Psyllid ID: psy15850


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MISPIQTTDNRPNSIVDSEVTLQYRRPVRNEIKELISEEELARRQAEAMRRIYQEERRRKYLQELHDISSRRHTDNFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKIRTAPKKLSEGQARAKFNFVAQTHLELSLVKESPHKYVDSEVTLQYRRPVRNEIKELISEEELARRQAEAMRRIYQEERRRKYLQELHDISSRRHTDNFTYRI
cccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHccccccccccccccccccccccEEEEEEEccccccEEEEccEEcEEccccEEEccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
cccccccccccccccccccEEEEccccccccccccccHHHHHHHcccHHHHcccHHHHHHHHHHHHHHHHHHcccccEEccEccccEEEEEEcccccEEEEEEccEEEEEEHHHEEEcccccccccccccccccEEEEEEEcccccEEEEEcccccccccccccEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEc
mispiqttdnrpnsivdsevtlqYRRPVRNEIKELISEEELARRQAEAMRRIYQEERRRKYLQELHDissrrhtdnftelsfkkgdIIFVRRQVdknwyegehnamiglfpfnyveiipydkirtapkklsegQARAKFNFVAQTHLELSlvkesphkyvdsevtlqyRRPVRNEIKELISEEELARRQAEAMRRIYQEERRRKYLQELHDissrrhtdnftyri
mispiqttdnrpnsivdsevtlqyrrpvrneikeliseeelARRQAEAMRRIYQEERRRKYLQelhdissrrhtdnftelsfkkgdiifVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKIRTAPKKLSEGQARAKFNFVAQTHLELslvkesphkyvdsevtlqyrrpvrneikeliseeelARRQAEAMRRIYQEERRRKYLqelhdissrrhtdnftyri
MISPIQTTDNRPNSIVDSEVTLQYRRPVRNEIKELISEEELARRQAEAMRRIYQEERRRKYLQELHDISSRRHTDNFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKIRTAPKKLSEGQARAKFNFVAQTHLELSLVKESPHKYVDSEVTLQYRRPVRNEIKELISEEELARRQAEAMRRIYQEERRRKYLQELHDISSRRHTDNFTYRI
*************************************************************************TDNFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKIRTAPKKLS*GQARAKFNFVAQTHLELSLVKESPHKYVDSEVTLQYRRPV*****************************************************
*****************************************************************HDISSRRHT****ELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEI**********************NFVAQTHLELSLVKESPHKYVDSEVT************************************************************
**********RPNSIVDSEVTLQYRRPVRNEIKELISEEELARRQAEAMRRIYQEERRRKYLQELHDISSRRHTDNFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKIRTAPKKLSEGQARAKFNFVAQTHLELSLVKESPHKYVDSEVTLQYRRPVRNEIKELISEEELARRQAEAMRRIYQEERRRKYLQELHDISSRRHTDNFTYRI
*****************SEVTLQ************ISEEELARRQAEAMRRIYQEERRRKYLQELHDISSRRHTDNFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKIRTAPKKLSEGQARAKFNFVAQTHLELSLVKESPHKYVDSEVTLQYRRPVRNEIKELISEEELARRQAEAMRRIYQEERRRKYLQELHDISSRRHTDNFTYRI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISPIQTTDNRPNSIVDSEVTLQYRRPVxxxxxxxxxxxxxxxxxxxxxxxxxxxxRRRKYLQELHDISSRRHTDNFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKIRTAPKKLSEGQARAKFNFVAQTHLELSLVKESPHKYVDSEVTLQYRRPVxxxxxxxxxxxxxxxxxxxxxxxxxxxxRRRKYLQELHDISSRRHTDNFTYRI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
Q9BX66 1292 Sorbin and SH3 domain-con no N/A 0.524 0.091 0.313 9e-17
Q624171290 Sorbin and SH3 domain-con no N/A 0.524 0.091 0.307 2e-16
O948751100 Sorbin and SH3 domain-con no N/A 0.333 0.068 0.481 1e-14
Q3UTJ21180 Sorbin and SH3 domain-con no N/A 0.333 0.063 0.481 1e-14
O354131196 Sorbin and SH3 domain-con no N/A 0.333 0.062 0.481 1e-14
Q9R1Z8 733 Vinexin OS=Mus musculus G no N/A 0.426 0.130 0.390 3e-14
O60504 671 Vinexin OS=Homo sapiens G no N/A 0.422 0.141 0.384 6e-14
Q8AXV0367 Endophilin-A2 OS=Gallus g no N/A 0.195 0.119 0.545 4e-09
Q5RBR0 888 E3 ubiquitin-protein liga no N/A 0.151 0.038 0.625 5e-09
Q7Z6J0 888 E3 ubiquitin-protein liga no N/A 0.151 0.038 0.625 5e-09
>sp|Q9BX66|SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens GN=SORBS1 PE=1 SV=3 Back     alignment and function desciption
 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 80/169 (47%), Gaps = 51/169 (30%)

Query: 35  LISEEELARRQAEAMRRIYQEERRRKYLQELHDISSRRHTD------------------- 75
           L S EE  RR+ +   ++  ++RR K  QE  DI++RRHT                    
Sbjct: 723 LESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDLLN 782

Query: 76  -------------------------NFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLF 110
                                       EL  +KGDI+++ +Q+D+NWYEGEH+  +G+F
Sbjct: 783 IDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGIF 842

Query: 111 PFNYVEIIPYDKIRTAPKKLSE------GQARAKFNFVAQTHLELSLVK 153
           P  Y+E++P  + +  PKKL+       G+A AKFNF   T +E+S  K
Sbjct: 843 PRTYIELLPPAE-KAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRK 890




Plays a role in tyrosine phosphorylation of CBL by linking CBL to the insulin receptor. Required for insulin-stimulated glucose transport. Involved in formation of actin stress fibers and focal adhesions.
Homo sapiens (taxid: 9606)
>sp|Q62417|SRBS1_MOUSE Sorbin and SH3 domain-containing protein 1 OS=Mus musculus GN=Sorbs1 PE=1 SV=2 Back     alignment and function description
>sp|O94875|SRBS2_HUMAN Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens GN=SORBS2 PE=1 SV=3 Back     alignment and function description
>sp|Q3UTJ2|SRBS2_MOUSE Sorbin and SH3 domain-containing protein 2 OS=Mus musculus GN=Sorbs2 PE=1 SV=2 Back     alignment and function description
>sp|O35413|SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus GN=Sorbs2 PE=1 SV=2 Back     alignment and function description
>sp|Q9R1Z8|VINEX_MOUSE Vinexin OS=Mus musculus GN=Sorbs3 PE=1 SV=1 Back     alignment and function description
>sp|O60504|VINEX_HUMAN Vinexin OS=Homo sapiens GN=SORBS3 PE=1 SV=2 Back     alignment and function description
>sp|Q8AXV0|SH3G1_CHICK Endophilin-A2 OS=Gallus gallus GN=SH3GL1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RBR0|SH3R1_PONAB E3 ubiquitin-protein ligase SH3RF1 OS=Pongo abelii GN=SH3RF1 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z6J0|SH3R1_HUMAN E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens GN=SH3RF1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
307215182 4470 Sorbin and SH3 domain-containing protein 0.631 0.031 0.6 4e-56
345488740 2222 PREDICTED: hypothetical protein LOC10012 0.631 0.063 0.594 3e-55
380028397 965 PREDICTED: uncharacterized protein LOC10 0.631 0.147 0.594 4e-54
328780855 966 PREDICTED: hypothetical protein LOC40965 0.631 0.146 0.594 4e-54
383851627 963 PREDICTED: uncharacterized protein LOC10 0.631 0.147 0.589 1e-53
307172916 1065 Sorbin and SH3 domain-containing protein 0.631 0.133 0.586 2e-52
332029655 1113 Sorbin and SH3 domain-containing protein 0.631 0.127 0.575 8e-52
328714703 1924 PREDICTED: hypothetical protein LOC10016 0.64 0.074 0.6 1e-51
350409487 902 PREDICTED: hypothetical protein LOC10074 0.631 0.157 0.589 1e-47
321468642 438 hypothetical protein DAPPUDRAFT_197424 [ 0.617 0.317 0.510 3e-44
>gi|307215182|gb|EFN89954.1| Sorbin and SH3 domain-containing protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 125/190 (65%), Gaps = 48/190 (25%)

Query: 12   PNSIVDSEVTLQYRRPVRNEIKELISEEELARRQAEAMRRIYQEERRRKYLQELHDISSR 71
            P   V+ EVT+ YR PVR E KE +SEEELARR AE MRR+YQEERRRKYLQELHDI SR
Sbjct: 4106 PRRYVEGEVTIHYRSPVRTEAKEPLSEEELARRSAENMRRVYQEERRRKYLQELHDIDSR 4165

