Psyllid ID: psy15889


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MGELMALWLRVRVWFKNRRAKWRKRERNAMNAAAAAAVDFKNGFSTQFNGLMQTFPDTDSLYTSAYSSYNNWASKVPSPLGTIGVNDLGFQS
cHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccc
MGELMALWLRVRVWFKNRRAKWRKRERNAMNAAAAAAVdfkngfstqfnglmqtfpdtdslyTSAYSSYnnwaskvpsplgtigvndlgfqs
mgelmalwLRVRVWFKNRRAKWRKRERNAMNAAAAAAVDFKNGFSTQFNGLMQTFPDTDSLYTSAYSSYNNWASKVPSPLGTIGVNDLGFQS
MGELMALWLRVRVWFKNRRAKWRKRERnamnaaaaaaVDFKNGFSTQFNGLMQTFPDTDSLYTSAYSSYNNWASKVPSPLGTIGVNDLGFQS
***LMALWLRVRVWFKNRRAKWRKRERNAMNAAAAAAVDFKNGFSTQFNGLMQTFPDTDSLYTSAYSSYNNWASKVPSPLGTIGV*******
*****ALWLRVRVWFKNRR************************************PDTDSLYTSAYSSYNNWASKV****************
MGELMALWLRVRVWFKNRRAKWRKRERNAMNAAAAAAVDFKNGFSTQFNGLMQTFPDTDSLYTSAYSSYNNWASKVPSPLGTIGVNDLGFQS
MGELMALWLRVRVWFKNRRAKWRKRERNAMNAAAAAAVDFKNGFSTQFNGLMQTFPDTDSLYTSAYSSYNNWASKVPS**************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGELMALWLRVRVWFKNRRAKWRKRERNAMNAAAAAAVDFKNGFSTQFNGLMQTFPDTDSLYTSAYSSYNNWASKVPSPLGTIGVNDLGFQS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query92 2.2.26 [Sep-21-2011]
Q9U637 331 Pituitary homeobox x OS=B N/A N/A 0.75 0.208 0.578 5e-19
O18400 509 Pituitary homeobox homolo yes N/A 0.858 0.155 0.604 3e-16
Q6QU75 293 Pituitary homeobox 3 OS=D yes N/A 0.673 0.211 0.564 5e-14
Q9PWR3 326 Pituitary homeobox 2 OS=X N/A N/A 0.673 0.190 0.564 7e-14
Q9W5Z2 314 Pituitary homeobox 2 OS=D no N/A 0.673 0.197 0.551 8e-14
Q99NA7 315 Pituitary homeobox 1 OS=R yes N/A 0.782 0.228 0.5 9e-14
O93385 333 Pituitary homeobox 2 OS=G yes N/A 0.673 0.186 0.551 1e-13
Q9R0W1 324 Pituitary homeobox 2 OS=R no N/A 0.673 0.191 0.551 1e-13
P56673 311 Pituitary homeobox 1 OS=G no N/A 0.760 0.225 0.5 1e-13
Q9W751 305 Pituitary homeobox 1 OS=X N/A N/A 0.760 0.229 0.511 2e-13
>sp|Q9U637|PITX_BRABE Pituitary homeobox x OS=Branchiostoma belcheri GN=Ptx PE=2 SV=1 Back     alignment and function desciption
 Score = 92.8 bits (229), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/83 (57%), Positives = 54/83 (65%), Gaps = 14/83 (16%)

Query: 3   ELMALWL-----RVRVWFKNRRAKWRKRERNAMNAAAAAAVDFKNGFSTQFNGLMQTFPD 57
           E +A W      RVRVWFKNRRAKWRKRERN +        +FKNGF   FNGLMQ F  
Sbjct: 136 EEIAAWTNLTEARVRVWFKNRRAKWRKRERNQLG-------EFKNGFGPHFNGLMQPF-- 186

Query: 58  TDSLYTSAYSSYNNWASKVPSPL 80
            D LY+    +YNNWA+KVPSPL
Sbjct: 187 DDGLYSGYSPAYNNWAAKVPSPL 209




Involved in left-right asymmetry in the developing embryo.
Branchiostoma belcheri (taxid: 7741)
>sp|O18400|PITX_DROME Pituitary homeobox homolog Ptx1 OS=Drosophila melanogaster GN=Ptx1 PE=2 SV=2 Back     alignment and function description
>sp|Q6QU75|PITX3_DANRE Pituitary homeobox 3 OS=Danio rerio GN=pitx3 PE=2 SV=1 Back     alignment and function description
>sp|Q9PWR3|PITX2_XENLA Pituitary homeobox 2 OS=Xenopus laevis GN=pitx2 PE=2 SV=1 Back     alignment and function description
>sp|Q9W5Z2|PITX2_DANRE Pituitary homeobox 2 OS=Danio rerio GN=pitx2 PE=2 SV=1 Back     alignment and function description
>sp|Q99NA7|PITX1_RAT Pituitary homeobox 1 OS=Rattus norvegicus GN=Pitx1 PE=2 SV=1 Back     alignment and function description
>sp|O93385|PITX2_CHICK Pituitary homeobox 2 OS=Gallus gallus GN=PITX2 PE=2 SV=1 Back     alignment and function description
>sp|Q9R0W1|PITX2_RAT Pituitary homeobox 2 OS=Rattus norvegicus GN=Pitx2 PE=2 SV=1 Back     alignment and function description
>sp|P56673|PITX1_CHICK Pituitary homeobox 1 OS=Gallus gallus GN=PITX1 PE=2 SV=1 Back     alignment and function description
>sp|Q9W751|PITX1_XENLA Pituitary homeobox 1 OS=Xenopus laevis GN=pitx1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
242017518 302 Pituitary homeobox, putative [Pediculus 0.858 0.261 0.8 6e-28
148298661 387 pituitary homeobox1 [Bombyx mori] gi|121 0.923 0.219 0.739 6e-28
357615722 377 pituitary homeobox1 [Danaus plexippus] 0.923 0.225 0.729 2e-27
193624928 429 PREDICTED: pituitary homeobox homolog Pt 0.945 0.202 0.75 3e-27
189234679 517 PREDICTED: similar to pituitary homeobox 0.836 0.148 0.729 2e-21
270002832 508 Ptx1 [Tribolium castaneum] 0.836 0.151 0.729 2e-21
170053388 644 homeobox protein [Culex quinquefasciatus 0.771 0.110 0.690 3e-20
170061749 624 homeobox protein [Culex quinquefasciatus 0.771 0.113 0.690 4e-20
347963348 493 AGAP000190-PA [Anopheles gambiae str. PE 0.771 0.144 0.666 7e-20
295798066 276 ptx protein [Tribolium castaneum] 0.836 0.278 0.658 9e-20
>gi|242017518|ref|XP_002429235.1| Pituitary homeobox, putative [Pediculus humanus corporis] gi|212514124|gb|EEB16497.1| Pituitary homeobox, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  127 bits (320), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 73/85 (85%), Gaps = 6/85 (7%)

Query: 3   ELMALWL-----RVRVWFKNRRAKWRKRERNAMNAAAAAAVDFKNGFSTQFNGLMQTFPD 57
           E +A+W      RVRVWFKNRRAKWRKRERNAMNAAAAAA DFKNGF TQFNGLMQ F D
Sbjct: 86  EEIAMWTNLTEARVRVWFKNRRAKWRKRERNAMNAAAAAAADFKNGFGTQFNGLMQPFTD 145

Query: 58  TDSLYTSAYSSYNNWASKVPSPLGT 82
           TDSLY S+YS+YNNWA+KVPSPLGT
Sbjct: 146 TDSLY-SSYSTYNNWAAKVPSPLGT 169




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|148298661|ref|NP_001091838.1| pituitary homeobox1 [Bombyx mori] gi|121582239|dbj|BAF44479.1| pituitary homeobox1 [Bombyx mori] Back     alignment and taxonomy information
>gi|357615722|gb|EHJ69804.1| pituitary homeobox1 [Danaus plexippus] Back     alignment and taxonomy information
>gi|193624928|ref|XP_001949221.1| PREDICTED: pituitary homeobox homolog Ptx1-like isoform 1 [Acyrthosiphon pisum] gi|328705300|ref|XP_003242759.1| PREDICTED: pituitary homeobox homolog Ptx1-like isoform 2 [Acyrthosiphon pisum] gi|328705302|ref|XP_003242760.1| PREDICTED: pituitary homeobox homolog Ptx1-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189234679|ref|XP_970167.2| PREDICTED: similar to pituitary homeobox1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270002832|gb|EEZ99279.1| Ptx1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170053388|ref|XP_001862650.1| homeobox protein [Culex quinquefasciatus] gi|167873959|gb|EDS37342.1| homeobox protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170061749|ref|XP_001866371.1| homeobox protein [Culex quinquefasciatus] gi|167879868|gb|EDS43251.1| homeobox protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347963348|ref|XP_310944.5| AGAP000190-PA [Anopheles gambiae str. PEST] gi|333467242|gb|EAA06466.6| AGAP000190-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|295798066|emb|CBL87030.1| ptx protein [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query92
FB|FBgn0020912 509 Ptx1 "Ptx1" [Drosophila melano 0.782 0.141 0.6 1.7e-16
ZFIN|ZDB-GENE-041229-4 293 pitx3 "paired-like homeodomain 0.728 0.228 0.541 9.1e-14
UNIPROTKB|F1MU46 314 PITX1 "Uncharacterized protein 0.771 0.226 0.488 2.9e-13
RGD|69253 315 Pitx1 "paired-like homeodomain 0.782 0.228 0.488 2.9e-13
UNIPROTKB|E1C143 292 PITX3 "Uncharacterized protein 0.728 0.229 0.529 3.4e-13
UNIPROTKB|E2RRG5 313 PITX1 "Uncharacterized protein 0.771 0.226 0.488 3.7e-13
UNIPROTKB|P78337 314 PITX1 "Pituitary homeobox 1" [ 0.771 0.226 0.488 3.7e-13
MGI|MGI:107374 315 Pitx1 "paired-like homeodomain 0.771 0.225 0.488 3.8e-13
UNIPROTKB|P56673 311 PITX1 "Pituitary homeobox 1" [ 0.760 0.225 0.5 6e-13
UNIPROTKB|D6RFI4290 PITX2 "Pituitary homeobox 2" [ 0.673 0.213 0.538 9.7e-13
FB|FBgn0020912 Ptx1 "Ptx1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 212 (79.7 bits), Expect = 1.7e-16, P = 1.7e-16
 Identities = 51/85 (60%), Positives = 56/85 (65%)

Query:     3 ELMALWL-----RVRVWFKNRRAKWRKRERXXXXXXXXXXVDFKNGFSTQFNGLMQTFPD 57
             E +A+W      RVRVWFKNRRAKWRKRER           DFK+GF TQF   MQ F D
Sbjct:   295 EEIAMWTNLTEARVRVWFKNRRAKWRKRERNAMNAAVAAA-DFKSGFGTQF---MQPFAD 350

Query:    58 TDSLYTSAYSSYNNWASKVPSPLGT 82
              DSLY+S Y  YNNW +KVPSPLGT
Sbjct:   351 -DSLYSS-YP-YNNW-TKVPSPLGT 371




GO:0005634 "nucleus" evidence=ISS;IDA
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0043565 "sequence-specific DNA binding" evidence=ISS
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005667 "transcription factor complex" evidence=ISS
ZFIN|ZDB-GENE-041229-4 pitx3 "paired-like homeodomain transcription factor 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MU46 PITX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|69253 Pitx1 "paired-like homeodomain 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C143 PITX3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRG5 PITX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P78337 PITX1 "Pituitary homeobox 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:107374 Pitx1 "paired-like homeodomain transcription factor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P56673 PITX1 "Pituitary homeobox 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|D6RFI4 PITX2 "Pituitary homeobox 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O18400PITX_DROMENo assigned EC number0.60410.85860.1552yesN/A
Q6QU75PITX3_DANRENo assigned EC number0.56410.67390.2116yesN/A
O93385PITX2_CHICKNo assigned EC number0.55120.67390.1861yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-05
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-04
smart0038957 smart00389, HOX, Homeodomain 8e-04
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
 Score = 38.6 bits (91), Expect = 1e-05
 Identities = 10/15 (66%), Positives = 15/15 (100%)

Query: 10 RVRVWFKNRRAKWRK 24
          +V+VWF+NRRAKW++
Sbjct: 43 QVKVWFQNRRAKWKR 57


Length = 57

>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 92
KOG0485|consensus268 99.39
KOG0489|consensus261 99.37
KOG0484|consensus125 99.34
KOG0488|consensus309 99.32
KOG0842|consensus307 99.29
KOG0486|consensus 351 99.24
KOG0850|consensus245 99.24
KOG0487|consensus308 99.21
KOG0848|consensus317 99.18
KOG0492|consensus246 99.15
KOG0843|consensus197 99.12
KOG2251|consensus228 98.95
KOG0847|consensus288 98.92
KOG0494|consensus332 98.91
KOG0844|consensus 408 98.88
KOG0491|consensus194 98.85
KOG0483|consensus198 98.83
KOG4577|consensus383 98.69
KOG0493|consensus342 98.45
KOG0490|consensus235 98.43
PF0004657 Homeobox: Homeobox domain not present here.; Inter 98.26
COG5576156 Homeodomain-containing transcription factor [Trans 98.19
cd0008659 homeodomain Homeodomain; DNA binding domains invol 97.76
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 97.67
KOG0849|consensus354 97.57
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 97.31
KOG3802|consensus398 96.95
KOG0775|consensus304 95.75
KOG0774|consensus334 94.61
KOG0490|consensus235 94.53
KOG1168|consensus385 94.16
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 93.14
>KOG0485|consensus Back     alignment and domain information
Probab=99.39  E-value=4.2e-13  Score=96.96  Aligned_cols=34  Identities=32%  Similarity=0.670  Sum_probs=29.0

Q ss_pred             Chhhhhhh-----cccccccccchhHHHHHHHHHHHHHH
Q psy15889          1 MGELMALW-----LRVRVWFKNRRAKWRKRERNAMNAAA   34 (92)
Q Consensus         1 ~R~eLA~~-----~qVkiWFQNRRaK~rr~~~~~~~~~~   34 (92)
                      +|..||++     +||||||||||.||||+.....+...
T Consensus       133 eRa~LA~sLqLTETQVKIWFQNRRnKwKRq~aad~ea~s  171 (268)
T KOG0485|consen  133 ERAGLAASLQLTETQVKIWFQNRRNKWKRQYAADLEAAS  171 (268)
T ss_pred             HHhHHHHhhhhhhhhhhhhhhhhhHHHHHHHhhhhhhhh
Confidence            57778888     99999999999999999988776543



>KOG0489|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 3e-04
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 3e-04
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure

Iteration: 1

Score = 40.4 bits (93), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 20/29 (68%), Positives = 22/29 (75%), Gaps = 5/29 (17%) Query: 3 ELMALWL-----RVRVWFKNRRAKWRKRE 26 E +A+W RVRVWFKNRRAKWRKRE Sbjct: 34 EEIAVWTNLTEARVRVWFKNRRAKWRKRE 62
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query92
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 6e-11
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 3e-10
3a02_A60 Homeobox protein aristaless; homeodomain, developm 6e-10
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 6e-10
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 2e-09
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 2e-09
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 3e-09
1uhs_A72 HOP, homeodomain only protein; structural genomics 5e-09
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-08
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-08
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-08
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 8e-08
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-07
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-07
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 3e-07
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-06
3d1n_I151 POU domain, class 6, transcription factor 1; prote 7e-06
1lfb_A99 Liver transcription factor (LFB1); transcription r 1e-05
2xsd_C164 POU domain, class 3, transcription factor 1; trans 2e-05
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 4e-05
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 9e-05
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-04
3a01_A93 Homeodomain-containing protein; homeodomain, prote 2e-04
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 7e-04
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
 Score = 52.3 bits (126), Expect = 6e-11
 Identities = 20/36 (55%), Positives = 23/36 (63%), Gaps = 5/36 (13%)

Query: 1  MGELMALWL-----RVRVWFKNRRAKWRKRERNAMN 31
            E +A+W      RVRVWFKNRRAKWRKRE   + 
Sbjct: 32 TREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVT 67


>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 99.41
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.11
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.1
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.1
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.08
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.05
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.05
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.04
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.03
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.03
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.03
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.02
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.01
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.0
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.0
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.0
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 98.99
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 98.98
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 98.97
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 98.97
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 98.97
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 98.96
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 98.96
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 98.96
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 98.96
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 98.95
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 98.95
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 98.94
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 98.94
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 98.93
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 98.93
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 98.93
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 98.93
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 98.91
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 98.91
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 98.9
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 98.89
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 98.88
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 98.88
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 98.88
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 98.88
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 98.87
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 98.87
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 98.85
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 98.84
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 98.83
2e19_A64 Transcription factor 8; homeobox domain, structura 98.83
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 98.83
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 98.82
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 98.81
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 98.8
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 98.78
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 98.78
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 98.75
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 98.74
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 98.74
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 98.73
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 98.72
2xsd_C164 POU domain, class 3, transcription factor 1; trans 98.71
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 98.69
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 98.61
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 98.5
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 98.44
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 98.21
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.07
1lfb_A99 Liver transcription factor (LFB1); transcription r 98.02
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
Probab=99.41  E-value=5.9e-14  Score=74.96  Aligned_cols=21  Identities=48%  Similarity=1.107  Sum_probs=18.8

Q ss_pred             cccccccccchhHHHHHHHHH
Q psy15889          9 LRVRVWFKNRRAKWRKRERNA   29 (92)
Q Consensus         9 ~qVkiWFQNRRaK~rr~~~~~   29 (92)
                      +||+||||||||||||.+...
T Consensus         1 rQVkIWFQNRRaK~Kk~~~~~   21 (37)
T 2nzz_A            1 RQIKIWFQNRRMKWKKRVFND   21 (37)
T ss_dssp             CCTTTTTTCSHHHHTSSHHHH
T ss_pred             CCceeccHHHHHHHHHHhHHH
Confidence            589999999999999988764



>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 92
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-06
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 1e-06
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-06
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 3e-06
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 4e-06
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 6e-06
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-05
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-05
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-05
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-05
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 3e-05
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-05
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 3e-05
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 3e-05
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 4e-05
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 5e-05
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-04
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-04
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 0.001
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 0.001
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 0.001
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 0.001
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 0.003
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 0.004
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 0.004
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 0.004
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Paired box protein pax6
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.2 bits (94), Expect = 1e-06
 Identities = 12/18 (66%), Positives = 16/18 (88%)

Query: 10 RVRVWFKNRRAKWRKRER 27
          R++VWF NRRAKWR+ E+
Sbjct: 44 RIQVWFSNRRAKWRREEK 61


>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query92
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.16
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.11
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.07
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.06
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.05
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.03
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.02
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.0
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 98.94
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 98.93
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 98.91
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 98.89
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 98.8
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 98.79
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 98.78
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 98.76
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 98.74
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 98.68
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 98.67
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 98.65
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 98.62
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 98.61
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 98.61
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 98.57
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 98.54
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 98.43
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 98.28
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 98.14
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 97.96
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Antennapedia Homeodomain
species: Drosophila melanogaster [TaxId: 7227]
Probab=99.16  E-value=5.1e-13  Score=75.78  Aligned_cols=25  Identities=36%  Similarity=0.777  Sum_probs=22.5

Q ss_pred             Chhhhhhh-----cccccccccchhHHHHH
Q psy15889          1 MGELMALW-----LRVRVWFKNRRAKWRKR   25 (92)
Q Consensus         1 ~R~eLA~~-----~qVkiWFQNRRaK~rr~   25 (92)
                      +|++||..     .+|+|||||||+|+||+
T Consensus        26 ~r~~LA~~l~l~~~~V~iWFQNrRak~kk~   55 (56)
T d9anta_          26 RRIEIAHALSLTERQIKIWFQNRRMKWKKE   55 (56)
T ss_dssp             HHHHHHHHHTCCHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHhCCChhHeeeccccchhhhhhc
Confidence            37889988     99999999999999984



>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure