 SORBS1 "Sorbin and SH3 domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:700014 Sorbs1 "sorbin and SH3 domain containing 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SC49 SORBS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M820 F1M820 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RDW3 SORBS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|620061 Sorbs2 "sorbin and SH3 domain containing 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O35413 Sorbs2 "Sorbin and SH3 domain-containing protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RMA6 SORBS3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 225 | |||
| cd11781 | 53 | cd11781, SH3_Sorbs_1, First Src Homology 3 domain | 2e-19 | |
| cd11786 | 53 | cd11786, SH3_SH3RF_1, First Src Homology 3 domain | 3e-15 | |
| cd11803 | 55 | cd11803, SH3_Endophilin_A, Src homology 3 domain o | 1e-14 | |
| cd11921 | 55 | cd11921, SH3_Vinexin_1, First Src Homology 3 domai | 6e-14 | |
| cd11920 | 55 | cd11920, SH3_Sorbs2_1, First Src Homology 3 domain | 2e-13 | |
| cd11877 | 53 | cd11877, SH3_PIX, Src Homology 3 domain of Pak Int | 2e-13 | |
| cd11927 | 54 | cd11927, SH3_SH3RF1_1, First Src Homology 3 domain | 2e-12 | |
| smart00326 | 56 | smart00326, SH3, Src homology 3 domains | 5e-12 | |
| cd11919 | 55 | cd11919, SH3_Sorbs1_1, First Src Homology 3 domain | 5e-12 | |
| cd11929 | 54 | cd11929, SH3_SH3RF2_1, First Src Homology 3 domain | 2e-11 | |
| cd00174 | 51 | cd00174, SH3, Src Homology 3 domain superfamily | 7e-11 | |
| cd11826 | 52 | cd11826, SH3_Abi, Src homology 3 domain of Abl Int | 2e-10 | |
| cd11782 | 53 | cd11782, SH3_Sorbs_2, Second Src Homology 3 domain | 3e-10 | |
| cd11928 | 54 | cd11928, SH3_SH3RF3_1, First Src Homology 3 domain | 5e-10 | |
| cd11805 | 53 | cd11805, SH3_GRB2_like_C, C-terminal Src homology | 7e-10 | |
| cd11971 | 59 | cd11971, SH3_Abi1, Src homology 3 domain of Abl In | 9e-10 | |
| cd11840 | 53 | cd11840, SH3_Intersectin_5, Fifth Src homology 3 d | 9e-10 | |
| cd11972 | 61 | cd11972, SH3_Abi2, Src homology 3 domain of Abl In | 1e-09 | |
| cd12061 | 54 | cd12061, SH3_betaPIX, Src Homology 3 domain of bet | 4e-09 | |
| cd11869 | 54 | cd11869, SH3_p40phox, Src Homology 3 domain of the | 4e-09 | |
| cd11809 | 53 | cd11809, SH3_srGAP, Src homology 3 domain of Slit- | 9e-09 | |
| cd11995 | 54 | cd11995, SH3_Intersectin1_5, Fifth Src homology 3 | 1e-08 | |
| cd11996 | 54 | cd11996, SH3_Intersectin2_5, Fifth Src homology 3 | 1e-08 | |
| cd11787 | 53 | cd11787, SH3_SH3RF_2, Second Src Homology 3 domain | 2e-08 | |
| cd11949 | 53 | cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom | 2e-08 | |
| cd11956 | 55 | cd11956, SH3_srGAP4, Src homology 3 domain of Slit | 2e-08 | |
| cd11923 | 57 | cd11923, SH3_Sorbs2_2, Second Src Homology 3 domai | 4e-08 | |
| cd11875 | 55 | cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do | 4e-08 | |
| cd11819 | 54 | cd11819, SH3_Cortactin_like, Src homology 3 domain | 5e-08 | |
| cd11820 | 54 | cd11820, SH3_STAM, Src homology 3 domain of Signal | 5e-08 | |
| cd11964 | 55 | cd11964, SH3_STAM1, Src homology 3 domain of Signa | 6e-08 | |
| cd11873 | 53 | cd11873, SH3_CD2AP-like_1, First Src Homology 3 do | 7e-08 | |
| cd11823 | 53 | cd11823, SH3_Nostrin, Src homology 3 domain of Nit | 8e-08 | |
| cd11963 | 57 | cd11963, SH3_STAM2, Src homology 3 domain of Signa | 1e-07 | |
| cd11922 | 58 | cd11922, SH3_Sorbs1_2, Second Src Homology 3 domai | 1e-07 | |
| cd12046 | 53 | cd12046, SH3_p67phox_C, C-terminal (or second) Src | 1e-07 | |
| cd11951 | 53 | cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom | 1e-07 | |
| cd12060 | 58 | cd12060, SH3_alphaPIX, Src Homology 3 domain of al | 2e-07 | |
| cd12142 | 55 | cd12142, SH3_D21-like, Src Homology 3 domain of SH | 2e-07 | |
| cd11841 | 54 | cd11841, SH3_SH3YL1_like, Src homology 3 domain of | 2e-07 | |
| cd11932 | 57 | cd11932, SH3_SH3RF2_2, Second Src Homology 3 domai | 4e-07 | |
| cd11874 | 53 | cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d | 4e-07 | |
| cd11772 | 53 | cd11772, SH3_OSTF1, Src Homology 3 domain of metaz | 4e-07 | |
| cd11842 | 55 | cd11842, SH3_Ysc84p_like, Src homology 3 domain of | 4e-07 | |
| cd11960 | 54 | cd11960, SH3_Abp1_eu, Src homology 3 domain of eum | 5e-07 | |
| cd11870 | 53 | cd11870, SH3_p67phox-like_C, C-terminal Src Homolo | 6e-07 | |
| cd11959 | 53 | cd11959, SH3_Cortactin, Src homology 3 domain of C | 6e-07 | |
| cd11806 | 53 | cd11806, SH3_PRMT2, Src homology 3 domain of Prote | 8e-07 | |
| cd11961 | 53 | cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src | 1e-06 | |
| pfam00018 | 47 | pfam00018, SH3_1, SH3 domain | 1e-06 | |
| pfam07653 | 53 | pfam07653, SH3_2, Variant SH3 domain | 1e-06 | |
| cd11815 | 52 | cd11815, SH3_Eve1_2, Second Src homology 3 domain | 2e-06 | |
| cd11829 | 52 | cd11829, SH3_GAS7, Src homology 3 domain of Growth | 2e-06 | |
| cd11766 | 53 | cd11766, SH3_Nck_2, Second Src Homology 3 domain o | 3e-06 | |
| cd11924 | 56 | cd11924, SH3_Vinexin_2, Second Src Homology 3 doma | 3e-06 | |
| cd11796 | 51 | cd11796, SH3_DNMBP_N3, Third N-terminal Src homolo | 3e-06 | |
| cd11804 | 52 | cd11804, SH3_GRB2_like_N, N-terminal Src homology | 3e-06 | |
| cd11884 | 56 | cd11884, SH3_MYO15, Src Homology 3 domain of Myosi | 4e-06 | |
| cd12057 | 56 | cd12057, SH3_CIN85_3, Third Src Homology 3 domain | 5e-06 | |
| cd11839 | 58 | cd11839, SH3_Intersectin_4, Fourth Src homology 3 | 5e-06 | |
| cd11818 | 50 | cd11818, SH3_Eve1_5, Fifth Src homology 3 domain o | 6e-06 | |
| cd11817 | 50 | cd11817, SH3_Eve1_4, Fourth Src homology 3 domain | 6e-06 | |
| cd11816 | 51 | cd11816, SH3_Eve1_3, Third Src homology 3 domain o | 8e-06 | |
| cd12073 | 55 | cd12073, SH3_HS1, Src homology 3 domain of Hematop | 8e-06 | |
| cd11930 | 55 | cd11930, SH3_SH3RF1_2, Second Src Homology 3 domai | 1e-05 | |
| cd11762 | 57 | cd11762, SH3_FCHSD_2, Second Src Homology 3 domain | 1e-05 | |
| cd11769 | 57 | cd11769, SH3_CSK, Src Homology 3 domain of C-termi | 1e-05 | |
| cd11830 | 54 | cd11830, SH3_VAV_2, C-terminal (or second) Src hom | 1e-05 | |
| cd11946 | 56 | cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom | 1e-05 | |
| cd11955 | 53 | cd11955, SH3_srGAP1-3, Src homology 3 domain of Sl | 1e-05 | |
| cd11950 | 53 | cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do | 2e-05 | |
| cd11851 | 62 | cd11851, SH3_RIM-BP, Src homology 3 domains of Rab | 2e-05 | |
| cd11824 | 53 | cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro | 2e-05 | |
| cd11810 | 50 | cd11810, SH3_RUSC1_like, Src homology 3 domain of | 2e-05 | |
| cd11821 | 53 | cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP | 3e-05 | |
| cd11889 | 53 | cd11889, SH3_Cyk3p-like, Src Homology 3 domain of | 3e-05 | |
| cd11827 | 53 | cd11827, SH3_MyoIe_If_like, Src homology 3 domain | 4e-05 | |
| cd11882 | 54 | cd11882, SH3_GRAF-like, Src Homology 3 domain of G | 4e-05 | |
| cd11977 | 58 | cd11977, SH3_VAV2_2, C-terminal (or second) Src ho | 5e-05 | |
| cd11931 | 55 | cd11931, SH3_SH3RF3_2, Second Src Homology 3 domai | 5e-05 | |
| cd12047 | 53 | cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 do | 5e-05 | |
| cd12054 | 55 | cd12054, SH3_CD2AP_2, Second Src Homology 3 domain | 6e-05 | |
| cd11785 | 55 | cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homo | 6e-05 | |
| cd12055 | 53 | cd12055, SH3_CIN85_2, Second Src Homology 3 domain | 6e-05 | |
| cd11837 | 53 | cd11837, SH3_Intersectin_2, Second Src homology 3 | 7e-05 | |
| cd11976 | 54 | cd11976, SH3_VAV1_2, C-terminal (or second) Src ho | 7e-05 | |
| cd11838 | 52 | cd11838, SH3_Intersectin_3, Third Src homology 3 d | 9e-05 | |
| cd12044 | 53 | cd12044, SH3_SKAP1, Src Homology 3 domain of Src K | 9e-05 | |
| cd12056 | 57 | cd12056, SH3_CD2AP_3, Third Src Homology 3 domain | 9e-05 | |
| cd11789 | 55 | cd11789, SH3_Nebulin_family_C, C-terminal Src Homo | 9e-05 | |
| cd11763 | 55 | cd11763, SH3_SNX9_like, Src Homology 3 domain of S | 1e-04 | |
| cd11813 | 53 | cd11813, SH3_SGSM3, Src Homology 3 domain of Small | 1e-04 | |
| cd11836 | 55 | cd11836, SH3_Intersectin_1, First Src homology 3 d | 1e-04 | |
| cd12013 | 61 | cd12013, SH3_RIM-BP_3, Third Src homology 3 domain | 1e-04 | |
| cd11978 | 56 | cd11978, SH3_VAV3_2, C-terminal (or second) Src ho | 1e-04 | |
| cd11843 | 53 | cd11843, SH3_PACSIN, Src homology 3 domain of Prot | 1e-04 | |
| cd12012 | 62 | cd12012, SH3_RIM-BP_2, Second Src homology 3 domai | 1e-04 | |
| cd11991 | 52 | cd11991, SH3_Intersectin1_3, Third Src homology 3 | 1e-04 | |
| cd11778 | 51 | cd11778, SH3_Bzz1_2, Second Src Homology 3 domain | 1e-04 | |
| cd11825 | 54 | cd11825, SH3_PLCgamma, Src homology 3 domain of Ph | 2e-04 | |
| cd12045 | 53 | cd12045, SH3_SKAP2, Src Homology 3 domain of Src K | 2e-04 | |
| cd11947 | 52 | cd11947, SH3_GRAP2_N, N-terminal Src homology 3 do | 2e-04 | |
| cd11866 | 53 | cd11866, SH3_SKAP1-like, Src Homology 3 domain of | 2e-04 | |
| cd11901 | 55 | cd11901, SH3_Nck1_2, Second Src Homology 3 domain | 2e-04 | |
| cd11771 | 60 | cd11771, SH3_Pex13p_fungal, Src Homology 3 domain | 3e-04 | |
| cd11793 | 55 | cd11793, SH3_ephexin1_like, Src homology 3 domain | 3e-04 | |
| cd11828 | 53 | cd11828, SH3_ARHGEF9_like, Src homology 3 domain o | 4e-04 | |
| cd11902 | 55 | cd11902, SH3_Nck2_2, Second Src Homology 3 domain | 4e-04 | |
| cd11887 | 60 | cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 a | 4e-04 | |
| cd11915 | 59 | cd11915, SH3_Irsp53, Src Homology 3 domain of Insu | 4e-04 | |
| cd12052 | 53 | cd12052, SH3_CIN85_1, First Src Homology 3 domain | 5e-04 | |
| cd11933 | 58 | cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 | 7e-04 | |
| cd11780 | 55 | cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Ho | 8e-04 | |
| cd11990 | 52 | cd11990, SH3_Intersectin2_2, Second Src homology 3 | 9e-04 | |
| cd11934 | 59 | cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do | 0.001 | |
| cd11855 | 55 | cd11855, SH3_Sho1p, Src homology 3 domain of High | 0.001 | |
| cd11958 | 51 | cd11958, SH3_RUSC1, Src homology 3 domain of RUN a | 0.001 | |
| cd11883 | 55 | cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 | 0.001 | |
| cd11782 | 53 | cd11782, SH3_Sorbs_2, Second Src Homology 3 domain | 0.002 | |
| cd11975 | 62 | cd11975, SH3_ARHGEF9, Src homology 3 domain of the | 0.002 | |
| cd11845 | 52 | cd11845, SH3_Src_like, Src homology 3 domain of Sr | 0.002 | |
| cd11759 | 57 | cd11759, SH3_CRK_C, C-terminal Src Homology 3 doma | 0.002 | |
| cd12059 | 58 | cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixe | 0.002 | |
| cd11993 | 65 | cd11993, SH3_Intersectin1_4, Fourth Src homology 3 | 0.002 | |
| cd11833 | 53 | cd11833, SH3_Stac_1, First C-terminal Src homology | 0.003 | |
| cd11757 | 52 | cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 | 0.003 | |
| cd11948 | 54 | cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom | 0.003 | |
| cd11988 | 57 | cd11988, SH3_Intersectin2_1, First Src homology 3 | 0.003 | |
| cd11957 | 52 | cd11957, SH3_RUSC2, Src homology 3 domain of RUN a | 0.003 | |
| cd11926 | 55 | cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain | 0.004 |
| >gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
Score = 78.2 bits (193), Expect = 2e-19
Identities = 29/42 (69%), Positives = 36/42 (85%)
Query: 76 NFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEI 117
+ ELS KKGDII++RRQ+DKNWYEGEHN +G+FP +YVEI
Sbjct: 12 SAKELSLKKGDIIYIRRQIDKNWYEGEHNGRVGIFPASYVEI 53
|
This family, also called the vinexin family, is composed predominantly of adaptor proteins containing one sorbin homology (SoHo) and three SH3 domains. Members include the first SH3 domains of Sorbs1 (or ponsin), Sorbs2 (or ArgBP2), Vinexin (or Sorbs3), and similar domains. They are involved in the regulation of cytoskeletal organization, cell adhesion, and growth factor signaling. Members of this family bind multiple partners including signaling molecules like c-Abl, c-Arg, Sos, and c-Cbl, as well as cytoskeletal molecules such as vinculin and afadin. They may have overlapping functions. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 53 |
| >gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A | Back alignment and domain information |
|---|
| >gnl|CDD|212854 cd11921, SH3_Vinexin_1, First Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) | Back alignment and domain information |
|---|
| >gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|214620 smart00326, SH3, Src homology 3 domains | Back alignment and domain information |
|---|
| >gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin | Back alignment and domain information |
|---|
| >gnl|CDD|212862 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212861 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212721 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain of SH3 domain containing ring finger proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase Activating Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) | Back alignment and domain information |
|---|
| >gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules | Back alignment and domain information |
|---|
| >gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer | Back alignment and domain information |
|---|
| >gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212855 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin | Back alignment and domain information |
|---|
| >gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor | Back alignment and domain information |
|---|
| >gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein | Back alignment and domain information |
|---|
| >gnl|CDD|212865 cd11932, SH3_SH3RF2_2, Second Src Homology 3 domain of SH3 domain containing ring finger 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of the p67phox subunit of NADPH oxidase and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin | Back alignment and domain information |
|---|
| >gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|215659 pfam00018, SH3_1, SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|212749 cd11815, SH3_Eve1_2, Second Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212763 cd11829, SH3_GAS7, Src homology 3 domain of Growth Arrest Specific protein 7 | Back alignment and domain information |
|---|
| >gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212857 cd11924, SH3_Vinexin_2, Second Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) | Back alignment and domain information |
|---|
| >gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba | Back alignment and domain information |
|---|
| >gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212817 cd11884, SH3_MYO15, Src Homology 3 domain of Myosin XV | Back alignment and domain information |
|---|
| >gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212773 cd11839, SH3_Intersectin_4, Fourth Src homology 3 domain (or SH3D) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding protein Eve-1 | Back alignment and domain information |
|---|
| >gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212863 cd11930, SH3_SH3RF1_2, Second Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and double SH3 domains proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase Activating Proteins 1, 2, and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212785 cd11851, SH3_RIM-BP, Src homology 3 domains of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212744 cd11810, SH3_RUSC1_like, Src homology 3 domain of RUN and SH3 domain-containing proteins 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212822 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of Cytokinesis protein 3 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212864 cd11931, SH3_SH3RF3_2, Second Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
| >gnl|CDD|212980 cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 domain of NADPH oxidase activator 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212719 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212988 cd12055, SH3_CIN85_2, Second Src Homology 3 domain (SH3B) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212977 cd12044, SH3_SKAP1, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein | Back alignment and domain information |
|---|
| >gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein Signaling Modulator 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A) of Intersectin | Back alignment and domain information |
|---|
| >gnl|CDD|212946 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain of VAV3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212945 cd12012, SH3_RIM-BP_2, Second Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or SH3C) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C (PLC) gamma | Back alignment and domain information |
|---|
| >gnl|CDD|212978 cd12045, SH3_SKAP2, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212800 cd11866, SH3_SKAP1-like, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p | Back alignment and domain information |
|---|
| >gnl|CDD|212727 cd11793, SH3_ephexin1_like, Src homology 3 domain of ephexin-1-like SH3 domain containing Rho guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212835 cd11902, SH3_Nck2_2, Second Src Homology 3 domain of Nck2 adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212848 cd11915, SH3_Irsp53, Src Homology 3 domain of Insulin Receptor tyrosine kinase Substrate p53 | Back alignment and domain information |
|---|
| >gnl|CDD|212985 cd12052, SH3_CIN85_1, First Src Homology 3 domain (SH3A) of Cbl-interacting protein of 85 kDa | Back alignment and domain information |
|---|
| >gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin | Back alignment and domain information |
|---|
| >gnl|CDD|212714 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212923 cd11990, SH3_Intersectin2_2, Second Src homology 3 domain (or SH3B) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity signaling protein Sho1p | Back alignment and domain information |
|---|
| >gnl|CDD|212891 cd11958, SH3_RUSC1, Src homology 3 domain of RUN and SH3 domain-containing protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors | Back alignment and domain information |
|---|
| >gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine nucleotide exchange factor ARHGEF9 | Back alignment and domain information |
|---|
| >gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212693 cd11759, SH3_CRK_C, C-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases 1, 2, and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|212926 cd11993, SH3_Intersectin1_4, Fourth Src homology 3 domain (or SH3D) of Intersectin-1 | Back alignment and domain information |
|---|
| >gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212691 cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 domain-binding protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein | Back alignment and domain information |
|---|
| >gnl|CDD|212921 cd11988, SH3_Intersectin2_1, First Src homology 3 domain (or SH3A) of Intersectin-2 | Back alignment and domain information |
|---|
| >gnl|CDD|212890 cd11957, SH3_RUSC2, Src homology 3 domain of RUN and SH3 domain-containing protein 2 | Back alignment and domain information |
|---|
| >gnl|CDD|212859 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1, an E3 ubiquitin-protein ligase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 225 | |||
| KOG4225|consensus | 489 | 99.72 | ||
| KOG1029|consensus | 1118 | 99.65 | ||
| KOG4226|consensus | 379 | 99.64 | ||
| KOG4348|consensus | 627 | 99.63 | ||
| PF14604 | 49 | SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 | 99.63 | |
| KOG4348|consensus | 627 | 99.62 | ||
| KOG1029|consensus | 1118 | 99.55 | ||
| PF07653 | 55 | SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 | 99.52 | |
| KOG2199|consensus | 462 | 99.45 | ||
| KOG2070|consensus | 661 | 99.38 | ||
| KOG3601|consensus | 222 | 99.36 | ||
| PF00018 | 48 | SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho | 99.32 | |
| KOG1118|consensus | 366 | 99.32 | ||
| smart00326 | 58 | SH3 Src homology 3 domains. Src homology 3 (SH3) d | 99.25 | |
| KOG4226|consensus | 379 | 99.25 | ||
| KOG4792|consensus | 293 | 99.22 | ||
| cd00174 | 54 | SH3 Src homology 3 domains; SH3 domains bind to pr | 99.2 | |
| KOG4225|consensus | 489 | 99.15 | ||
| KOG0162|consensus | 1106 | 99.15 | ||
| KOG2996|consensus | 865 | 99.14 | ||
| KOG1264|consensus | 1267 | 99.12 | ||
| KOG3632|consensus | 1335 | 99.01 | ||
| KOG2856|consensus | 472 | 98.9 | ||
| KOG2546|consensus | 483 | 98.84 | ||
| KOG4278|consensus | 1157 | 98.73 | ||
| KOG3601|consensus | 222 | 98.65 | ||
| KOG0515|consensus | 752 | 98.62 | ||
| KOG3875|consensus | 362 | 98.51 | ||
| KOG3655|consensus | 484 | 98.51 | ||
| KOG0197|consensus | 468 | 98.51 | ||
| KOG1702|consensus | 264 | 98.47 | ||
| KOG1843|consensus | 473 | 98.35 | ||
| KOG0609|consensus | 542 | 98.31 | ||
| KOG2996|consensus | 865 | 98.27 | ||
| KOG2222|consensus | 848 | 98.11 | ||
| KOG3523|consensus | 695 | 97.94 | ||
| PF14604 | 49 | SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 | 97.81 | |
| KOG4792|consensus | 293 | 97.64 | ||
| KOG2528|consensus | 490 | 97.63 | ||
| KOG1451|consensus | 812 | 97.6 | ||
| KOG4773|consensus | 386 | 97.6 | ||
| KOG3775|consensus | 482 | 97.54 | ||
| PF07653 | 55 | SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 | 97.47 | |
| PF00018 | 48 | SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho | 97.43 | |
| KOG3632|consensus | 1335 | 97.35 | ||
| KOG3557|consensus | 721 | 97.34 | ||
| KOG4575|consensus | 874 | 97.34 | ||
| KOG4429|consensus | 421 | 97.26 | ||
| KOG2199|consensus | 462 | 97.23 | ||
| KOG3771|consensus | 460 | 97.04 | ||
| KOG2070|consensus | 661 | 96.93 | ||
| KOG3725|consensus | 375 | 96.41 | ||
| KOG1118|consensus | 366 | 96.39 | ||
| KOG0162|consensus | 1106 | 96.38 | ||
| cd00174 | 54 | SH3 Src homology 3 domains; SH3 domains bind to pr | 96.29 | |
| smart00326 | 58 | SH3 Src homology 3 domains. Src homology 3 (SH3) d | 96.28 | |
| KOG0515|consensus | 752 | 96.26 | ||
| KOG2546|consensus | 483 | 95.8 | ||
| KOG2856|consensus | 472 | 95.75 | ||
| PF08239 | 55 | SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S | 95.63 | |
| KOG3565|consensus | 640 | 94.77 | ||
| PF14603 | 89 | hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. | 94.55 | |
| KOG0199|consensus | 1039 | 94.27 | ||
| KOG1264|consensus | 1267 | 94.09 | ||
| smart00287 | 63 | SH3b Bacterial SH3 domain homologues. | 93.53 | |
| KOG1702|consensus | 264 | 93.11 | ||
| KOG0040|consensus | 2399 | 92.45 | ||
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 91.52 | |
| PF06347 | 55 | SH3_4: Bacterial SH3 domain; InterPro: IPR010466 S | 90.79 | |
| KOG3812|consensus | 475 | 90.77 | ||
| KOG3705|consensus | 580 | 87.07 | ||
| PF00017 | 77 | SH2: SH2 domain; InterPro: IPR000980 The Src homol | 86.86 | |
| KOG4429|consensus | 421 | 86.65 | ||
| KOG3655|consensus | 484 | 84.14 | ||
| KOG2222|consensus | 848 | 83.89 | ||
| KOG3875|consensus | 362 | 83.14 | ||
| PRK13914 | 481 | invasion associated secreted endopeptidase; Provis | 82.56 | |
| smart00252 | 84 | SH2 Src homology 2 domains. Src homology 2 domains | 81.05 | |
| KOG4773|consensus | 386 | 80.74 | ||
| KOG1843|consensus | 473 | 80.51 | ||
| cd00173 | 94 | SH2 Src homology 2 domains; Signal transduction, i | 80.06 |
| >KOG4225|consensus | Back alignment and domain information |
|---|
Probab=99.72 E-value=2.2e-17 Score=143.91 Aligned_cols=107 Identities=39% Similarity=0.681 Sum_probs=90.9
Q ss_pred EEEeecccCCCCCCCCccccccCCCeEEEEEecCCCeEEEEECCeEEEeeCCcEEeecCCCC----CCCc-CCCCcCcEE
Q psy15850 62 LQELHDISSRRHTDNFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKI----RTAP-KKLSEGQAR 136 (225)
Q Consensus 62 ~~al~d~~~~~~~~~~~eLs~~~Gdii~v~~~~~~~Ww~g~~~g~~G~~P~nyv~~~~~~~~----~~~~-~~~~~~~~~ 136 (225)
++|+|+|.++ ...||+|++||||.|+.+.|.+|+.|+.+|+.|+||+|||+.+..... .+.| +....|.++
T Consensus 233 aralf~F~~q----t~kEL~~~kGDIVyI~rkvD~nWyeGEhhGr~GifP~sYvE~~~~~e~~qP~~~~P~q~~~~g~a~ 308 (489)
T KOG4225|consen 233 ARALFDFEAQ----TPKELPFNKGDIVYILRKVDQNWYEGEHHGRVGIFPASYVEILTPREKAQPARPPPQQVLEQGEAI 308 (489)
T ss_pred hhheeccccC----CccccccCCCCEEEEEeeccCceeeeeecceecceechheeecCcccccCcCCCCccccccccccc
Confidence 7899999999 788999999999999999999999999999999999999999875221 2222 223577899
Q ss_pred EcccccCCCccccccccccceEEecccccccccccch
Q psy15850 137 AKFNFVAQTHLELSLVKESPHKYVDSEVTLQYRRPVR 173 (225)
Q Consensus 137 a~~~~~~~~~~els~~~g~~v~~~~~~~~~~~~f~~~ 173 (225)
|.|+|.+....||++++|+.|+.... +++.|..+.+
T Consensus 309 A~y~F~~~s~~Els~~kge~v~L~r~-vd~nw~eG~i 344 (489)
T KOG4225|consen 309 AKYNFNADSPVELSLRKGERVTLTRQ-VDENWYEGKI 344 (489)
T ss_pred ccCCCCCCCchhcccccCceEEEEEe-ccCceeeccc
Confidence 99999999999999999999998875 6666664333
|
|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A | Back alignment and domain information |
|---|
| >KOG4348|consensus | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
| >PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG2199|consensus | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG1118|consensus | Back alignment and domain information |
|---|
| >smart00326 SH3 Src homology 3 domains | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies | Back alignment and domain information |
|---|
| >KOG4225|consensus | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG2856|consensus | Back alignment and domain information |
|---|
| >KOG2546|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >KOG3875|consensus | Back alignment and domain information |
|---|
| >KOG3655|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG1843|consensus | Back alignment and domain information |
|---|
| >KOG0609|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG2222|consensus | Back alignment and domain information |
|---|
| >KOG3523|consensus | Back alignment and domain information |
|---|
| >PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG2528|consensus | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >KOG4773|consensus | Back alignment and domain information |
|---|
| >KOG3775|consensus | Back alignment and domain information |
|---|
| >PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG3557|consensus | Back alignment and domain information |
|---|
| >KOG4575|consensus | Back alignment and domain information |
|---|
| >KOG4429|consensus | Back alignment and domain information |
|---|
| >KOG2199|consensus | Back alignment and domain information |
|---|
| >KOG3771|consensus | Back alignment and domain information |
|---|
| >KOG2070|consensus | Back alignment and domain information |
|---|
| >KOG3725|consensus | Back alignment and domain information |
|---|
| >KOG1118|consensus | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies | Back alignment and domain information |
|---|
| >smart00326 SH3 Src homology 3 domains | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >KOG2546|consensus | Back alignment and domain information |
|---|
| >KOG2856|consensus | Back alignment and domain information |
|---|
| >PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG3565|consensus | Back alignment and domain information |
|---|
| >PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A | Back alignment and domain information |
|---|
| >KOG0199|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >smart00287 SH3b Bacterial SH3 domain homologues | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG0040|consensus | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF06347 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] | Back alignment and domain information |
|---|
| >KOG3812|consensus | Back alignment and domain information |
|---|
| >KOG3705|consensus | Back alignment and domain information |
|---|
| >PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] | Back alignment and domain information |
|---|
| >KOG4429|consensus | Back alignment and domain information |
|---|
| >KOG3655|consensus | Back alignment and domain information |
|---|
| >KOG2222|consensus | Back alignment and domain information |
|---|
| >KOG3875|consensus | Back alignment and domain information |
|---|
| >PRK13914 invasion associated secreted endopeptidase; Provisional | Back alignment and domain information |
|---|
| >smart00252 SH2 Src homology 2 domains | Back alignment and domain information |
|---|
| >KOG4773|consensus | Back alignment and domain information |
|---|
| >KOG1843|consensus | Back alignment and domain information |
|---|
| >cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 225 | ||||
| 2dlm_A | 68 | Solution Structure Of The First Sh3 Domain Of Human | 2e-10 | ||
| 2nwm_A | 65 | Solution Structure Of The First Sh3 Domain Of Human | 4e-10 | ||
| 2dl3_A | 68 | Solution Structure Of The First Sh3 Domain Of Human | 2e-09 | ||
| 2djq_A | 68 | The Solution Structure Of The First Sh3 Domain Of M | 4e-09 | ||
| 2dbm_A | 73 | Solution Structures Of The Sh3 Domain Of Human Sh3- | 1e-08 | ||
| 3iql_A | 71 | Crystal Structure Of The Rat Endophilin-A1 Sh3 Doma | 1e-08 | ||
| 2ew3_A | 68 | Solution Structure Of The Sh3 Domain Of Human Sh3gl | 1e-08 | ||
| 2ed0_A | 78 | Solution Structure Of The Sh3 Domain Of Abl Interac | 9e-08 | ||
| 1gri_A | 217 | Grb2 Length = 217 | 2e-07 | ||
| 1gri_A | 217 | Grb2 Length = 217 | 2e-06 | ||
| 3c0c_A | 73 | X-Ray Crystal Structure Of The Rat Endophilin A2 Sh | 3e-07 | ||
| 3gf9_A | 295 | Crystal Structure Of Human Intersectin 2 Rhogef Dom | 4e-07 | ||
| 1udl_A | 98 | The Solution Structure Of The Fifth Sh3 Domain Of I | 2e-06 | ||
| 2df6_A | 59 | Crystal Structure Of The Sh3 Domain Of Betapix In C | 2e-06 | ||
| 2dyb_A | 341 | The Crystal Structure Of Human P40(Phox) Length = 3 | 2e-06 | ||
| 2esw_A | 61 | Atomic Structure Of The N-Terminal Sh3 Domain Of Mo | 2e-06 | ||
| 3jv3_A | 283 | Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l | 2e-06 | ||
| 2ak5_A | 64 | Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length | 3e-06 | ||
| 1sem_A | 58 | Structural Determinants Of Peptide-Binding Orientat | 4e-06 | ||
| 1x2q_A | 88 | Solution Structure Of The Sh3 Domain Of The Signal | 4e-06 | ||
| 3sem_A | 60 | Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Le | 5e-06 | ||
| 1z9q_A | 79 | Solution Structure Of Sh3 Domain Of P40phox Length | 6e-06 | ||
| 1k76_A | 62 | Solution Structure Of The C-Terminal Sem-5 Sh3 Doma | 8e-06 | ||
| 1w6x_A | 60 | Sh3 Domain Of P40phox, Component Of The Nadph Oxida | 1e-05 | ||
| 2ecz_A | 70 | Solution Structure Of The Sh3 Domain Of Sorbin And | 1e-05 | ||
| 2epd_A | 76 | Solution Structure Of Sh3 Domain In Rho-Gtpase-Acti | 2e-05 | ||
| 2o2w_A | 67 | Extending Powder Diffraction To Proteins: Structure | 2e-05 | ||
| 1ujy_A | 76 | Solution Structure Of Sh3 Domain In RacCDC42 GUANIN | 2e-05 | ||
| 2l0a_A | 72 | Solution Nmr Structure Of Signal Transducing Adapte | 3e-05 | ||
| 4gbq_A | 74 | Solution Nmr Structure Of The Grb2 N-Terminal Sh3 D | 3e-05 | ||
| 2vwf_A | 58 | Grb2 Sh3c (2) Length = 58 | 5e-05 | ||
| 1io6_A | 59 | Growth Factor Receptor-Bound Protein 2 (Grb2) C-Ter | 5e-05 | ||
| 1gcq_A | 61 | Crystal Structure Of Vav And Grb2 Sh3 Domains Lengt | 5e-05 | ||
| 1zsg_A | 65 | Beta Pix-Sh3 Complexed With An Atypical Peptide Fro | 9e-05 | ||
| 2yun_A | 79 | Solution Structure Of The Sh3 Domain Of Human Nostr | 1e-04 | ||
| 2vvk_A | 56 | Grb2 Sh3c (1) Length = 56 | 1e-04 | ||
| 2dl8_A | 72 | Solution Structure Of The Sh3 Domain Of Human Slit- | 1e-04 | ||
| 2ydl_A | 69 | Crystal Structure Of Sh3c From Cin85 Length = 69 | 1e-04 | ||
| 2k6d_A | 62 | Cin85 Sh3-C Domain In Complex With Ubiquitin Length | 1e-04 | ||
| 1zlm_A | 58 | Crystal Structure Of The Sh3 Domain Of Human Osteoc | 2e-04 | ||
| 1x2k_A | 68 | Solution Structure Of The Sh3 Domain Of Human Osteo | 2e-04 | ||
| 2o2o_A | 92 | Solution Structure Of Domain B From Human Cin85 Pro | 2e-04 | ||
| 1uj0_A | 62 | Crystal Structure Of Stam2 Sh3 Domain In Complex Wi | 2e-04 | ||
| 2k9g_A | 73 | Solution Structure Of The Third Sh3 Domain Of The C | 2e-04 | ||
| 2yup_A | 90 | Solution Structure Of The Second Sh3 Domain Of Huma | 2e-04 | ||
| 2gnc_A | 60 | Crystal Structure Of Srgap1 Sh3 Domain In The Slit- | 2e-04 | ||
| 2drk_A | 59 | Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L | 2e-04 | ||
| 2drm_A | 58 | Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L | 2e-04 | ||
| 1oot_A | 60 | Crystal Structure Of The Sh3 Domain From A S. Cerev | 3e-04 | ||
| 2yuo_A | 78 | Solution Structure Of The Sh3 Domain Of Mouse Run A | 3e-04 | ||
| 2a08_A | 60 | Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 | 4e-04 | ||
| 1aze_A | 56 | Nmr Structure Of The Complex Between The C32s-Y7v M | 4e-04 | ||
| 3ehq_A | 222 | Crystal Structure Of Human Osteoclast Stimulating F | 4e-04 | ||
| 1wi7_A | 68 | Solution Structure Of The Sh3 Domain Of Sh3-Domain | 5e-04 | ||
| 3u23_A | 65 | Atomic Resolution Crystal Structure Of The 2nd Sh3 | 5e-04 | ||
| 2fei_A | 65 | Solution Structure Of The Second Sh3 Domain Of Huma | 5e-04 | ||
| 2kbt_A | 142 | Attachment Of An Nmr-Invisible Solubility Enhanceme | 7e-04 | ||
| 1k4u_S | 62 | Solution Structure Of The C-Terminal Sh3 Domain Of | 9e-04 |
| >pdb|2DLM|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Vinexin Length = 68 | Back alignment and structure |
|
| >pdb|2NWM|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Vinexin And Its Interaction With The Peptides From Vinculin Length = 65 | Back alignment and structure |
| >pdb|2DL3|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Sorbin And Sh3 Domain-Containing Protein 1 Length = 68 | Back alignment and structure |
| >pdb|2DJQ|A Chain A, The Solution Structure Of The First Sh3 Domain Of Mouse Sh3 Domain Containing Ring Finger 2 Length = 68 | Back alignment and structure |
| >pdb|2DBM|A Chain A, Solution Structures Of The Sh3 Domain Of Human Sh3- Containing Grb2-Like Protein 2 Length = 73 | Back alignment and structure |
| >pdb|3IQL|A Chain A, Crystal Structure Of The Rat Endophilin-A1 Sh3 Domain Length = 71 | Back alignment and structure |
| >pdb|2EW3|A Chain A, Solution Structure Of The Sh3 Domain Of Human Sh3gl3 Length = 68 | Back alignment and structure |
| >pdb|2ED0|A Chain A, Solution Structure Of The Sh3 Domain Of Abl Interactor 2 (Abelson Interactor 2) Length = 78 | Back alignment and structure |
| >pdb|1GRI|A Chain A, Grb2 Length = 217 | Back alignment and structure |
| >pdb|1GRI|A Chain A, Grb2 Length = 217 | Back alignment and structure |
| >pdb|3C0C|A Chain A, X-Ray Crystal Structure Of The Rat Endophilin A2 Sh3 Domain Length = 73 | Back alignment and structure |
| >pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 | Back alignment and structure |
| >pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 | Back alignment and structure |
| >pdb|2DF6|A Chain A, Crystal Structure Of The Sh3 Domain Of Betapix In Complex With A High Affinity Peptide From Pak2 Length = 59 | Back alignment and structure |
| >pdb|2DYB|A Chain A, The Crystal Structure Of Human P40(Phox) Length = 341 | Back alignment and structure |
| >pdb|2ESW|A Chain A, Atomic Structure Of The N-Terminal Sh3 Domain Of Mouse Beta Pix,P21-Activated Kinase (Pak)-Interacting Exchange Factor Length = 61 | Back alignment and structure |
| >pdb|3JV3|A Chain A, Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l Length = 283 | Back alignment and structure |
| >pdb|2AK5|A Chain A, Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length = 64 | Back alignment and structure |
| >pdb|1SEM|A Chain A, Structural Determinants Of Peptide-Binding Orientation And Of Sequence Specificity In Sh3 Domains Length = 58 | Back alignment and structure |
| >pdb|1X2Q|A Chain A, Solution Structure Of The Sh3 Domain Of The Signal Transducing Adaptor Molecule 2 Length = 88 | Back alignment and structure |
| >pdb|3SEM|A Chain A, Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Length = 60 | Back alignment and structure |
| >pdb|1Z9Q|A Chain A, Solution Structure Of Sh3 Domain Of P40phox Length = 79 | Back alignment and structure |
| >pdb|1K76|A Chain A, Solution Structure Of The C-Terminal Sem-5 Sh3 Domain (Minimized Average Structure) Length = 62 | Back alignment and structure |
| >pdb|1W6X|A Chain A, Sh3 Domain Of P40phox, Component Of The Nadph Oxidase Length = 60 | Back alignment and structure |
| >pdb|2ECZ|A Chain A, Solution Structure Of The Sh3 Domain Of Sorbin And Sh3 Domain-Containing Protein 1 Length = 70 | Back alignment and structure |
| >pdb|2EPD|A Chain A, Solution Structure Of Sh3 Domain In Rho-Gtpase-Activating Protein 4 Length = 76 | Back alignment and structure |
| >pdb|2O2W|A Chain A, Extending Powder Diffraction To Proteins: Structure Solution Of The Second Sh3 Domain From Ponsin Length = 67 | Back alignment and structure |
| >pdb|1UJY|A Chain A, Solution Structure Of Sh3 Domain In RacCDC42 GUANINE Nucleotide Exchange Factor(Gef) 6 Length = 76 | Back alignment and structure |
| >pdb|2L0A|A Chain A, Solution Nmr Structure Of Signal Transducing Adapter Molecule 1 Stam-1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4479e Length = 72 | Back alignment and structure |
| >pdb|4GBQ|A Chain A, Solution Nmr Structure Of The Grb2 N-Terminal Sh3 Domain Complexed With A Ten-Residue Peptide Derived From Sos Direct Refinement Against Noes, J-Couplings, And 1h And 13c Chemical Shifts, 15 Structures Length = 74 | Back alignment and structure |
| >pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 | Back alignment and structure |
| >pdb|1IO6|A Chain A, Growth Factor Receptor-Bound Protein 2 (Grb2) C-Terminal Sh3 Domain Complexed With A Ligand Peptide (Nmr, Minimized Mean Structure) Length = 59 | Back alignment and structure |
| >pdb|1GCQ|A Chain A, Crystal Structure Of Vav And Grb2 Sh3 Domains Length = 61 | Back alignment and structure |
| >pdb|1ZSG|A Chain A, Beta Pix-Sh3 Complexed With An Atypical Peptide From Alpha- Pak Length = 65 | Back alignment and structure |
| >pdb|2YUN|A Chain A, Solution Structure Of The Sh3 Domain Of Human Nostrin Length = 79 | Back alignment and structure |
| >pdb|2VVK|A Chain A, Grb2 Sh3c (1) Length = 56 | Back alignment and structure |
| >pdb|2DL8|A Chain A, Solution Structure Of The Sh3 Domain Of Human Slit-Robo Rho Gtpase-Activating Protein 2 Length = 72 | Back alignment and structure |
| >pdb|2YDL|A Chain A, Crystal Structure Of Sh3c From Cin85 Length = 69 | Back alignment and structure |
| >pdb|2K6D|A Chain A, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 62 | Back alignment and structure |
| >pdb|1ZLM|A Chain A, Crystal Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor Length = 58 | Back alignment and structure |
| >pdb|1X2K|A Chain A, Solution Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor 1 (Ostf1) Length = 68 | Back alignment and structure |
| >pdb|2O2O|A Chain A, Solution Structure Of Domain B From Human Cin85 Protein Length = 92 | Back alignment and structure |
| >pdb|1UJ0|A Chain A, Crystal Structure Of Stam2 Sh3 Domain In Complex With A Ubpy-Derived Peptide Length = 62 | Back alignment and structure |
| >pdb|2K9G|A Chain A, Solution Structure Of The Third Sh3 Domain Of The Cin85 Adapter Protein Length = 73 | Back alignment and structure |
| >pdb|2YUP|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Vinexin Length = 90 | Back alignment and structure |
| >pdb|2GNC|A Chain A, Crystal Structure Of Srgap1 Sh3 Domain In The Slit-Robo Signaling Pathway Length = 60 | Back alignment and structure |
| >pdb|2DRK|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 59 | Back alignment and structure |
| >pdb|2DRM|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 58 | Back alignment and structure |
| >pdb|1OOT|A Chain A, Crystal Structure Of The Sh3 Domain From A S. Cerevisiae Hypothetical 40.4 Kda Protein At 1.39 A Resolution Length = 60 | Back alignment and structure |
| >pdb|2YUO|A Chain A, Solution Structure Of The Sh3 Domain Of Mouse Run And Tbc1 Domain Containing 3 Length = 78 | Back alignment and structure |
| >pdb|2A08|A Chain A, Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 | Back alignment and structure |
| >pdb|1AZE|A Chain A, Nmr Structure Of The Complex Between The C32s-Y7v Mutant Of The Nsh3 Domain Of Grb2 With A Peptide From Sos, 10 Structures Length = 56 | Back alignment and structure |
| >pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 | Back alignment and structure |
| >pdb|1WI7|A Chain A, Solution Structure Of The Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 Length = 68 | Back alignment and structure |
| >pdb|3U23|A Chain A, Atomic Resolution Crystal Structure Of The 2nd Sh3 Domain From Human Cd2ap (Cms) In Complex With A Proline-Rich Peptide From Human Rin3 Length = 65 | Back alignment and structure |
| >pdb|2FEI|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Cms Protein Length = 65 | Back alignment and structure |
| >pdb|2KBT|A Chain A, Attachment Of An Nmr-Invisible Solubility Enhancement Tag (Inset) Using A Sortase-Mediated Protein Ligation Method Length = 142 | Back alignment and structure |
| >pdb|1K4U|S Chain S, Solution Structure Of The C-Terminal Sh3 Domain Of P67phox Complexed With The C-Terminal Tail Region Of P47phox Length = 62 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 225 | |||
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 2e-21 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 3e-21 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 5e-21 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 5e-21 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} Length | 7e-21 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 2e-20 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 4e-20 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 5e-20 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 6e-20 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 6e-20 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 7e-20 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 7e-20 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 1e-19 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 2e-19 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 3e-19 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 3e-19 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 3e-19 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 5e-19 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 8e-19 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 1e-18 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 1e-18 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 1e-10 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 2e-18 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 4e-18 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 4e-18 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 5e-18 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 5e-18 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 5e-18 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 5e-18 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 1e-17 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 5e-09 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 1e-17 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 2e-17 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 2e-17 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 2e-17 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 2e-17 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 2e-17 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 3e-17 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 4e-17 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 4e-17 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 6e-17 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 8e-17 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 9e-17 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 1e-16 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 1e-16 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 1e-16 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 2e-16 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 2e-16 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 3e-16 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 3e-16 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 3e-16 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 3e-16 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 4e-16 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 5e-16 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 5e-16 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 5e-16 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 5e-16 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 5e-16 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 6e-16 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 7e-16 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 1e-15 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 1e-15 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 1e-15 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 1e-15 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 1e-15 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 2e-15 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 2e-15 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 2e-15 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 3e-15 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 3e-15 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 4e-15 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 4e-15 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 4e-15 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 7e-15 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 9e-15 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 9e-15 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 1e-14 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 1e-14 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 1e-14 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 2e-14 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 2e-14 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 2e-14 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 2e-14 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 4e-14 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 4e-14 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 5e-14 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 6e-14 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 7e-14 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 8e-14 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 1e-13 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 1e-13 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 1e-13 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 1e-13 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 1e-13 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 1e-13 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 2e-13 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 2e-13 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 2e-13 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 3e-13 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 4e-13 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 5e-13 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 6e-13 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 6e-13 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 9e-13 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 9e-13 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 4e-10 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 7e-06 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 1e-12 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 1e-12 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 1e-12 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 2e-12 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 2e-12 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 2e-12 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 2e-12 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 3e-12 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 3e-12 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 4e-12 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 4e-12 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 4e-08 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 6e-12 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 6e-12 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 7e-12 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 2e-11 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 5e-07 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 2e-11 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 2e-11 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 6e-11 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 7e-11 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 8e-11 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 8e-11 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 1e-10 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 1e-10 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 2e-10 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 2e-10 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 2e-10 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 3e-10 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 3e-10 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 4e-10 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 4e-10 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 4e-10 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 4e-10 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 5e-10 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 5e-10 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 7e-10 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 7e-10 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 9e-10 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 1e-09 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 1e-09 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 1e-09 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 2e-09 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 4e-09 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 4e-09 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 5e-09 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 7e-09 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 1e-08 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 5e-08 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 1e-08 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 1e-08 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 1e-08 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 1e-08 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 2e-08 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 2e-08 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 3e-08 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 3e-08 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 4e-08 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 7e-08 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 7e-08 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 7e-08 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 7e-08 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 8e-08 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 3e-07 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 4e-07 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 4e-07 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 5e-07 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 6e-07 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 2e-06 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 4e-06 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 5e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-06 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 1e-05 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 1e-05 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 2e-05 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 8e-05 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 1e-04 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 1e-04 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 4e-04 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 4e-04 |
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
Score = 83.4 bits (207), Expect = 2e-21
Identities = 22/41 (53%), Positives = 32/41 (78%)
Query: 79 ELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIP 119
+L F KGD+I +RRQ+D+NWY+GE N + G+FP + VE+I
Sbjct: 23 DLKFNKGDVILLRRQLDENWYQGEINGVSGIFPASSVEVIS 63
|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 | Back alignment and structure |
|---|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 225 | |||
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 99.84 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.78 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.75 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.73 | |
| 2lx7_A | 60 | GAS-7, growth arrest-specific protein 7; structura | 99.72 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 99.56 | |
| 2lj0_A | 65 | Sorbin and SH3 domain-containing protein 1; R85FL, | 99.71 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 99.69 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 99.68 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} | 99.68 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 99.67 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 99.67 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 99.67 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 99.66 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 99.66 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 99.66 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 99.66 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 99.66 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 99.66 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 99.66 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 99.65 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 99.65 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 99.65 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 99.65 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 99.65 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 99.64 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 99.64 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 99.64 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 99.64 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 99.64 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 99.64 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 99.64 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 99.64 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 99.64 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 99.64 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 99.64 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 99.64 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 99.64 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 99.64 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.64 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 99.64 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 99.64 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 99.63 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 99.63 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 99.63 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 99.63 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 99.63 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.63 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 99.63 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 99.63 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 99.63 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 99.63 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 99.63 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 99.63 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 99.63 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 99.62 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 99.62 | |
| 4glm_A | 72 | Dynamin-binding protein; SH3 domain, DNMBP, struct | 99.62 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 99.62 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 99.62 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 99.62 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 99.62 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 99.62 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 99.62 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.62 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 99.62 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 99.62 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.61 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 99.61 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.61 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 99.61 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 99.61 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 99.61 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.61 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 99.61 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 99.61 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 99.61 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 99.61 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 99.61 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 99.6 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 99.6 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 99.6 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 99.6 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 99.6 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 99.6 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.6 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 99.6 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 99.6 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 99.6 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 99.6 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 99.6 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 99.6 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 99.6 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 99.6 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 99.6 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 99.6 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 99.6 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 99.59 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 99.59 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 99.59 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.59 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 99.59 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 99.59 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 99.59 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 99.59 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 99.59 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.59 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 99.58 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 99.58 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 99.58 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 99.58 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 99.58 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 99.58 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 99.58 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 99.58 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.58 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 99.58 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 99.58 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 99.58 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.58 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 99.58 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 99.58 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 99.58 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.58 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 99.57 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 99.57 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 99.57 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 99.57 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 99.56 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 99.56 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 99.56 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 99.56 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 99.56 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 99.56 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 99.56 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 99.56 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 99.56 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 99.56 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 99.56 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 99.55 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 99.55 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.55 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 99.55 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 99.55 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 99.55 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 99.54 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 99.54 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 99.54 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 99.54 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 99.53 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 99.53 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 99.53 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 99.53 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 99.53 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 99.52 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 99.52 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 99.52 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 99.52 | |
| 2m0y_A | 74 | Dedicator of cytokinesis protein 1; apoptosis; NMR | 99.51 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 99.51 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 99.51 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.51 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 99.51 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 99.51 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 99.5 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 99.5 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.5 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 99.49 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 99.48 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 99.48 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 99.47 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 99.47 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.47 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 99.47 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.47 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 99.46 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 99.46 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 99.45 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 99.45 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.43 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 99.41 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 99.4 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 99.4 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 99.4 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.4 | |
| 1ng2_A | 193 | Neutrophil cytosolic factor 1; P47PHOX, autoinhibi | 99.36 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 99.35 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 99.31 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.3 | |
| 1v1c_A | 71 | Obscurin; muscle, sarcomere, adapter, myogenesis, | 99.29 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 99.27 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 99.25 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 98.82 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 99.17 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 99.17 | |
| 1udl_A | 98 | Intersectin 2, KIAA1256; beta barrel, SH3 domain, | 99.16 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 99.14 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.11 | |
| 1g2b_A | 62 | Spectrin alpha chain; capping protein, calcium-bin | 99.05 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 99.01 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 98.98 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 98.86 | |
| 1ri9_A | 102 | FYN-binding protein; SH3-like, helically extended, | 98.86 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 98.84 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 98.69 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 98.62 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 98.56 | |
| 2gtj_A | 96 | FYN-binding protein; SH3, redox, signaling protein | 98.56 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 98.54 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 98.51 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 98.46 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 98.43 | |
| 3pe0_A | 283 | Plectin; cytoskeleton, plakin, spectrin repeat, SH | 98.32 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 98.3 | |
| 2i0n_A | 80 | Class VII unconventional myosin; beta-sheet loop, | 98.15 | |
| 2a28_A | 54 | BZZ1 protein; SH3 domain, signaling protein; 1.07A | 98.08 | |
| 2lj0_A | 65 | Sorbin and SH3 domain-containing protein 1; R85FL, | 98.01 | |
| 2lx7_A | 60 | GAS-7, growth arrest-specific protein 7; structura | 98.01 | |
| 1x43_A | 81 | Endophilin B1, SH3 domain GRB2-like protein B1; st | 98.0 | |
| 3c0c_A | 73 | Endophilin-A2; endocytosis, SH3, voltage-gated cal | 98.0 | |
| 2nwm_A | 65 | Vinexin; cell adhesion; NMR {Homo sapiens} | 97.99 | |
| 2j6f_A | 62 | CD2-associated protein; metal-binding, immune resp | 97.99 | |
| 1ugv_A | 72 | KIAA0621, olygophrenin-1 like protein; beta barrel | 97.98 | |
| 2ed0_A | 78 | ABL interactor 2; coiled coil, cytoskeleton, nucle | 97.97 | |
| 1k4u_S | 62 | Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti | 97.97 | |
| 2gnc_A | 60 | SLIT-ROBO RHO GTPase-activating protein 1; beta ba | 97.97 | |
| 2g6f_X | 59 | RHO guanine nucleotide exchange factor 7; SH3 doma | 97.96 | |
| 2ew3_A | 68 | SH3-containing GRB2-like protein 3; SH3GL3, soluti | 97.96 | |
| 1jo8_A | 58 | ABP1P, actin binding protein; SH3 domain actin-bin | 97.95 | |
| 2bz8_A | 58 | SH3-domain kinase binding protein 1; SH3 domain, C | 97.95 | |
| 2dyb_A | 341 | Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid | 97.95 | |
| 2fei_A | 65 | CD2-associated protein; CMS SH3 domain, structural | 97.95 | |
| 2k9g_A | 73 | SH3 domain-containing kinase-binding protein 1; CI | 97.94 | |
| 3ulr_B | 65 | SRC substrate cortactin; SH3, protein-protein inte | 97.93 | |
| 2ydl_A | 69 | SH3 domain-containing kinase-binding protein 1; si | 97.93 | |
| 2l0a_A | 72 | STAM-1, signal transducing adapter molecule 1; str | 97.93 | |
| 1tg0_A | 68 | BBC1 protein, myosin tail region-interacting prote | 97.93 | |
| 2dmo_A | 68 | Neutrophil cytosol factor 2; SH3 domain, structura | 97.91 | |
| 1w70_A | 60 | Neutrophil cytosol factor 4; NADPH oxidase, P40PHO | 97.91 | |
| 1oot_A | 60 | Hypothetical 40.4 kDa protein in PES4-His2 interge | 97.9 | |
| 1uti_A | 58 | GRB2-related adaptor protein 2; signaling protein | 97.9 | |
| 2ed1_A | 76 | 130 kDa phosphatidylinositol 4,5-biphosphate- depe | 97.9 | |
| 2jte_A | 64 | CD2-associated protein; SH3 domain, coiled coil, c | 97.89 | |
| 2dl8_A | 72 | SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom | 97.89 | |
| 1sem_A | 58 | SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin | 97.89 | |
| 2xmf_A | 60 | Myosin 1E SH3; motor protein, SH3 domain; HET: DIA | 97.89 | |
| 1wyx_A | 69 | CRK-associated substrate; beta sheets, cell adhesi | 97.88 | |
| 2x3w_D | 60 | Syndapin I, protein kinase C and casein kinase sub | 97.88 | |
| 1gbq_A | 74 | GRB2; complex (signal transduction/peptide), SH3 d | 97.88 | |
| 2da9_A | 70 | SH3-domain kinase binding protein 1; structural ge | 97.88 | |
| 1z9q_A | 79 | Neutrophil cytosol factor 4; oxidoreductase activa | 97.87 | |
| 3rnj_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 97.87 | |
| 2drm_A | 58 | Acanthamoeba myosin IB; SH3 domain, contractIle pr | 97.87 | |
| 1uhc_A | 79 | KIAA1010 protein; beta barrel, SH3, human cDNA, st | 97.87 | |
| 2ebp_A | 73 | SAM and SH3 domain-containing protein 1; proline-g | 97.86 | |
| 1zuu_A | 58 | BZZ1 protein; SH3 domain, unknown function; 0.97A | 97.86 | |
| 1zx6_A | 58 | YPR154WP; SH3 domain, protein binding; 1.60A {Sacc | 97.86 | |
| 2eyx_A | 67 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 97.85 | |
| 2rf0_A | 89 | Mitogen-activated protein kinase kinase kinase 10; | 97.85 | |
| 2v1q_A | 60 | SLA1, cytoskeleton assembly control protein SLA1; | 97.85 | |
| 1uj0_A | 62 | Signal transducing adaptor molecule (SH3 domain an | 97.85 | |
| 2jt4_A | 71 | Cytoskeleton assembly control protein SLA1; endocy | 97.85 | |
| 1y0m_A | 61 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 97.85 | |
| 2fpe_A | 62 | C-JUN-amino-terminal kinase interacting protein 1; | 97.85 | |
| 2ege_A | 75 | Uncharacterized protein KIAA1666; SH3 domain, KIAA | 97.85 | |
| 2dl7_A | 73 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 97.85 | |
| 3eg3_A | 63 | Proto-oncogene tyrosine-protein kinase ABL1; beta, | 97.84 | |
| 2dl4_A | 68 | Protein STAC; SH3 domain, STAC protein, SRC homolo | 97.84 | |
| 2kxc_A | 67 | Brain-specific angiogenesis inhibitor 1-associate | 97.84 | |
| 1csk_A | 71 | C-SRC SH3 domain; phosphotransferase; 2.50A {Homo | 97.84 | |
| 2djq_A | 68 | SH3 domain containing ring finger 2; MUS musculus | 97.84 | |
| 2o2o_A | 92 | SH3-domain kinase-binding protein 1; CIN85, protei | 97.84 | |
| 2bzy_A | 67 | CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu | 97.84 | |
| 4e6r_A | 58 | Cytoplasmic protein NCK2; SH3 domain, protein bind | 97.83 | |
| 1b07_A | 65 | Protein (proto-oncogene CRK (CRK)); SH3 domain, in | 97.83 | |
| 2ak5_A | 64 | RHO guanine nucleotide exchange factor 7; adaptor | 97.83 | |
| 2ct4_A | 70 | CDC42-interacting protein 4; thyroid receptor inte | 97.83 | |
| 2d8h_A | 80 | SH3YL1 protein; SH3 domain, hypothetical protein S | 97.83 | |
| 2o9s_A | 67 | Ponsin; SH3 domain, signaling protein; 0.83A {Homo | 97.82 | |
| 1neg_A | 83 | Spectrin alpha chain, brain; SH3-domain fold, five | 97.82 | |
| 2dbm_A | 73 | SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH | 97.82 | |
| 1x2p_A | 68 | Protein arginine N-methyltransferase 2; SH3 domain | 97.81 | |
| 2b86_A | 67 | Cytoplasmic protein NCK2; NCK SH3 domain, signalin | 97.81 | |
| 1zlm_A | 58 | Osteoclast stimulating factor 1; beta barrel, sign | 97.81 | |
| 1wi7_A | 68 | SH3-domain kinase binding protein 1; beta barrel, | 97.8 | |
| 2vwf_A | 58 | Growth factor receptor-bound protein 2; polymorphi | 97.8 | |
| 3u23_A | 65 | CD2-associated protein; structural genomics, struc | 97.8 | |
| 2yuo_A | 78 | CIP85, RUN and TBC1 domain containing 3; structura | 97.8 | |
| 2yup_A | 90 | Vinexin; sorbin and SH3 domain-containing protein | 97.8 | |
| 2ecz_A | 70 | Sorbin and SH3 domain-containing protein 1; glycop | 97.8 | |
| 2iim_A | 62 | Proto-oncogene tyrosine-protein kinase LCK; beta-b | 97.79 | |
| 1spk_A | 72 | RSGI RUH-010, riken cDNA 1300006M19; structural ge | 97.78 | |
| 2dl3_A | 68 | Sorbin and SH3 domain-containing protein 1; ponsin | 97.78 | |
| 2dm1_A | 73 | Protein VAV-2; RHO family guanine nucleotide excha | 97.78 | |
| 1x2q_A | 88 | Signal transducing adapter molecule 2; SH3 domain, | 97.78 | |
| 1cka_A | 57 | C-CRK N-terminal SH3 domain; complex (oncogene pro | 97.78 | |
| 2pqh_A | 80 | Spectrin alpha chain, brain; SH3 domain, chimera, | 97.78 | |
| 1uhf_A | 69 | Intersectin 2; beta barrel, SH3 domain, riken stru | 97.77 | |
| 2fpf_A | 71 | C-JUN-amino-terminal kinase interacting protein 1; | 97.77 | |
| 1uff_A | 93 | Intersectin 2; beta barrel, SH3 domain, endocytosi | 97.77 | |
| 1x6b_A | 79 | RHO guanine exchange factor (GEF) 16; SH3 domain, | 97.77 | |
| 2cre_A | 71 | HEF-like protein; SH3 domain, SRC homology 3 domai | 97.77 | |
| 2yuq_A | 85 | Tyrosine-protein kinase ITK/TSK; T-cell-specific k | 97.77 | |
| 2ega_A | 70 | SH3 and PX domain-containing protein 2A; SH3 domai | 97.76 | |
| 2ysq_A | 81 | RHO guanine nucleotide exchange factor 9; SH3 doma | 97.76 | |
| 2eqi_A | 69 | Phospholipase C, gamma 2; SH3 domain, PLCG2, struc | 97.76 | |
| 1x2k_A | 68 | OSTF1, osteoclast stimulating factor 1; SH3 domain | 97.75 | |
| 2dil_A | 69 | Proline-serine-threonine phosphatase-interacting p | 97.75 | |
| 2e5k_A | 94 | Suppressor of T-cell receptor signaling 1; SH3 dom | 97.75 | |
| 4esr_A | 69 | Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai | 97.75 | |
| 1ujy_A | 76 | RHO guanine nucleotide exchange factor 6; structur | 97.75 | |
| 2csi_A | 76 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 97.75 | |
| 2j05_A | 65 | RAS GTPase-activating protein 1; GTPase activation | 97.75 | |
| 1bb9_A | 115 | Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat | 97.75 | |
| 1aww_A | 67 | ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke | 97.74 | |
| 1wie_A | 96 | RIM binding protein 2; beta barrel, KIAA0318 prote | 97.74 | |
| 2ekh_A | 80 | SH3 and PX domain-containing protein 2A; SH3 domai | 97.74 | |
| 1nm7_A | 69 | Peroxisomal membrane protein PAS20; yeast, PEX5P, | 97.74 | |
| 3r6n_A | 450 | Desmoplakin; spectrin repeat, SH3 domain, cell adh | 97.73 | |
| 2yun_A | 79 | Nostrin; nitric oxide synthase trafficker, structu | 97.73 | |
| 2oaw_A | 65 | Spectrin alpha chain, brain; SH3 domain, chimera, | 97.72 | |
| 2k2m_A | 68 | EPS8-like protein 1; alternative splicing, coiled | 97.72 | |
| 1zuy_A | 58 | Myosin-5 isoform; SH3 domain, contractIle protein; | 97.72 | |
| 1gl5_A | 67 | Tyrosine-protein kinase TEC; transferase, ATP-bind | 97.72 | |
| 4glm_A | 72 | Dynamin-binding protein; SH3 domain, DNMBP, struct | 97.72 | |
| 1u5s_A | 71 | Cytoplasmic protein NCK2; protein-protein complex, | 97.71 | |
| 2lcs_A | 73 | NAP1-binding protein 2; adaptor, transferase, sign | 97.71 | |
| 2gqi_A | 71 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 97.71 | |
| 3cqt_A | 79 | P59-FYN, proto-oncogene tyrosine-protein kinase FY | 97.71 | |
| 1w1f_A | 65 | Tyrosine-protein kinase LYN; SH3-domain, SH3 domai | 97.71 | |
| 2epd_A | 76 | RHO GTPase-activating protein 4; SH3 domain, struc | 97.71 | |
| 1x69_A | 79 | Cortactin isoform A; SH3 domain, CTTN, oncogene EM | 97.71 | |
| 2dlp_A | 85 | KIAA1783 protein; SH3 domain, structural genomics, | 97.7 | |
| 1j3t_A | 74 | Intersectin 2; beta barrel, SH3 domain, riken stru | 97.7 | |
| 2dnu_A | 71 | RUH-061, SH3 multiple domains 1; RSGI, structural | 97.7 | |
| 1s1n_A | 68 | Nephrocystin 1; beta barrel, cell adhesion; NMR {H | 97.69 | |
| 1x6g_A | 81 | Megakaryocyte-associated tyrosine-protein kinase; | 97.69 | |
| 2oi3_A | 86 | Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t | 97.69 | |
| 3ngp_A | 62 | Spectrin alpha chain, brain; beta barrel, structur | 97.69 | |
| 2d8j_A | 77 | FYN-related kinase; SH3 domain, structural genomic | 97.68 | |
| 2csq_A | 97 | RIM-BP2, RIM binding protein 2; SH3 domain, struct | 97.68 | |
| 2dbk_A | 88 | CRK-like protein; structural genomics, NPPSFA, nat | 97.68 | |
| 1ruw_A | 69 | Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th | 97.68 | |
| 2dl5_A | 78 | KIAA0769 protein; SH3 domain, FCHSD2, structural g | 97.67 | |
| 2enm_A | 77 | Sorting nexin-9; SH3-like barrel, protein transpor | 97.67 | |
| 3thk_A | 73 | Spectrin alpha chain, brain; SH3 domain, chimera, | 97.66 | |
| 1wxt_A | 68 | Hypothetical protein FLJ21522; SH3 domain, EPS8-re | 97.66 | |
| 3h0h_A | 73 | Proto-oncogene tyrosine-protein kinase FYN; beta b | 97.66 | |
| 1hsq_A | 71 | Phospholipase C-gamma (SH3 domain); phosphoric die | 97.66 | |
| 2kgt_A | 72 | Tyrosine-protein kinase 6; SH3 domain, SRC kinase, | 97.66 | |
| 1i1j_A | 108 | Melanoma derived growth regulatory protein; SH3 su | 97.65 | |
| 2ke9_A | 83 | Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp | 97.65 | |
| 2m0y_A | 74 | Dedicator of cytokinesis protein 1; apoptosis; NMR | 97.64 | |
| 2cub_A | 88 | Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor | 97.63 | |
| 1yn8_A | 59 | NBP2, NAP1-binding protein 2; SH3 domain, unknown | 97.63 | |
| 1i07_A | 60 | Epidermal growth factor receptor kinase substrate | 97.62 | |
| 2cuc_A | 70 | SH3 domain containing ring finger 2; structural ge | 97.61 | |
| 1wxu_A | 93 | Peroxisomal biogenesis factor 13; SH3 domain, PEX1 | 97.58 | |
| 2kbt_A | 142 | Chimera of proto-oncogene VAV, linker, immunoglobu | 97.58 | |
| 4f14_A | 64 | Nebulette; SH3 domain, heart muscle, actin-binding | 97.58 | |
| 1wx6_A | 91 | Cytoplasmic protein NCK2; SH3 domain, structural g | 97.58 | |
| 2kxd_A | 73 | 11-MER peptide, SH3 domain of spectrin alpha CHAI; | 97.54 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 97.54 | |
| 2jxb_A | 86 | T-cell surface glycoprotein CD3 epsilon chain, cyt | 97.53 | |
| 2jw4_A | 72 | Cytoplasmic protein NCK1; SH3 domain, phosphorylat | 97.52 | |
| 1ue9_A | 80 | Intersectin 2; beta barrel, SH3 domain, riken stru | 97.52 | |
| 4ag1_C | 84 | Fynomer; hydrolase-de novo protein complex, inhibi | 97.52 | |
| 1jqq_A | 92 | PEX13P, peroxisomal membrane protein PAS20, PAS20P | 97.51 | |
| 2ct3_A | 70 | Vinexin; SH3 domian, structural genomics, NPPSFA, | 97.5 | |
| 2egc_A | 75 | SH3 and PX domain-containing protein 2A; SH3 domai | 97.49 | |
| 2v1r_A | 80 | Peroxisomal membrane protein PAS20; protein transp | 97.48 | |
| 2rqv_A | 108 | BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop | 97.47 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 97.45 | |
| 2cud_A | 79 | SRC-like-adapter; SH3 domain, negative mitogenesis | 97.45 | |
| 1awj_A | 77 | ITK; transferase, regulatory intramolecular comple | 97.45 | |
| 2vkn_A | 70 | Protein SSU81; membrane, SH3 domain, transmembrane | 97.44 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 97.4 | |
| 1wxb_A | 68 | Epidermal growth factor receptor pathway substrate | 97.39 | |
| 2yt6_A | 109 | Adult MALE urinary bladder cDNA, riken FULL- lengt | 97.39 | |
| 2rqr_A | 119 | CED-12 homolog, engulfment and cell motility prote | 97.38 | |
| 3jv3_A | 283 | Intersectin-1; SH3 domain, DH domain, guanine nucl | 97.28 | |
| 3o5z_A | 90 | Phosphatidylinositol 3-kinase regulatory subunit; | 97.24 | |
| 3reb_B | 90 | Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain | 97.22 | |
| 3i5r_A | 83 | Phosphatidylinositol 3-kinase regulatory subunit a | 97.21 | |
| 1gcq_C | 70 | VAV proto-oncogene; SH3 domain, protein-protein co | 97.18 | |
| 2kym_A | 120 | BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI | 97.15 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 96.96 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 96.95 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 96.89 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 96.89 | |
| 1k1z_A | 78 | VAV; SH3, proto-oncogene, signaling protein; NMR { | 96.78 | |
| 1v1c_A | 71 | Obscurin; muscle, sarcomere, adapter, myogenesis, | 96.67 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 96.67 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 96.57 | |
| 1u3o_A | 82 | Huntingtin-associated protein-interacting protein; | 96.53 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 96.51 | |
| 3a98_A | 184 | DOCK2, dedicator of cytokinesis protein 2; protein | 96.33 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 96.32 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 96.31 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 96.25 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 96.13 | |
| 2de0_X | 526 | Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran | 96.13 | |
| 2jmc_A | 77 | Spectrin alpha chain, brain and P41 peptide chimer | 95.84 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 95.71 | |
| 2kt8_A | 76 | Probable surface protein; SH3 family, structural g | 95.61 | |
| 3haj_A | 486 | Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, | 95.6 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 95.59 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 95.56 | |
| 2krs_A | 74 | Probable enterotoxin; all beta, SH3, ENTD, CPF_058 | 95.52 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 95.45 | |
| 1tuc_A | 63 | Alpha-spectrin; capping protein, calcium-binding, | 95.13 | |
| 2kq8_A | 70 | Cell WALL hydrolase; GFT protein structure, NESG, | 95.02 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 94.12 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 93.64 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 93.61 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 93.05 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 92.88 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 92.82 | |
| 1ri9_A | 102 | FYN-binding protein; SH3-like, helically extended, | 92.66 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 92.39 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 92.28 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 92.27 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 92.26 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 92.12 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 92.04 | |
| 1wfw_A | 74 | Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex | 92.04 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 91.93 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 91.72 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 91.61 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 91.41 | |
| 2lnw_A | 122 | VAV-2, guanine nucleotide exchange factor VAV2; si | 91.26 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 90.9 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 90.81 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 90.74 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 90.3 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 90.12 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 90.0 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 89.68 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 89.63 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 89.57 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 89.57 | |
| 2gtj_A | 96 | FYN-binding protein; SH3, redox, signaling protein | 89.17 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 88.84 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 88.74 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 88.74 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 88.69 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 88.63 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 88.56 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 88.31 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 88.19 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 87.92 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 87.03 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 86.81 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 86.75 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 86.58 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 86.57 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 86.48 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 85.92 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 85.48 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 85.3 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 84.99 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 84.81 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 84.75 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 84.09 | |
| 3h8z_A | 128 | FragIle X mental retardation syndrome-related Pro; | 84.09 | |
| 1ug1_A | 92 | KIAA1010 protein; structural genomics, SH3 domain, | 84.06 | |
| 3npf_A | 306 | Putative dipeptidyl-peptidase VI; structural genom | 83.88 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 83.25 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 83.09 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 82.91 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 82.34 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 80.75 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 80.38 |
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
Probab=99.84 E-value=2.2e-21 Score=156.40 Aligned_cols=120 Identities=13% Similarity=0.220 Sum_probs=98.3
Q ss_pred ceEEEEeecccCCCCCCCCccccccCCCeEEEEEecCCCeEEEEECCeEEEeeCCcEEeecCCCCCCCcCC-CCcCcEEE
Q psy15850 59 RKYLQELHDISSRRHTDNFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKIRTAPKK-LSEGQARA 137 (225)
Q Consensus 59 ~~~~~al~d~~~~~~~~~~~eLs~~~Gdii~v~~~~~~~Ww~g~~~g~~G~~P~nyv~~~~~~~~~~~~~~-~~~~~~~a 137 (225)
...++|+|||.+. ..+||+|++||+|.|+.+.+.+||.|+.+|+.||||++||+.+........+.. .....++|
T Consensus 11 ~~~~~al~dy~~~----~~~eLs~~~Gd~i~vl~~~~~gWw~g~~~g~~G~~P~~yv~~~~~~~~~~~~~p~~~~~~~~a 86 (193)
T 1ng2_A 11 LQTYRAIADYEKT----SGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVA 86 (193)
T ss_dssp CEEEECSSCBCCS----STTCCCBCTTCEEEEEECCTTSCCEEEECCCCCCCCGGGCCCSSCSSCSCCCCCCTTCEEEEE
T ss_pred CcEEEEcCCcCCC----CCCcCCCCCCCEEEEEEecCCCeEEEEECCeeeEechheEEeeccccccchhhccccceeeee
Confidence 4568999999999 788999999999999999899999999999999999999998765432211111 13346899
Q ss_pred cccccCCCccccccccccceEEecccccccccccchhhhhhccchh
Q psy15850 138 KFNFVAQTHLELSLVKESPHKYVDSEVTLQYRRPVRNEIKELISEE 183 (225)
Q Consensus 138 ~~~~~~~~~~els~~~g~~v~~~~~~~~~~~~f~~~~~l~e~~~~~ 183 (225)
+|+|.+..+++|+|.+||+|.++.. ..++||.+..+.-..|++.+
T Consensus 87 l~dy~a~~~~eLs~~~Gd~i~vl~~-~~~gWw~g~~~g~~G~~P~~ 131 (193)
T 1ng2_A 87 IKAYTAVEGDEVSLLEGEAVEVIHK-LLDGWWVIRKDDVTGYFPSM 131 (193)
T ss_dssp SSCBCCCSTTBCCBCTTCEEEEEEC-CTTSEEEEEETTEEEEEEGG
T ss_pred ccccCCCCCCcccccCCCEEEEEEe-cCCCeEEEEECCCEEEEehH
Confidence 9999999999999999999999987 47788866666666666554
|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A | Back alignment and structure |
|---|
| >4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A | Back alignment and structure |
|---|
| >1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
|---|
| >3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A | Back alignment and structure |
|---|
| >2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A | Back alignment and structure |
|---|
| >1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} | Back alignment and structure |
|---|
| >2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A | Back alignment and structure |
|---|
| >2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A | Back alignment and structure |
|---|
| >2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A | Back alignment and structure |
|---|
| >2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A | Back alignment and structure |
|---|
| >2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A | Back alignment and structure |
|---|
| >2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A | Back alignment and structure |
|---|
| >1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A | Back alignment and structure |
|---|
| >1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A | Back alignment and structure |
|---|
| >2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A | Back alignment and structure |
|---|
| >2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A | Back alignment and structure |
|---|
| >2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A | Back alignment and structure |
|---|
| >2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} | Back alignment and structure |
|---|
| >1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} | Back alignment and structure |
|---|
| >2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D | Back alignment and structure |
|---|
| >1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A | Back alignment and structure |
|---|
| >2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A | Back alignment and structure |
|---|
| >1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A | Back alignment and structure |
|---|
| >1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A | Back alignment and structure |
|---|
| >2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A | Back alignment and structure |
|---|
| >1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A | Back alignment and structure |
|---|
| >2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* | Back alignment and structure |
|---|
| >2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A | Back alignment and structure |
|---|
| >2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A | Back alignment and structure |
|---|
| >4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A | Back alignment and structure |
|---|
| >1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A | Back alignment and structure |
|---|
| >2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A | Back alignment and structure |
|---|
| >1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A | Back alignment and structure |
|---|
| >1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A | Back alignment and structure |
|---|
| >1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} | Back alignment and structure |
|---|
| >1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A | Back alignment and structure |
|---|
| >3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A | Back alignment and structure |
|---|
| >2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A | Back alignment and structure |
|---|
| >1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A | Back alignment and structure |
|---|
| >2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A | Back alignment and structure |
|---|
| >1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} | Back alignment and structure |
|---|
| >1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A | Back alignment and structure |
|---|
| >1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B | Back alignment and structure |
|---|
| >1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A | Back alignment and structure |
|---|
| >1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A | Back alignment and structure |
|---|
| >2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A | Back alignment and structure |
|---|
| >1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A | Back alignment and structure |
|---|
| >1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A | Back alignment and structure |
|---|
| >2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A | Back alignment and structure |
|---|
| >2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A | Back alignment and structure |
|---|
| >3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... | Back alignment and structure |
|---|
| >2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A | Back alignment and structure |
|---|
| >2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* | Back alignment and structure |
|---|
| >1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A | Back alignment and structure |
|---|
| >2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A | Back alignment and structure |
|---|
| >2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A | Back alignment and structure |
|---|
| >2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A | Back alignment and structure |
|---|
| >1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... | Back alignment and structure |
|---|
| >1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A | Back alignment and structure |
|---|
| >2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
| >2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A | Back alignment and structure |
|---|
| >2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A | Back alignment and structure |
|---|
| >3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A | Back alignment and structure |
|---|
| >3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A | Back alignment and structure |
|---|
| >1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A | Back alignment and structure |
|---|
| >2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} | Back alignment and structure |
|---|
| >2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A | Back alignment and structure |
|---|
| >2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A | Back alignment and structure |
|---|
| >3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
|---|
| >1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* | Back alignment and structure |
|---|
| >1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* | Back alignment and structure |
|---|
| >1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 | Back alignment and structure |
|---|
| >3npf_A Putative dipeptidyl-peptidase VI; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: CSA GOL; 1.72A {Bacteroides ovatus} PDB: 3pvq_A | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 225 | ||||
| d1ujya_ | 76 | b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens | 3e-15 | |
| d1sema_ | 58 | b.34.2.1 (A:) Growth factor receptor-bound protein | 2e-14 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 4e-14 | |
| d1udla_ | 98 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 1e-08 | |
| d1gcqa_ | 56 | b.34.2.1 (A:) Growth factor receptor-bound protein | 8e-14 | |
| d1u06a1 | 55 | b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic | 2e-13 | |
| d1k4us_ | 62 | b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId | 5e-13 | |
| d1utia_ | 57 | b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona | 6e-13 | |
| d1j3ta_ | 74 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 6e-13 | |
| d1uhfa_ | 69 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 6e-13 | |
| d1ugva_ | 72 | b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 | 7e-13 | |
| d1ycsb2 | 63 | b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ | 7e-13 | |
| d1uj0a_ | 58 | b.34.2.1 (A:) Signal transducing adaptor molecule | 9e-13 | |
| d1gria1 | 56 | b.34.2.1 (A:1-56) Growth factor receptor-bound pro | 7e-12 | |
| d1oota_ | 58 | b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' | 8e-12 | |
| d1jo8a_ | 58 | b.34.2.1 (A:) Actin binding protein ABP1 {Baker's | 1e-11 | |
| d1ckaa_ | 57 | b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse | 1e-11 | |
| d1uffa_ | 93 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 2e-11 | |
| d1arka_ | 60 | b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo | 3e-11 | |
| d2hspa_ | 71 | b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( | 3e-11 | |
| d1uhca_ | 79 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 4e-11 | |
| d1spka_ | 72 | b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI | 5e-11 | |
| d1ue9a_ | 80 | b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom | 6e-11 | |
| d1opka1 | 57 | b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai | 7e-11 | |
| d1awwa_ | 67 | b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom | 8e-11 | |
| d2v1ra1 | 67 | b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe | 1e-10 | |
| d1qcfa1 | 65 | b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu | 2e-10 | |
| d2iima1 | 62 | b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d | 2e-10 | |
| d1ng2a2 | 118 | b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic | 2e-10 | |
| d1k9aa1 | 71 | b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs | 3e-10 | |
| d1fmka1 | 64 | b.34.2.1 (A:82-145) c-src protein tyrosine kinase | 6e-10 | |
| d1efna_ | 57 | b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, | 7e-10 | |
| d1u5sa1 | 71 | b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax | 9e-10 | |
| d1i07a_ | 59 | b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus | 1e-09 | |
| d1gl5a_ | 67 | b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc | 2e-09 | |
| d1ng2a1 | 58 | b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic | 2e-09 | |
| d1wlpb1 | 53 | b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic | 2e-09 | |
| d1gcqc_ | 69 | b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu | 2e-09 | |
| d1wiea_ | 96 | b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human | 6e-09 | |
| d2rn8a1 | 53 | b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus | 1e-08 | |
| d1zuua1 | 56 | b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc | 2e-08 | |
| d1bb9a_ | 83 | b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu | 4e-07 | |
| d1wfwa_ | 74 | b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta | 7e-07 | |
| d1phta_ | 83 | b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a | 1e-05 | |
| d1vyva1 | 145 | b.34.2.1 (A:71-215) SH3-like domain of the L-type | 2e-05 | |
| d1i1ja_ | 106 | b.34.2.1 (A:) Melanoma inhibitory activity protein | 2e-05 | |
| d1kjwa1 | 96 | b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu | 8e-05 | |
| d1t0ha_ | 96 | b.34.2.1 (A:) SH3-like domain of the L-type calciu | 8e-05 | |
| d1vyua1 | 136 | b.34.2.1 (A:39-174) SH3-like domain of the L-type | 6e-04 | |
| d1ug1a_ | 92 | b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA | 0.001 |
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: SH3-domain family: SH3-domain domain: Rac/CDC42 GEF 6 species: Human (Homo sapiens) [TaxId: 9606]
Score = 66.4 bits (162), Expect = 3e-15
Identities = 21/41 (51%), Positives = 24/41 (58%)
Query: 79 ELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIP 119
ELS KGDII+V R + W+EG N G FP NYV I
Sbjct: 26 ELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIK 66
|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 225 | |||
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 99.76 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.75 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.74 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 99.71 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 99.7 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 99.7 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 99.68 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 99.67 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.66 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.66 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 99.66 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 99.66 | |
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.66 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.65 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 99.65 | |
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.65 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 99.63 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 99.63 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 99.63 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.63 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 99.62 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 99.62 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 99.61 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 99.61 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 99.61 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 99.6 | |
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 99.6 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.59 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.58 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 99.58 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 99.58 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.58 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.57 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.57 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 99.56 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 99.55 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 99.54 | |
| d1zuua1 | 56 | BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.54 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 99.53 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 99.53 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 99.52 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 99.52 | |
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.51 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 99.51 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 99.49 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 99.48 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 99.36 | |
| d1udla_ | 98 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 99.32 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 99.17 | |
| d1gria1 | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 98.32 | |
| d1uj0a_ | 58 | Signal transducing adaptor molecule Stam2 {Mouse ( | 98.25 | |
| d1wlpb1 | 53 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 98.2 | |
| d1ugva_ | 72 | Olygophrenin-1 like protein (KIAA0621) {Human (Hom | 98.17 | |
| d1ycsb2 | 63 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 98.17 | |
| d1k4us_ | 62 | p67phox {Human (Homo sapiens) [TaxId: 9606]} | 98.16 | |
| d1utia_ | 57 | Grb2-related adaptor protein 2 (Mona/Gads) {Mouse | 98.14 | |
| d1oota_ | 58 | Hypothetical protein YFR024c {Baker's yeast (Sacch | 98.13 | |
| d1opka1 | 57 | Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul | 98.11 | |
| d1u06a1 | 55 | alpha-Spectrin, SH3 domain {Chicken (Gallus gallus | 98.11 | |
| d1ng2a1 | 58 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 98.09 | |
| d1gcqa_ | 56 | Growth factor receptor-bound protein 2 (GRB2), N- | 98.07 | |
| d1ng2a2 | 118 | p47pox (neutrophil cytosolic factor 1) {Human (Hom | 98.06 | |
| d1ujya_ | 76 | Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 | 98.05 | |
| d1sema_ | 58 | Growth factor receptor-bound protein 2 (GRB2), N- | 98.03 | |
| d1k9aa1 | 71 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 97.98 | |
| d1j3ta_ | 74 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 97.97 | |
| d1efna_ | 57 | Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu | 97.93 | |
| d2hspa_ | 71 | Phospholipase C, SH3 domain {Human (Homo sapiens) | 97.93 | |
| d1spka_ | 72 | BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 | 97.92 | |
| d1uffa_ | 93 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 97.92 | |
| d1zuua1 | 56 | BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 97.92 | |
| d1uhfa_ | 69 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 97.91 | |
| d1ug1a_ | 92 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 97.91 | |
| d1jo8a_ | 58 | Actin binding protein ABP1 {Baker's yeast (Sacchar | 97.87 | |
| d1i07a_ | 59 | EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 | 97.85 | |
| d2iima1 | 62 | p56-lck tyrosine kinase, SH3 domain {Human (Homo s | 97.84 | |
| d1ckaa_ | 57 | C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) | 97.81 | |
| d2rn8a1 | 53 | Bruton's tyrosine kinase {Mus musculus [TaxId: 100 | 97.81 | |
| d1uhca_ | 79 | Hypothetical protein Baa76854.1 (KIAA1010) {Human | 97.81 | |
| d1awwa_ | 67 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 97.77 | |
| d1t0ha_ | 96 | SH3-like domain of the L-type calcium channel {Rab | 97.75 | |
| d1fmka1 | 64 | c-src protein tyrosine kinase {Human (Homo sapiens | 97.72 | |
| d1gl5a_ | 67 | tyrosine kinase tec {Mouse (Mus musculus) [TaxId: | 97.71 | |
| d1qcfa1 | 65 | Hemapoetic cell kinase Hck {Human (Homo sapiens) [ | 97.7 | |
| d1ue9a_ | 80 | Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta | 97.69 | |
| d1wiea_ | 96 | RIM binding protein 2, RIMBP2 {Human (Homo sapiens | 97.66 | |
| d1arka_ | 60 | SH3 domain from nebulin {Human (Homo sapiens) [Tax | 97.61 | |
| d1bb9a_ | 83 | Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 | 97.61 | |
| d1u5sa1 | 71 | Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | 97.52 | |
| d2v1ra1 | 67 | Peroxisomal membrane protein Pex13p {Baker's yeast | 97.51 | |
| d1gcqc_ | 69 | Vav N-terminal SH3 domain {Mouse (Mus musculus) [T | 97.51 | |
| d1i1ja_ | 106 | Melanoma inhibitory activity protein {Human (Homo | 97.48 | |
| d1kjwa1 | 96 | Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | 97.45 | |
| d1phta_ | 83 | Phosphatidylinositol 3-kinase (p85-alpha subunit, | 97.43 | |
| d1wfwa_ | 74 | Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | 97.42 | |
| d1vyva1 | 145 | SH3-like domain of the L-type calcium channel {Rat | 97.14 | |
| d1vyua1 | 136 | SH3-like domain of the L-type calcium channel {Rat | 95.8 | |
| d1ri9a_ | 77 | Fyn-binding protein (T-cell adapter protein adap) | 95.7 | |
| d1r1qa_ | 97 | GRB2-related adaptor protein 2 (MONA, GRID) {Mouse | 94.73 | |
| d1jyra_ | 96 | Growth factor receptor-bound protein 2 (GRB2) {Hum | 94.48 | |
| d1jwoa_ | 97 | Csk homologous kinase Chk {Human (Homo sapiens) [T | 93.26 | |
| d1k9aa2 | 101 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 92.55 | |
| d1rpya_ | 86 | Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI | 92.35 | |
| d1i3za_ | 103 | Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus | 92.07 | |
| d1mila_ | 104 | Shc adaptor protein {Human (Homo sapiens) [TaxId: | 92.05 | |
| d1a81a1 | 129 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 91.31 | |
| d2shpa2 | 109 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 90.93 | |
| d1rjaa_ | 100 | Tyrosine-protein kinase 6 (Breast tumor kinase, Br | 90.79 | |
| d2izva2 | 112 | Suppressor of cytokine signaling 4, SOCS-4 {Human | 90.25 | |
| d2fcia1 | 105 | Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: | 90.02 | |
| d1opka2 | 101 | Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: | 89.84 | |
| d2oq1a1 | 130 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 88.97 | |
| d1a81a2 | 125 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 87.31 | |
| d1qada_ | 107 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 86.6 | |
| d1d4ta_ | 104 | The Xlp protein Sap {Human (Homo sapiens) [TaxId: | 86.13 | |
| d2eyva1 | 109 | Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 | 85.95 | |
| d2c9wa2 | 103 | Suppressor of cytokine signaling 2, SOCS-2 {Human | 85.44 | |
| d2qmsa1 | 113 | Growth factor receptor-bound protein 7 {Human (Hom | 85.31 | |
| d1nrva_ | 105 | Growth factor receptor-bound protein 10, GRB10 {Hu | 85.02 | |
| d2oq1a2 | 124 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 84.93 | |
| d1qcfa2 | 103 | Hemopoetic cell kinase Hck {Human (Homo sapiens) [ | 81.19 |
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: SH3-domain family: SH3-domain domain: Grb2-related adaptor protein 2 (Mona/Gads) species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.76 E-value=1.1e-18 Score=111.66 Aligned_cols=55 Identities=29% Similarity=0.643 Sum_probs=52.3
Q ss_pred eEEEEeecccCCCCCCCCccccccCCCeEEEEEecCCCeEEEEECCeEEEeeCCcEEee
Q psy15850 60 KYLQELHDISSRRHTDNFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEII 118 (225)
Q Consensus 60 ~~~~al~d~~~~~~~~~~~eLs~~~Gdii~v~~~~~~~Ww~g~~~g~~G~~P~nyv~~~ 118 (225)
++|+|+|||.++ +.+||+|++||+|.|++..+++||.|+.+|+.|+||+|||+++
T Consensus 2 ~yarAlydy~~~----~~~eLs~~~Gd~i~v~~~~~~~Ww~g~~~g~~G~~P~~yve~i 56 (57)
T d1utia_ 2 RWARALYDFEAL----EEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPM 56 (57)
T ss_dssp CEEEESSCBCCC----STTBCCBCTTCEEEEEECCSSSEEEEEETTEEEEEEGGGEEEC
T ss_pred EEEEECcCCCCC----CcCCcCCCCCCEEEEeEEcCCCEEEEEECCcEEEEEHHHEEEc
Confidence 579999999999 7889999999999999999999999999999999999999975
|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|