Query: 72   RHTDNFT------------------------------------------------ELSFK 83
            RHTDNF                                                 EL+F+
Sbjct: 4166 RHTDNFIPSQKSPIPLNRYDDFVDDLSQRSRSQDQTPEPRLVARALYNFVGQSSRELTFR 4225

Query: 84   KGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKIRTAPKKLSEGQARAKFNFVA 143
            +GDIIFVRRQVDKNWYEGE+NAMIGLFPFNYVEI+PYD +RT PKK  EGQARAKFNFVA
Sbjct: 4226 RGDIIFVRRQVDKNWYEGEYNAMIGLFPFNYVEILPYDGMRTTPKKAHEGQARAKFNFVA 4285

Query: 144  QTHLELSLVK 153
            QT+LELSLVK
Sbjct: 4286 QTNLELSLVK 4295




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345488740|ref|XP_001605377.2| PREDICTED: hypothetical protein LOC100121771 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380028397|ref|XP_003697889.1| PREDICTED: uncharacterized protein LOC100867381 [Apis florea] Back     alignment and taxonomy information
>gi|328780855|ref|XP_393153.4| PREDICTED: hypothetical protein LOC409655 [Apis mellifera] Back     alignment and taxonomy information
>gi|383851627|ref|XP_003701333.1| PREDICTED: uncharacterized protein LOC100875671 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307172916|gb|EFN64083.1| Sorbin and SH3 domain-containing protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332029655|gb|EGI69544.1| Sorbin and SH3 domain-containing protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328714703|ref|XP_003245429.1| PREDICTED: hypothetical protein LOC100167639 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|350409487|ref|XP_003488756.1| PREDICTED: hypothetical protein LOC100740896, partial [Bombus impatiens] Back     alignment and taxonomy information
>gi|321468642|gb|EFX79626.1| hypothetical protein DAPPUDRAFT_197424 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
FB|FBgn00335042412 CAP "CAP" [Drosophila melanoga 0.333 0.031 0.68 1.4e-39
UNIPROTKB|E1C0091006 SORBS1 "Uncharacterized protei 0.328 0.073 0.444 2.8e-19
UNIPROTKB|Q9BX66 1292 SORBS1 "Sorbin and SH3 domain- 0.328 0.057 0.444 1.1e-18
MGI|MGI:7000141290 Sorbs1 "sorbin and SH3 domain 0.333 0.058 0.45 1.3e-18
UNIPROTKB|F1SC491293 SORBS1 "Uncharacterized protei 0.328 0.057 0.444 1.4e-18
UNIPROTKB|F1M8201290 F1M820 "Uncharacterized protei 0.333 0.058 0.45 2.2e-18
UNIPROTKB|E2RDW31193 SORBS2 "Uncharacterized protei 0.617 0.116 0.357 3.3e-16
RGD|6200611196 Sorbs2 "sorbin and SH3 domain 0.333 0.062 0.506 8.9e-16
UNIPROTKB|O354131196 Sorbs2 "Sorbin and SH3 domain- 0.333 0.062 0.506 8.9e-16
UNIPROTKB|F1RMA6 732 SORBS3 "Uncharacterized protei 0.426 0.131 0.4 9.8e-16
FB|FBgn0033504 CAP "CAP" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 268 (99.4 bits), Expect = 1.4e-39, Sum P(2) = 1.4e-39
 Identities = 51/75 (68%), Positives = 61/75 (81%)

Query:    79 ELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKIRTAPKKLSEGQARAK 138
             ELSF+KGD I++RRQ+D NWYEGEHNAMIGL P +YVEI+  D  RT  K+ SEGQARAK
Sbjct:  2173 ELSFRKGDTIYIRRQIDANWYEGEHNAMIGLLPASYVEIVSRDGARTPSKRPSEGQARAK 2232

Query:   139 FNFVAQTHLELSLVK 153
             +NF AQ+ +ELSL K
Sbjct:  2233 YNFQAQSGIELSLNK 2247


GO:0017166 "vinculin binding" evidence=ISS
GO:0005925 "focal adhesion" evidence=ISS
UNIPROTKB|E1C009 SORBS1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BX66 SORBS1 "Sorbin and SH3 domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:700014 Sorbs1 "sorbin and SH3 domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SC49 SORBS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1M820 F1M820 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDW3 SORBS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|620061 Sorbs2 "sorbin and SH3 domain containing 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O35413 Sorbs2 "Sorbin and SH3 domain-containing protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMA6 SORBS3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.4.1.68LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
cd1178153 cd11781, SH3_Sorbs_1, First Src Homology 3 domain 2e-19
cd1178653 cd11786, SH3_SH3RF_1, First Src Homology 3 domain 3e-15
cd1180355 cd11803, SH3_Endophilin_A, Src homology 3 domain o 1e-14
cd1192155 cd11921, SH3_Vinexin_1, First Src Homology 3 domai 6e-14
cd1192055 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain 2e-13
cd1187753 cd11877, SH3_PIX, Src Homology 3 domain of Pak Int 2e-13
cd1192754 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain 2e-12
smart0032656 smart00326, SH3, Src homology 3 domains 5e-12
cd1191955 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain 5e-12
cd1192954 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain 2e-11
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 7e-11
cd1182652 cd11826, SH3_Abi, Src homology 3 domain of Abl Int 2e-10
cd1178253 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain 3e-10
cd1192854 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain 5e-10
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 7e-10
cd1197159 cd11971, SH3_Abi1, Src homology 3 domain of Abl In 9e-10
cd1184053 cd11840, SH3_Intersectin_5, Fifth Src homology 3 d 9e-10
cd1197261 cd11972, SH3_Abi2, Src homology 3 domain of Abl In 1e-09
cd1206154 cd12061, SH3_betaPIX, Src Homology 3 domain of bet 4e-09
cd1186954 cd11869, SH3_p40phox, Src Homology 3 domain of the 4e-09
cd1180953 cd11809, SH3_srGAP, Src homology 3 domain of Slit- 9e-09
cd1199554 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 1e-08
cd1199654 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 1e-08
cd1178753 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain 2e-08
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 2e-08
cd1195655 cd11956, SH3_srGAP4, Src homology 3 domain of Slit 2e-08
cd1192357 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domai 4e-08
cd1187555 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do 4e-08
cd1181954 cd11819, SH3_Cortactin_like, Src homology 3 domain 5e-08
cd1182054 cd11820, SH3_STAM, Src homology 3 domain of Signal 5e-08
cd1196455 cd11964, SH3_STAM1, Src homology 3 domain of Signa 6e-08
cd1187353 cd11873, SH3_CD2AP-like_1, First Src Homology 3 do 7e-08
cd1182353 cd11823, SH3_Nostrin, Src homology 3 domain of Nit 8e-08
cd1196357 cd11963, SH3_STAM2, Src homology 3 domain of Signa 1e-07
cd1192258 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domai 1e-07
cd1204653 cd12046, SH3_p67phox_C, C-terminal (or second) Src 1e-07
cd1195153 cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom 1e-07
cd1206058 cd12060, SH3_alphaPIX, Src Homology 3 domain of al 2e-07
cd1214255 cd12142, SH3_D21-like, Src Homology 3 domain of SH 2e-07
cd1184154 cd11841, SH3_SH3YL1_like, Src homology 3 domain of 2e-07
cd1193257 cd11932, SH3_SH3RF2_2, Second Src Homology 3 domai 4e-07
cd1187453 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d 4e-07
cd1177253 cd11772, SH3_OSTF1, Src Homology 3 domain of metaz 4e-07
cd1184255 cd11842, SH3_Ysc84p_like, Src homology 3 domain of 4e-07
cd1196054 cd11960, SH3_Abp1_eu, Src homology 3 domain of eum 5e-07
cd1187053 cd11870, SH3_p67phox-like_C, C-terminal Src Homolo 6e-07
cd1195953 cd11959, SH3_Cortactin, Src homology 3 domain of C 6e-07
cd1180653 cd11806, SH3_PRMT2, Src homology 3 domain of Prote 8e-07
cd1196153 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src 1e-06
pfam0001847 pfam00018, SH3_1, SH3 domain 1e-06
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 1e-06
cd1181552 cd11815, SH3_Eve1_2, Second Src homology 3 domain 2e-06
cd1182952 cd11829, SH3_GAS7, Src homology 3 domain of Growth 2e-06
cd1176653 cd11766, SH3_Nck_2, Second Src Homology 3 domain o 3e-06
cd1192456 cd11924, SH3_Vinexin_2, Second Src Homology 3 doma 3e-06
cd1179651 cd11796, SH3_DNMBP_N3, Third N-terminal Src homolo 3e-06
cd1180452 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3e-06
cd1188456 cd11884, SH3_MYO15, Src Homology 3 domain of Myosi 4e-06
cd1205756 cd12057, SH3_CIN85_3, Third Src Homology 3 domain 5e-06
cd1183958 cd11839, SH3_Intersectin_4, Fourth Src homology 3 5e-06
cd1181850 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain o 6e-06
cd1181750 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain 6e-06
cd1181651 cd11816, SH3_Eve1_3, Third Src homology 3 domain o 8e-06
cd1207355 cd12073, SH3_HS1, Src homology 3 domain of Hematop 8e-06
cd1193055 cd11930, SH3_SH3RF1_2, Second Src Homology 3 domai 1e-05
cd1176257 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain 1e-05
cd1176957 cd11769, SH3_CSK, Src Homology 3 domain of C-termi 1e-05
cd1183054 cd11830, SH3_VAV_2, C-terminal (or second) Src hom 1e-05
cd1194656 cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom 1e-05
cd1195553 cd11955, SH3_srGAP1-3, Src homology 3 domain of Sl 1e-05
cd1195053 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do 2e-05
cd1185162 cd11851, SH3_RIM-BP, Src homology 3 domains of Rab 2e-05
cd1182453 cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro 2e-05
cd1181050 cd11810, SH3_RUSC1_like, Src homology 3 domain of 2e-05
cd1182153 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP 3e-05
cd1188953 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of 3e-05
cd1182753 cd11827, SH3_MyoIe_If_like, Src homology 3 domain 4e-05
cd1188254 cd11882, SH3_GRAF-like, Src Homology 3 domain of G 4e-05
cd1197758 cd11977, SH3_VAV2_2, C-terminal (or second) Src ho 5e-05
cd1193155 cd11931, SH3_SH3RF3_2, Second Src Homology 3 domai 5e-05
cd1204753 cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 do 5e-05
cd1205455 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain 6e-05
cd1178555 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homo 6e-05
cd1205553 cd12055, SH3_CIN85_2, Second Src Homology 3 domain 6e-05
cd1183753 cd11837, SH3_Intersectin_2, Second Src homology 3 7e-05
cd1197654 cd11976, SH3_VAV1_2, C-terminal (or second) Src ho 7e-05
cd1183852 cd11838, SH3_Intersectin_3, Third Src homology 3 d 9e-05
cd1204453 cd12044, SH3_SKAP1, Src Homology 3 domain of Src K 9e-05
cd1205657 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain 9e-05
cd1178955 cd11789, SH3_Nebulin_family_C, C-terminal Src Homo 9e-05
cd1176355 cd11763, SH3_SNX9_like, Src Homology 3 domain of S 1e-04
cd1181353 cd11813, SH3_SGSM3, Src Homology 3 domain of Small 1e-04
cd1183655 cd11836, SH3_Intersectin_1, First Src homology 3 d 1e-04
cd1201361 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain 1e-04
cd1197856 cd11978, SH3_VAV3_2, C-terminal (or second) Src ho 1e-04
cd1184353 cd11843, SH3_PACSIN, Src homology 3 domain of Prot 1e-04
cd1201262 cd12012, SH3_RIM-BP_2, Second Src homology 3 domai 1e-04
cd1199152 cd11991, SH3_Intersectin1_3, Third Src homology 3 1e-04
cd1177851 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain 1e-04
cd1182554 cd11825, SH3_PLCgamma, Src homology 3 domain of Ph 2e-04
cd1204553 cd12045, SH3_SKAP2, Src Homology 3 domain of Src K 2e-04
cd1194752 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 do 2e-04
cd1186653 cd11866, SH3_SKAP1-like, Src Homology 3 domain of 2e-04
cd1190155 cd11901, SH3_Nck1_2, Second Src Homology 3 domain 2e-04
cd1177160 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain 3e-04
cd1179355 cd11793, SH3_ephexin1_like, Src homology 3 domain 3e-04
cd1182853 cd11828, SH3_ARHGEF9_like, Src homology 3 domain o 4e-04
cd1190255 cd11902, SH3_Nck2_2, Second Src Homology 3 domain 4e-04
cd1188760 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 a 4e-04
cd1191559 cd11915, SH3_Irsp53, Src Homology 3 domain of Insu 4e-04
cd1205253 cd12052, SH3_CIN85_1, First Src Homology 3 domain 5e-04
cd1193358 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 7e-04
cd1178055 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Ho 8e-04
cd1199052 cd11990, SH3_Intersectin2_2, Second Src homology 3 9e-04
cd1193459 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do 0.001
cd1185555 cd11855, SH3_Sho1p, Src homology 3 domain of High 0.001
cd1195851 cd11958, SH3_RUSC1, Src homology 3 domain of RUN a 0.001
cd1188355 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 0.001
cd1178253 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain 0.002
cd1197562 cd11975, SH3_ARHGEF9, Src homology 3 domain of the 0.002
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 0.002
cd1175957 cd11759, SH3_CRK_C, C-terminal Src Homology 3 doma 0.002
cd1205958 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixe 0.002
cd1199365 cd11993, SH3_Intersectin1_4, Fourth Src homology 3 0.002
cd1183353 cd11833, SH3_Stac_1, First C-terminal Src homology 0.003
cd1175752 cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 0.003
cd1194854 cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom 0.003
cd1198857 cd11988, SH3_Intersectin2_1, First Src homology 3 0.003
cd1195752 cd11957, SH3_RUSC2, Src homology 3 domain of RUN a 0.003
cd1192655 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain 0.004
>gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
 Score = 78.2 bits (193), Expect = 2e-19
 Identities = 29/42 (69%), Positives = 36/42 (85%)

Query: 76  NFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEI 117
           +  ELS KKGDII++RRQ+DKNWYEGEHN  +G+FP +YVEI
Sbjct: 12  SAKELSLKKGDIIYIRRQIDKNWYEGEHNGRVGIFPASYVEI 53


This family, also called the vinexin family, is composed predominantly of adaptor proteins containing one sorbin homology (SoHo) and three SH3 domains. Members include the first SH3 domains of Sorbs1 (or ponsin), Sorbs2 (or ArgBP2), Vinexin (or Sorbs3), and similar domains. They are involved in the regulation of cytoskeletal organization, cell adhesion, and growth factor signaling. Members of this family bind multiple partners including signaling molecules like c-Abl, c-Arg, Sos, and c-Cbl, as well as cytoskeletal molecules such as vinculin and afadin. They may have overlapping functions. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 53

>gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins Back     alignment and domain information
>gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A Back     alignment and domain information
>gnl|CDD|212854 cd11921, SH3_Vinexin_1, First Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) Back     alignment and domain information
>gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors Back     alignment and domain information
>gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin Back     alignment and domain information
>gnl|CDD|212862 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins Back     alignment and domain information
>gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212861 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1 Back     alignment and domain information
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin Back     alignment and domain information
>gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 Back     alignment and domain information
>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins Back     alignment and domain information
>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212721 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain of SH3 domain containing ring finger proteins Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase Activating Protein 4 Back     alignment and domain information
>gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins Back     alignment and domain information
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules Back     alignment and domain information
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 Back     alignment and domain information
>gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer Back     alignment and domain information
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 Back     alignment and domain information
>gnl|CDD|212855 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin Back     alignment and domain information
>gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins Back     alignment and domain information
>gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein Back     alignment and domain information
>gnl|CDD|212865 cd11932, SH3_SH3RF2_2, Second Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 Back     alignment and domain information
>gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins Back     alignment and domain information
>gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of the p67phox subunit of NADPH oxidase and similar proteins Back     alignment and domain information
>gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin Back     alignment and domain information
>gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 Back     alignment and domain information
>gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|212749 cd11815, SH3_Eve1_2, Second Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212763 cd11829, SH3_GAS7, Src homology 3 domain of Growth Arrest Specific protein 7 Back     alignment and domain information
>gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212857 cd11924, SH3_Vinexin_2, Second Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) Back     alignment and domain information
>gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212817 cd11884, SH3_MYO15, Src Homology 3 domain of Myosin XV Back     alignment and domain information
>gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212773 cd11839, SH3_Intersectin_4, Fourth Src homology 3 domain (or SH3D) of Intersectin Back     alignment and domain information
>gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 Back     alignment and domain information
>gnl|CDD|212863 cd11930, SH3_SH3RF1_2, Second Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and double SH3 domains proteins Back     alignment and domain information
>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins Back     alignment and domain information
>gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase Activating Proteins 1, 2, and 3 Back     alignment and domain information
>gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|212785 cd11851, SH3_RIM-BP, Src homology 3 domains of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|212744 cd11810, SH3_RUSC1_like, Src homology 3 domain of RUN and SH3 domain-containing proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing proteins Back     alignment and domain information
>gnl|CDD|212822 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of Cytokinesis protein 3 and similar proteins Back     alignment and domain information
>gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins Back     alignment and domain information
>gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase and similar proteins Back     alignment and domain information
>gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein Back     alignment and domain information
>gnl|CDD|212864 cd11931, SH3_SH3RF3_2, Second Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212980 cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 domain of NADPH oxidase activator 1 Back     alignment and domain information
>gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212719 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains Back     alignment and domain information
>gnl|CDD|212988 cd12055, SH3_CIN85_2, Second Src Homology 3 domain (SH3B) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin Back     alignment and domain information
>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein Back     alignment and domain information
>gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin Back     alignment and domain information
>gnl|CDD|212977 cd12044, SH3_SKAP1, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 Back     alignment and domain information
>gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins Back     alignment and domain information
>gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins Back     alignment and domain information
>gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein Signaling Modulator 3 Back     alignment and domain information
>gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A) of Intersectin Back     alignment and domain information
>gnl|CDD|212946 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain of VAV3 protein Back     alignment and domain information
>gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>gnl|CDD|212945 cd12012, SH3_RIM-BP_2, Second Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or SH3C) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and similar domains Back     alignment and domain information
>gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C (PLC) gamma Back     alignment and domain information
>gnl|CDD|212978 cd12045, SH3_SKAP2, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 2 Back     alignment and domain information
>gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|212800 cd11866, SH3_SKAP1-like, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 and similar proteins Back     alignment and domain information
>gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor protein Back     alignment and domain information
>gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p Back     alignment and domain information
>gnl|CDD|212727 cd11793, SH3_ephexin1_like, Src homology 3 domain of ephexin-1-like SH3 domain containing Rho guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212835 cd11902, SH3_Nck2_2, Second Src Homology 3 domain of Nck2 adaptor protein Back     alignment and domain information
>gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar domains Back     alignment and domain information
>gnl|CDD|212848 cd11915, SH3_Irsp53, Src Homology 3 domain of Insulin Receptor tyrosine kinase Substrate p53 Back     alignment and domain information
>gnl|CDD|212985 cd12052, SH3_CIN85_1, First Src Homology 3 domain (SH3A) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin Back     alignment and domain information
>gnl|CDD|212714 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212923 cd11990, SH3_Intersectin2_2, Second Src homology 3 domain (or SH3B) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 Back     alignment and domain information
>gnl|CDD|212789 cd11855, SH3_Sho1p, Src homology 3 domain of High osmolarity signaling protein Sho1p Back     alignment and domain information
>gnl|CDD|212891 cd11958, SH3_RUSC1, Src homology 3 domain of RUN and SH3 domain-containing protein 1 Back     alignment and domain information
>gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212908 cd11975, SH3_ARHGEF9, Src homology 3 domain of the Rho guanine nucleotide exchange factor ARHGEF9 Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212693 cd11759, SH3_CRK_C, C-terminal Src Homology 3 domain of Ct10 Regulator of Kinase adaptor proteins Back     alignment and domain information
>gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases 1, 2, and 3 Back     alignment and domain information
>gnl|CDD|212926 cd11993, SH3_Intersectin1_4, Fourth Src homology 3 domain (or SH3D) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins Back     alignment and domain information
>gnl|CDD|212691 cd11757, SH3_SH3BP4, Src Homology 3 domain of SH3 domain-binding protein 4 Back     alignment and domain information
>gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212921 cd11988, SH3_Intersectin2_1, First Src homology 3 domain (or SH3A) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212890 cd11957, SH3_RUSC2, Src homology 3 domain of RUN and SH3 domain-containing protein 2 Back     alignment and domain information
>gnl|CDD|212859 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1, an E3 ubiquitin-protein ligase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
KOG4225|consensus489 99.72
KOG1029|consensus1118 99.65
KOG4226|consensus379 99.64
KOG4348|consensus 627 99.63
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.63
KOG4348|consensus 627 99.62
KOG1029|consensus 1118 99.55
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 99.52
KOG2199|consensus462 99.45
KOG2070|consensus 661 99.38
KOG3601|consensus222 99.36
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 99.32
KOG1118|consensus366 99.32
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 99.25
KOG4226|consensus 379 99.25
KOG4792|consensus293 99.22
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 99.2
KOG4225|consensus489 99.15
KOG0162|consensus1106 99.15
KOG2996|consensus865 99.14
KOG1264|consensus 1267 99.12
KOG3632|consensus1335 99.01
KOG2856|consensus472 98.9
KOG2546|consensus483 98.84
KOG4278|consensus 1157 98.73
KOG3601|consensus222 98.65
KOG0515|consensus752 98.62
KOG3875|consensus362 98.51
KOG3655|consensus484 98.51
KOG0197|consensus 468 98.51
KOG1702|consensus264 98.47
KOG1843|consensus473 98.35
KOG0609|consensus 542 98.31
KOG2996|consensus865 98.27
KOG2222|consensus 848 98.11
KOG3523|consensus695 97.94
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 97.81
KOG4792|consensus293 97.64
KOG2528|consensus 490 97.63
KOG1451|consensus812 97.6
KOG4773|consensus386 97.6
KOG3775|consensus482 97.54
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 97.47
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 97.43
KOG3632|consensus1335 97.35
KOG3557|consensus721 97.34
KOG4575|consensus 874 97.34
KOG4429|consensus421 97.26
KOG2199|consensus 462 97.23
KOG3771|consensus460 97.04
KOG2070|consensus 661 96.93
KOG3725|consensus375 96.41
KOG1118|consensus366 96.39
KOG0162|consensus1106 96.38
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 96.29
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 96.28
KOG0515|consensus752 96.26
KOG2546|consensus483 95.8
KOG2856|consensus472 95.75
PF0823955 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S 95.63
KOG3565|consensus640 94.77
PF1460389 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. 94.55
KOG0199|consensus 1039 94.27
KOG1264|consensus 1267 94.09
smart0028763 SH3b Bacterial SH3 domain homologues. 93.53
KOG1702|consensus264 93.11
KOG0040|consensus 2399 92.45
PRK10884206 SH3 domain-containing protein; Provisional 91.52
PF0634755 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 S 90.79
KOG3812|consensus 475 90.77
KOG3705|consensus580 87.07
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 86.86
KOG4429|consensus421 86.65
KOG3655|consensus484 84.14
KOG2222|consensus 848 83.89
KOG3875|consensus362 83.14
PRK13914 481 invasion associated secreted endopeptidase; Provis 82.56
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 81.05
KOG4773|consensus 386 80.74
KOG1843|consensus473 80.51
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 80.06
>KOG4225|consensus Back     alignment and domain information
Probab=99.72  E-value=2.2e-17  Score=143.91  Aligned_cols=107  Identities=39%  Similarity=0.681  Sum_probs=90.9

Q ss_pred             EEEeecccCCCCCCCCccccccCCCeEEEEEecCCCeEEEEECCeEEEeeCCcEEeecCCCC----CCCc-CCCCcCcEE
Q psy15850         62 LQELHDISSRRHTDNFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKI----RTAP-KKLSEGQAR  136 (225)
Q Consensus        62 ~~al~d~~~~~~~~~~~eLs~~~Gdii~v~~~~~~~Ww~g~~~g~~G~~P~nyv~~~~~~~~----~~~~-~~~~~~~~~  136 (225)
                      ++|+|+|.++    ...||+|++||||.|+.+.|.+|+.|+.+|+.|+||+|||+.+.....    .+.| +....|.++
T Consensus       233 aralf~F~~q----t~kEL~~~kGDIVyI~rkvD~nWyeGEhhGr~GifP~sYvE~~~~~e~~qP~~~~P~q~~~~g~a~  308 (489)
T KOG4225|consen  233 ARALFDFEAQ----TPKELPFNKGDIVYILRKVDQNWYEGEHHGRVGIFPASYVEILTPREKAQPARPPPQQVLEQGEAI  308 (489)
T ss_pred             hhheeccccC----CccccccCCCCEEEEEeeccCceeeeeecceecceechheeecCcccccCcCCCCccccccccccc
Confidence            7899999999    788999999999999999999999999999999999999999875221    2222 223577899


Q ss_pred             EcccccCCCccccccccccceEEecccccccccccch
Q psy15850        137 AKFNFVAQTHLELSLVKESPHKYVDSEVTLQYRRPVR  173 (225)
Q Consensus       137 a~~~~~~~~~~els~~~g~~v~~~~~~~~~~~~f~~~  173 (225)
                      |.|+|.+....||++++|+.|+.... +++.|..+.+
T Consensus       309 A~y~F~~~s~~Els~~kge~v~L~r~-vd~nw~eG~i  344 (489)
T KOG4225|consen  309 AKYNFNADSPVELSLRKGERVTLTRQ-VDENWYEGKI  344 (489)
T ss_pred             ccCCCCCCCchhcccccCceEEEEEe-ccCceeeccc
Confidence            99999999999999999999998875 6666664333



>KOG1029|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG3565|consensus Back     alignment and domain information
>PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>smart00287 SH3b Bacterial SH3 domain homologues Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF06347 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>KOG3705|consensus Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>PRK13914 invasion associated secreted endopeptidase; Provisional Back     alignment and domain information
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
2dlm_A68 Solution Structure Of The First Sh3 Domain Of Human 2e-10
2nwm_A65 Solution Structure Of The First Sh3 Domain Of Human 4e-10
2dl3_A68 Solution Structure Of The First Sh3 Domain Of Human 2e-09
2djq_A68 The Solution Structure Of The First Sh3 Domain Of M 4e-09
2dbm_A73 Solution Structures Of The Sh3 Domain Of Human Sh3- 1e-08
3iql_A71 Crystal Structure Of The Rat Endophilin-A1 Sh3 Doma 1e-08
2ew3_A68 Solution Structure Of The Sh3 Domain Of Human Sh3gl 1e-08
2ed0_A78 Solution Structure Of The Sh3 Domain Of Abl Interac 9e-08
1gri_A217 Grb2 Length = 217 2e-07
1gri_A217 Grb2 Length = 217 2e-06
3c0c_A73 X-Ray Crystal Structure Of The Rat Endophilin A2 Sh 3e-07
3gf9_A 295 Crystal Structure Of Human Intersectin 2 Rhogef Dom 4e-07
1udl_A98 The Solution Structure Of The Fifth Sh3 Domain Of I 2e-06
2df6_A59 Crystal Structure Of The Sh3 Domain Of Betapix In C 2e-06
2dyb_A341 The Crystal Structure Of Human P40(Phox) Length = 3 2e-06
2esw_A61 Atomic Structure Of The N-Terminal Sh3 Domain Of Mo 2e-06
3jv3_A 283 Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l 2e-06
2ak5_A64 Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length 3e-06
1sem_A58 Structural Determinants Of Peptide-Binding Orientat 4e-06
1x2q_A88 Solution Structure Of The Sh3 Domain Of The Signal 4e-06
3sem_A60 Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Le 5e-06
1z9q_A79 Solution Structure Of Sh3 Domain Of P40phox Length 6e-06
1k76_A62 Solution Structure Of The C-Terminal Sem-5 Sh3 Doma 8e-06
1w6x_A60 Sh3 Domain Of P40phox, Component Of The Nadph Oxida 1e-05
2ecz_A70 Solution Structure Of The Sh3 Domain Of Sorbin And 1e-05
2epd_A76 Solution Structure Of Sh3 Domain In Rho-Gtpase-Acti 2e-05
2o2w_A67 Extending Powder Diffraction To Proteins: Structure 2e-05
1ujy_A76 Solution Structure Of Sh3 Domain In RacCDC42 GUANIN 2e-05
2l0a_A72 Solution Nmr Structure Of Signal Transducing Adapte 3e-05
4gbq_A74 Solution Nmr Structure Of The Grb2 N-Terminal Sh3 D 3e-05
2vwf_A58 Grb2 Sh3c (2) Length = 58 5e-05
1io6_A59 Growth Factor Receptor-Bound Protein 2 (Grb2) C-Ter 5e-05
1gcq_A61 Crystal Structure Of Vav And Grb2 Sh3 Domains Lengt 5e-05
1zsg_A65 Beta Pix-Sh3 Complexed With An Atypical Peptide Fro 9e-05
2yun_A79 Solution Structure Of The Sh3 Domain Of Human Nostr 1e-04
2vvk_A56 Grb2 Sh3c (1) Length = 56 1e-04
2dl8_A72 Solution Structure Of The Sh3 Domain Of Human Slit- 1e-04
2ydl_A69 Crystal Structure Of Sh3c From Cin85 Length = 69 1e-04
2k6d_A62 Cin85 Sh3-C Domain In Complex With Ubiquitin Length 1e-04
1zlm_A58 Crystal Structure Of The Sh3 Domain Of Human Osteoc 2e-04
1x2k_A68 Solution Structure Of The Sh3 Domain Of Human Osteo 2e-04
2o2o_A92 Solution Structure Of Domain B From Human Cin85 Pro 2e-04
1uj0_A62 Crystal Structure Of Stam2 Sh3 Domain In Complex Wi 2e-04
2k9g_A73 Solution Structure Of The Third Sh3 Domain Of The C 2e-04
2yup_A90 Solution Structure Of The Second Sh3 Domain Of Huma 2e-04
2gnc_A60 Crystal Structure Of Srgap1 Sh3 Domain In The Slit- 2e-04
2drk_A59 Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L 2e-04
2drm_A58 Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L 2e-04
1oot_A60 Crystal Structure Of The Sh3 Domain From A S. Cerev 3e-04
2yuo_A78 Solution Structure Of The Sh3 Domain Of Mouse Run A 3e-04
2a08_A60 Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 4e-04
1aze_A56 Nmr Structure Of The Complex Between The C32s-Y7v M 4e-04
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 4e-04
1wi7_A68 Solution Structure Of The Sh3 Domain Of Sh3-Domain 5e-04
3u23_A65 Atomic Resolution Crystal Structure Of The 2nd Sh3 5e-04
2fei_A65 Solution Structure Of The Second Sh3 Domain Of Huma 5e-04
2kbt_A142 Attachment Of An Nmr-Invisible Solubility Enhanceme 7e-04
1k4u_S62 Solution Structure Of The C-Terminal Sh3 Domain Of 9e-04
>pdb|2DLM|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Vinexin Length = 68 Back     alignment and structure

Iteration: 1

Score = 62.4 bits (150), Expect = 2e-10, Method: Composition-based stats. Identities = 22/40 (55%), Positives = 34/40 (85%) Query: 79 ELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEII 118 EL+ +KGDI+++ ++VDKNW EGEH+ +G+FP NYVE++ Sbjct: 23 ELTLQKGDIVYIHKEVDKNWLEGEHHGRLGIFPANYVEVL 62
>pdb|2NWM|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Vinexin And Its Interaction With The Peptides From Vinculin Length = 65 Back     alignment and structure
>pdb|2DL3|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Sorbin And Sh3 Domain-Containing Protein 1 Length = 68 Back     alignment and structure
>pdb|2DJQ|A Chain A, The Solution Structure Of The First Sh3 Domain Of Mouse Sh3 Domain Containing Ring Finger 2 Length = 68 Back     alignment and structure
>pdb|2DBM|A Chain A, Solution Structures Of The Sh3 Domain Of Human Sh3- Containing Grb2-Like Protein 2 Length = 73 Back     alignment and structure
>pdb|3IQL|A Chain A, Crystal Structure Of The Rat Endophilin-A1 Sh3 Domain Length = 71 Back     alignment and structure
>pdb|2EW3|A Chain A, Solution Structure Of The Sh3 Domain Of Human Sh3gl3 Length = 68 Back     alignment and structure
>pdb|2ED0|A Chain A, Solution Structure Of The Sh3 Domain Of Abl Interactor 2 (Abelson Interactor 2) Length = 78 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|3C0C|A Chain A, X-Ray Crystal Structure Of The Rat Endophilin A2 Sh3 Domain Length = 73 Back     alignment and structure
>pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 Back     alignment and structure
>pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 Back     alignment and structure
>pdb|2DF6|A Chain A, Crystal Structure Of The Sh3 Domain Of Betapix In Complex With A High Affinity Peptide From Pak2 Length = 59 Back     alignment and structure
>pdb|2DYB|A Chain A, The Crystal Structure Of Human P40(Phox) Length = 341 Back     alignment and structure
>pdb|2ESW|A Chain A, Atomic Structure Of The N-Terminal Sh3 Domain Of Mouse Beta Pix,P21-Activated Kinase (Pak)-Interacting Exchange Factor Length = 61 Back     alignment and structure
>pdb|3JV3|A Chain A, Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l Length = 283 Back     alignment and structure
>pdb|2AK5|A Chain A, Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length = 64 Back     alignment and structure
>pdb|1SEM|A Chain A, Structural Determinants Of Peptide-Binding Orientation And Of Sequence Specificity In Sh3 Domains Length = 58 Back     alignment and structure
>pdb|1X2Q|A Chain A, Solution Structure Of The Sh3 Domain Of The Signal Transducing Adaptor Molecule 2 Length = 88 Back     alignment and structure
>pdb|3SEM|A Chain A, Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Length = 60 Back     alignment and structure
>pdb|1Z9Q|A Chain A, Solution Structure Of Sh3 Domain Of P40phox Length = 79 Back     alignment and structure
>pdb|1K76|A Chain A, Solution Structure Of The C-Terminal Sem-5 Sh3 Domain (Minimized Average Structure) Length = 62 Back     alignment and structure
>pdb|1W6X|A Chain A, Sh3 Domain Of P40phox, Component Of The Nadph Oxidase Length = 60 Back     alignment and structure
>pdb|2ECZ|A Chain A, Solution Structure Of The Sh3 Domain Of Sorbin And Sh3 Domain-Containing Protein 1 Length = 70 Back     alignment and structure
>pdb|2EPD|A Chain A, Solution Structure Of Sh3 Domain In Rho-Gtpase-Activating Protein 4 Length = 76 Back     alignment and structure
>pdb|2O2W|A Chain A, Extending Powder Diffraction To Proteins: Structure Solution Of The Second Sh3 Domain From Ponsin Length = 67 Back     alignment and structure
>pdb|1UJY|A Chain A, Solution Structure Of Sh3 Domain In RacCDC42 GUANINE Nucleotide Exchange Factor(Gef) 6 Length = 76 Back     alignment and structure
>pdb|2L0A|A Chain A, Solution Nmr Structure Of Signal Transducing Adapter Molecule 1 Stam-1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4479e Length = 72 Back     alignment and structure
>pdb|4GBQ|A Chain A, Solution Nmr Structure Of The Grb2 N-Terminal Sh3 Domain Complexed With A Ten-Residue Peptide Derived From Sos Direct Refinement Against Noes, J-Couplings, And 1h And 13c Chemical Shifts, 15 Structures Length = 74 Back     alignment and structure
>pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 Back     alignment and structure
>pdb|1IO6|A Chain A, Growth Factor Receptor-Bound Protein 2 (Grb2) C-Terminal Sh3 Domain Complexed With A Ligand Peptide (Nmr, Minimized Mean Structure) Length = 59 Back     alignment and structure
>pdb|1GCQ|A Chain A, Crystal Structure Of Vav And Grb2 Sh3 Domains Length = 61 Back     alignment and structure
>pdb|1ZSG|A Chain A, Beta Pix-Sh3 Complexed With An Atypical Peptide From Alpha- Pak Length = 65 Back     alignment and structure
>pdb|2YUN|A Chain A, Solution Structure Of The Sh3 Domain Of Human Nostrin Length = 79 Back     alignment and structure
>pdb|2VVK|A Chain A, Grb2 Sh3c (1) Length = 56 Back     alignment and structure
>pdb|2DL8|A Chain A, Solution Structure Of The Sh3 Domain Of Human Slit-Robo Rho Gtpase-Activating Protein 2 Length = 72 Back     alignment and structure
>pdb|2YDL|A Chain A, Crystal Structure Of Sh3c From Cin85 Length = 69 Back     alignment and structure
>pdb|2K6D|A Chain A, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 62 Back     alignment and structure
>pdb|1ZLM|A Chain A, Crystal Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor Length = 58 Back     alignment and structure
>pdb|1X2K|A Chain A, Solution Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor 1 (Ostf1) Length = 68 Back     alignment and structure
>pdb|2O2O|A Chain A, Solution Structure Of Domain B From Human Cin85 Protein Length = 92 Back     alignment and structure
>pdb|1UJ0|A Chain A, Crystal Structure Of Stam2 Sh3 Domain In Complex With A Ubpy-Derived Peptide Length = 62 Back     alignment and structure
>pdb|2K9G|A Chain A, Solution Structure Of The Third Sh3 Domain Of The Cin85 Adapter Protein Length = 73 Back     alignment and structure
>pdb|2YUP|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Vinexin Length = 90 Back     alignment and structure
>pdb|2GNC|A Chain A, Crystal Structure Of Srgap1 Sh3 Domain In The Slit-Robo Signaling Pathway Length = 60 Back     alignment and structure
>pdb|2DRK|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 59 Back     alignment and structure
>pdb|2DRM|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 58 Back     alignment and structure
>pdb|1OOT|A Chain A, Crystal Structure Of The Sh3 Domain From A S. Cerevisiae Hypothetical 40.4 Kda Protein At 1.39 A Resolution Length = 60 Back     alignment and structure
>pdb|2YUO|A Chain A, Solution Structure Of The Sh3 Domain Of Mouse Run And Tbc1 Domain Containing 3 Length = 78 Back     alignment and structure
>pdb|2A08|A Chain A, Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 Back     alignment and structure
>pdb|1AZE|A Chain A, Nmr Structure Of The Complex Between The C32s-Y7v Mutant Of The Nsh3 Domain Of Grb2 With A Peptide From Sos, 10 Structures Length = 56 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|1WI7|A Chain A, Solution Structure Of The Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 Length = 68 Back     alignment and structure
>pdb|3U23|A Chain A, Atomic Resolution Crystal Structure Of The 2nd Sh3 Domain From Human Cd2ap (Cms) In Complex With A Proline-Rich Peptide From Human Rin3 Length = 65 Back     alignment and structure
>pdb|2FEI|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Cms Protein Length = 65 Back     alignment and structure
>pdb|2KBT|A Chain A, Attachment Of An Nmr-Invisible Solubility Enhancement Tag (Inset) Using A Sortase-Mediated Protein Ligation Method Length = 142 Back     alignment and structure
>pdb|1K4U|S Chain S, Solution Structure Of The C-Terminal Sh3 Domain Of P67phox Complexed With The C-Terminal Tail Region Of P47phox Length = 62 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 2e-21
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 3e-21
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 5e-21
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 5e-21
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} Length 7e-21
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 2e-20
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 4e-20
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 5e-20
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 6e-20
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 6e-20
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 7e-20
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 7e-20
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 1e-19
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 2e-19
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 3e-19
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 3e-19
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 3e-19
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 5e-19
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 8e-19
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 1e-18
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 1e-18
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 1e-10
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 2e-18
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 4e-18
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 4e-18
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 5e-18
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 5e-18
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 5e-18
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 5e-18
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 1e-17
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 5e-09
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 1e-17
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 2e-17
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 2e-17
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 2e-17
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 2e-17
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 2e-17
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 3e-17
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 4e-17
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 4e-17
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 6e-17
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 8e-17
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 9e-17
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 1e-16
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 1e-16
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 1e-16
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 2e-16
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 2e-16
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 3e-16
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 3e-16
3u23_A65 CD2-associated protein; structural genomics, struc 3e-16
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 3e-16
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 4e-16
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 5e-16
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 5e-16
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 5e-16
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 5e-16
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 5e-16
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 6e-16
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 7e-16
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 1e-15
2da9_A70 SH3-domain kinase binding protein 1; structural ge 1e-15
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 1e-15
2dil_A69 Proline-serine-threonine phosphatase-interacting p 1e-15
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 1e-15
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 2e-15
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 2e-15
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 2e-15
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 3e-15
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 3e-15
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 4e-15
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 4e-15
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 4e-15
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 7e-15
1uti_A58 GRB2-related adaptor protein 2; signaling protein 9e-15
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 9e-15
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 1e-14
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 1e-14
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 1e-14
2cuc_A70 SH3 domain containing ring finger 2; structural ge 2e-14
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 2e-14
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 2e-14
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 2e-14
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 4e-14
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 4e-14
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 5e-14
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 6e-14
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 7e-14
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 8e-14
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 1e-13
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 1e-13
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 1e-13
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 1e-13
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 1e-13
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 1e-13
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 2e-13
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 2e-13
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 2e-13
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 3e-13
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 4e-13
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 5e-13
2j6f_A62 CD2-associated protein; metal-binding, immune resp 6e-13
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 6e-13
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 9e-13
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 9e-13
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 4e-10
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 7e-06
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 1e-12
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 1e-12
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 1e-12
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 2e-12
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 2e-12
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 2e-12
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 2e-12
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 3e-12
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 3e-12
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 4e-12
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 4e-12
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 4e-08
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 6e-12
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 6e-12
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 7e-12
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 2e-11
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 5e-07
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 2e-11
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 2e-11
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 6e-11
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 7e-11
1wxb_A68 Epidermal growth factor receptor pathway substrate 8e-11
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 8e-11
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 1e-10
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 1e-10
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 2e-10
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 2e-10
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 2e-10
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 3e-10
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 3e-10
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 4e-10
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 4e-10
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 4e-10
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 4e-10
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 5e-10
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 5e-10
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 7e-10
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 7e-10
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 9e-10
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 1e-09
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 1e-09
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 1e-09
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 2e-09
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 4e-09
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 4e-09
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 5e-09
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 7e-09
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 1e-08
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 5e-08
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 1e-08
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 1e-08
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 1e-08
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 1e-08
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 2e-08
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 2e-08
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 3e-08
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 3e-08
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 4e-08
1awj_A77 ITK; transferase, regulatory intramolecular comple 7e-08
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 7e-08
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 7e-08
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 7e-08
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 8e-08
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 3e-07
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 4e-07
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 4e-07
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 5e-07
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 6e-07
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 2e-06
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 4e-06
1i07_A60 Epidermal growth factor receptor kinase substrate 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 1e-05
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 1e-05
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 2e-05
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 8e-05
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 1e-04
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 1e-04
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 4e-04
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 4e-04
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 Back     alignment and structure
 Score = 83.4 bits (207), Expect = 2e-21
 Identities = 22/41 (53%), Positives = 32/41 (78%)

Query: 79  ELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIP 119
           +L F KGD+I +RRQ+D+NWY+GE N + G+FP + VE+I 
Sbjct: 23  DLKFNKGDVILLRRQLDENWYQGEINGVSGIFPASSVEVIS 63


>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.84
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.78
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.75
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.73
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.72
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 99.56
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.71
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 99.69
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 99.68
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.68
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.67
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.67
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.67
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.66
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.66
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.66
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.66
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.66
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.66
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.66
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.65
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.65
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.65
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.65
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.65
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.64
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.64
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.64
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.64
3u23_A65 CD2-associated protein; structural genomics, struc 99.64
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.64
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.64
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.64
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.64
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.64
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.64
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.64
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.64
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.64
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.64
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.64
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.64
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.63
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.63
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.63
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.63
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.63
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.63
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.63
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 99.63
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.63
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.63
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.63
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.63
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 99.63
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.62
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.62
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.62
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.62
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.62
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.62
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.62
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 99.62
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.62
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.62
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 99.62
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.62
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 99.61
2da9_A70 SH3-domain kinase binding protein 1; structural ge 99.61
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.61
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.61
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.61
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.61
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.61
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.61
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.61
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.61
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 99.61
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.61
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.6
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.6
2dil_A69 Proline-serine-threonine phosphatase-interacting p 99.6
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 99.6
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.6
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 99.6
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.6
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 99.6
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 99.6
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 99.6
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 99.6
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.6
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.6
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.6
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.6
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.6
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 99.6
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.6
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 99.59
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 99.59
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 99.59
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 99.59
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 99.59
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 99.59
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 99.59
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.59
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 99.59
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.59
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.58
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 99.58
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 99.58
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.58
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.58
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 99.58
1i07_A60 Epidermal growth factor receptor kinase substrate 99.58
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 99.58
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.58
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 99.58
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.58
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 99.58
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 99.58
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 99.58
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.58
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.58
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 99.58
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.57
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 99.57
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 99.57
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 99.57
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.56
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 99.56
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 99.56
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 99.56
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.56
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 99.56
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 99.56
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.56
2cuc_A70 SH3 domain containing ring finger 2; structural ge 99.56
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 99.56
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 99.56
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 99.55
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 99.55
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.55
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.55
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 99.55
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.55
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.54
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 99.54
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 99.54
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 99.54
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 99.53
1wxb_A68 Epidermal growth factor receptor pathway substrate 99.53
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 99.53
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 99.53
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 99.53
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 99.52
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.52
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.52
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 99.52
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 99.51
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 99.51
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.51
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.51
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 99.51
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.51
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 99.5
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 99.5
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.5
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 99.49
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 99.48
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 99.48
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 99.47
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 99.47
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 99.47
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 99.47
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.47
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 99.46
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 99.46
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 99.45
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 99.45
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.43
1awj_A77 ITK; transferase, regulatory intramolecular comple 99.41
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 99.4
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.4
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 99.4
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.4
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.36
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 99.35
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 99.31
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.3
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 99.29
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.27
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 99.25
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.82
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 99.17
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 99.17
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.16
1u3o_A82 Huntingtin-associated protein-interacting protein; 99.14
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.11
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 99.05
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 99.01
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 98.98
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 98.86
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 98.86
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 98.84
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 98.69
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.62
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.56
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 98.56
3kfv_A 308 Tight junction protein ZO-3; structural genomics c 98.54
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.51
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.46
3tvt_A 292 Disks large 1 tumor suppressor protein; DLG, SRC-h 98.43
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 98.32
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 98.3
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 98.15
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 98.08
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 98.01
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 98.01
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 98.0
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 98.0
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 97.99
2j6f_A62 CD2-associated protein; metal-binding, immune resp 97.99
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 97.98
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 97.97
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 97.97
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 97.97
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 97.96
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 97.96
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 97.95
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 97.95
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 97.95
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 97.95
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 97.94
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 97.93
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 97.93
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 97.93
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 97.93
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 97.91
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 97.91
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 97.9
1uti_A58 GRB2-related adaptor protein 2; signaling protein 97.9
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 97.9
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 97.89
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 97.89
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 97.89
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 97.89
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 97.88
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 97.88
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 97.88
2da9_A70 SH3-domain kinase binding protein 1; structural ge 97.88
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 97.87
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 97.87
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 97.87
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 97.87
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 97.86
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 97.86
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 97.86
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 97.85
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 97.85
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 97.85
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 97.85
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 97.85
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.85
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 97.85
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 97.85
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 97.85
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 97.84
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 97.84
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 97.84
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 97.84
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 97.84
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 97.84
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 97.84
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 97.83
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 97.83
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 97.83
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 97.83
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 97.83
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 97.82
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 97.82
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 97.82
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 97.81
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 97.81
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 97.81
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 97.8
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 97.8
3u23_A65 CD2-associated protein; structural genomics, struc 97.8
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 97.8
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 97.8
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 97.8
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 97.79
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 97.78
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 97.78
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 97.78
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 97.78
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 97.78
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 97.78
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 97.77
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 97.77
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 97.77
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 97.77
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 97.77
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 97.77
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 97.76
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 97.76
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 97.76
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 97.75
2dil_A69 Proline-serine-threonine phosphatase-interacting p 97.75
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 97.75
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 97.75
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 97.75
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 97.75
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 97.75
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 97.75
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 97.74
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 97.74
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 97.74
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 97.74
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 97.73
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 97.73
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 97.72
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 97.72
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 97.72
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 97.72
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 97.72
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 97.71
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 97.71
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 97.71
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 97.71
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 97.71
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 97.71
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 97.71
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 97.7
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 97.7
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 97.7
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 97.69
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 97.69
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 97.69
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 97.69
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 97.68
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 97.68
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 97.68
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 97.68
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 97.67
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 97.67
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 97.66
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 97.66
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 97.66
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 97.66
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 97.66
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 97.65
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 97.65
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 97.64
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 97.63
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 97.63
1i07_A60 Epidermal growth factor receptor kinase substrate 97.62
2cuc_A70 SH3 domain containing ring finger 2; structural ge 97.61
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 97.58
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 97.58
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 97.58
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 97.58
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 97.54
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 97.54
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 97.53
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 97.52
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 97.52
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 97.52
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 97.51
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 97.5
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 97.49
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 97.48
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 97.47
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 97.45
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 97.45
1awj_A77 ITK; transferase, regulatory intramolecular comple 97.45
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 97.44
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 97.4
1wxb_A68 Epidermal growth factor receptor pathway substrate 97.39
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 97.39
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 97.38
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 97.28
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 97.24
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 97.22
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 97.21
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 97.18
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 97.15
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 96.96
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 96.95
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 96.89
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 96.89
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 96.78
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 96.67
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 96.67
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 96.57
1u3o_A82 Huntingtin-associated protein-interacting protein; 96.53
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 96.51
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 96.33
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 96.32
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 96.31
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 96.25
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 96.13
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 96.13
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 95.84
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 95.71
2kt8_A76 Probable surface protein; SH3 family, structural g 95.61
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 95.6
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 95.59
2dly_A121 FYN-related kinase; BRK family kinase, structural 95.56
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_058 95.52
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 95.45
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 95.13
2kq8_A70 Cell WALL hydrolase; GFT protein structure, NESG, 95.02
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 94.12
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 93.64
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 93.61
3maz_A125 Signal-transducing adaptor protein 1; modular doma 93.05
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 92.88
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 92.82
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 92.66
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 92.39
3kfv_A 308 Tight junction protein ZO-3; structural genomics c 92.28
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 92.27
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 92.26
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 92.12
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 92.04
1wfw_A74 Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex 92.04
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 91.93
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 91.72
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 91.61
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 91.41
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 91.26
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 90.9
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 90.81
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 90.74
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 90.3
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 90.12
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 90.0
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 89.68
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 89.63
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 89.57
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 89.57
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 89.17
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 88.84
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 88.74
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 88.74
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 88.69
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 88.63
3tvt_A 292 Disks large 1 tumor suppressor protein; DLG, SRC-h 88.56
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 88.31
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 88.19
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 87.92
2vif_A141 Suppressor of cytokine signalling 6; growth regula 87.03
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 86.81
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 86.75
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 86.58
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 86.57
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 86.48
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 85.92
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 85.48
4fbn_A 246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 85.3
2aug_A126 Growth factor receptor-bound protein 14; phosphory 84.99
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 84.81
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 84.75
2oq1_A 254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 84.09
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 84.09
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 84.06
3npf_A 306 Putative dipeptidyl-peptidase VI; structural genom 83.88
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 83.25
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 83.09
1a81_A 254 SYK kinase; complex (transferase-peptide), SYK, ki 82.91
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 82.34
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 80.75
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 80.38
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
Probab=99.84  E-value=2.2e-21  Score=156.40  Aligned_cols=120  Identities=13%  Similarity=0.220  Sum_probs=98.3

Q ss_pred             ceEEEEeecccCCCCCCCCccccccCCCeEEEEEecCCCeEEEEECCeEEEeeCCcEEeecCCCCCCCcCC-CCcCcEEE
Q psy15850         59 RKYLQELHDISSRRHTDNFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIPYDKIRTAPKK-LSEGQARA  137 (225)
Q Consensus        59 ~~~~~al~d~~~~~~~~~~~eLs~~~Gdii~v~~~~~~~Ww~g~~~g~~G~~P~nyv~~~~~~~~~~~~~~-~~~~~~~a  137 (225)
                      ...++|+|||.+.    ..+||+|++||+|.|+.+.+.+||.|+.+|+.||||++||+.+........+.. .....++|
T Consensus        11 ~~~~~al~dy~~~----~~~eLs~~~Gd~i~vl~~~~~gWw~g~~~g~~G~~P~~yv~~~~~~~~~~~~~p~~~~~~~~a   86 (193)
T 1ng2_A           11 LQTYRAIADYEKT----SGSEMALSTGDVVEVVEKSESGWWFCQMKAKRGWIPASFLEPLDSPDETEDPEPNYAGEPYVA   86 (193)
T ss_dssp             CEEEECSSCBCCS----STTCCCBCTTCEEEEEECCTTSCCEEEECCCCCCCCGGGCCCSSCSSCSCCCCCCTTCEEEEE
T ss_pred             CcEEEEcCCcCCC----CCCcCCCCCCCEEEEEEecCCCeEEEEECCeeeEechheEEeeccccccchhhccccceeeee
Confidence            4568999999999    788999999999999999899999999999999999999998765432211111 13346899


Q ss_pred             cccccCCCccccccccccceEEecccccccccccchhhhhhccchh
Q psy15850        138 KFNFVAQTHLELSLVKESPHKYVDSEVTLQYRRPVRNEIKELISEE  183 (225)
Q Consensus       138 ~~~~~~~~~~els~~~g~~v~~~~~~~~~~~~f~~~~~l~e~~~~~  183 (225)
                      +|+|.+..+++|+|.+||+|.++.. ..++||.+..+.-..|++.+
T Consensus        87 l~dy~a~~~~eLs~~~Gd~i~vl~~-~~~gWw~g~~~g~~G~~P~~  131 (193)
T 1ng2_A           87 IKAYTAVEGDEVSLLEGEAVEVIHK-LLDGWWVIRKDDVTGYFPSM  131 (193)
T ss_dssp             SSCBCCCSTTBCCBCTTCEEEEEEC-CTTSEEEEEETTEEEEEEGG
T ss_pred             ccccCCCCCCcccccCCCEEEEEEe-cCCCeEEEEECCCEEEEehH
Confidence            9999999999999999999999987 47788866666666666554



>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3npf_A Putative dipeptidyl-peptidase VI; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: CSA GOL; 1.72A {Bacteroides ovatus} PDB: 3pvq_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 225
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 3e-15
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 2e-14
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 4e-14
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-08
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 8e-14
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 2e-13
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 5e-13
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 6e-13
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 6e-13
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 6e-13
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 7e-13
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 7e-13
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 9e-13
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 7e-12
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 8e-12
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 1e-11
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 1e-11
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 2e-11
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 3e-11
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 3e-11
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 4e-11
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 5e-11
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 6e-11
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 7e-11
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 8e-11
d2v1ra167 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe 1e-10
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 2e-10
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 2e-10
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 2e-10
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 3e-10
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 6e-10
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 7e-10
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 9e-10
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 1e-09
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 2e-09
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 2e-09
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 2e-09
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 2e-09
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 6e-09
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 1e-08
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 2e-08
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 4e-07
d1wfwa_74 b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta 7e-07
d1phta_83 b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a 1e-05
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 2e-05
d1i1ja_106 b.34.2.1 (A:) Melanoma inhibitory activity protein 2e-05
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 8e-05
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 8e-05
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 6e-04
d1ug1a_92 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 0.001
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: Rac/CDC42 GEF 6
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 66.4 bits (162), Expect = 3e-15
 Identities = 21/41 (51%), Positives = 24/41 (58%)

Query: 79  ELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEIIP 119
           ELS  KGDII+V R  +  W+EG  N   G FP NYV  I 
Sbjct: 26  ELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIK 66


>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.76
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.75
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.74
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.71
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.7
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.68
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.67
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.66
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.66
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.66
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 99.66
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.66
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.65
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.65
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.63
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.63
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.63
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.63
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 99.62
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.62
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 99.61
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.61
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.61
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.6
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.6
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.59
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.58
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.58
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.58
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.58
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.57
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.57
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.56
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.55
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.54
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.54
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 99.53
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.53
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.52
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.52
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.51
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.51
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.49
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 99.48
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 99.36
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.32
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 99.17
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 98.32
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 98.25
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.2
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 98.17
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 98.17
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 98.16
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 98.14
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 98.13
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 98.11
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 98.11
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.09
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 98.07
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.06
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 98.05
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 98.03
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 97.98
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.97
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 97.93
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 97.93
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 97.92
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.92
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 97.92
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.91
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 97.91
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 97.87
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 97.85
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 97.84
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 97.81
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 97.81
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 97.81
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 97.77
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 97.75
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 97.72
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 97.71
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 97.7
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 97.69
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 97.66
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 97.61
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 97.61
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 97.52
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 97.51
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 97.51
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 97.48
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.45
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 97.43
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 97.42
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 97.14
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 95.8
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 95.7
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 94.73
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 94.48
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 93.26
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 92.55
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 92.35
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 92.07
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 92.05
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 91.31
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 90.93
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 90.79
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 90.25
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 90.02
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 89.84
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 88.97
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 87.31
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 86.6
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 86.13
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 85.95
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 85.44
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 85.31
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 85.02
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 84.93
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 81.19
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: Grb2-related adaptor protein 2 (Mona/Gads)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.76  E-value=1.1e-18  Score=111.66  Aligned_cols=55  Identities=29%  Similarity=0.643  Sum_probs=52.3

Q ss_pred             eEEEEeecccCCCCCCCCccccccCCCeEEEEEecCCCeEEEEECCeEEEeeCCcEEee
Q psy15850         60 KYLQELHDISSRRHTDNFTELSFKKGDIIFVRRQVDKNWYEGEHNAMIGLFPFNYVEII  118 (225)
Q Consensus        60 ~~~~al~d~~~~~~~~~~~eLs~~~Gdii~v~~~~~~~Ww~g~~~g~~G~~P~nyv~~~  118 (225)
                      ++|+|+|||.++    +.+||+|++||+|.|++..+++||.|+.+|+.|+||+|||+++
T Consensus         2 ~yarAlydy~~~----~~~eLs~~~Gd~i~v~~~~~~~Ww~g~~~g~~G~~P~~yve~i   56 (57)
T d1utia_           2 RWARALYDFEAL----EEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPM   56 (57)
T ss_dssp             CEEEESSCBCCC----STTBCCBCTTCEEEEEECCSSSEEEEEETTEEEEEEGGGEEEC
T ss_pred             EEEEECcCCCCC----CcCCcCCCCCCEEEEeEEcCCCEEEEEECCcEEEEEHHHEEEc
Confidence            579999999999    7889999999999999999999999999999999999999975



>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure