Psyllid ID: psy15889
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 92 | ||||||
| 242017518 | 302 | Pituitary homeobox, putative [Pediculus | 0.858 | 0.261 | 0.8 | 6e-28 | |
| 148298661 | 387 | pituitary homeobox1 [Bombyx mori] gi|121 | 0.923 | 0.219 | 0.739 | 6e-28 | |
| 357615722 | 377 | pituitary homeobox1 [Danaus plexippus] | 0.923 | 0.225 | 0.729 | 2e-27 | |
| 193624928 | 429 | PREDICTED: pituitary homeobox homolog Pt | 0.945 | 0.202 | 0.75 | 3e-27 | |
| 189234679 | 517 | PREDICTED: similar to pituitary homeobox | 0.836 | 0.148 | 0.729 | 2e-21 | |
| 270002832 | 508 | Ptx1 [Tribolium castaneum] | 0.836 | 0.151 | 0.729 | 2e-21 | |
| 170053388 | 644 | homeobox protein [Culex quinquefasciatus | 0.771 | 0.110 | 0.690 | 3e-20 | |
| 170061749 | 624 | homeobox protein [Culex quinquefasciatus | 0.771 | 0.113 | 0.690 | 4e-20 | |
| 347963348 | 493 | AGAP000190-PA [Anopheles gambiae str. PE | 0.771 | 0.144 | 0.666 | 7e-20 | |
| 295798066 | 276 | ptx protein [Tribolium castaneum] | 0.836 | 0.278 | 0.658 | 9e-20 |
| >gi|242017518|ref|XP_002429235.1| Pituitary homeobox, putative [Pediculus humanus corporis] gi|212514124|gb|EEB16497.1| Pituitary homeobox, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 127 bits (320), Expect = 6e-28, Method: Compositional matrix adjust.
Identities = 68/85 (80%), Positives = 73/85 (85%), Gaps = 6/85 (7%)
Query: 3 ELMALWL-----RVRVWFKNRRAKWRKRERNAMNAAAAAAVDFKNGFSTQFNGLMQTFPD 57
E +A+W RVRVWFKNRRAKWRKRERNAMNAAAAAA DFKNGF TQFNGLMQ F D
Sbjct: 86 EEIAMWTNLTEARVRVWFKNRRAKWRKRERNAMNAAAAAAADFKNGFGTQFNGLMQPFTD 145
Query: 58 TDSLYTSAYSSYNNWASKVPSPLGT 82
TDSLY S+YS+YNNWA+KVPSPLGT
Sbjct: 146 TDSLY-SSYSTYNNWAAKVPSPLGT 169
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|148298661|ref|NP_001091838.1| pituitary homeobox1 [Bombyx mori] gi|121582239|dbj|BAF44479.1| pituitary homeobox1 [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|357615722|gb|EHJ69804.1| pituitary homeobox1 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|193624928|ref|XP_001949221.1| PREDICTED: pituitary homeobox homolog Ptx1-like isoform 1 [Acyrthosiphon pisum] gi|328705300|ref|XP_003242759.1| PREDICTED: pituitary homeobox homolog Ptx1-like isoform 2 [Acyrthosiphon pisum] gi|328705302|ref|XP_003242760.1| PREDICTED: pituitary homeobox homolog Ptx1-like isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|189234679|ref|XP_970167.2| PREDICTED: similar to pituitary homeobox1 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270002832|gb|EEZ99279.1| Ptx1 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|170053388|ref|XP_001862650.1| homeobox protein [Culex quinquefasciatus] gi|167873959|gb|EDS37342.1| homeobox protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|170061749|ref|XP_001866371.1| homeobox protein [Culex quinquefasciatus] gi|167879868|gb|EDS43251.1| homeobox protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|347963348|ref|XP_310944.5| AGAP000190-PA [Anopheles gambiae str. PEST] gi|333467242|gb|EAA06466.6| AGAP000190-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|295798066|emb|CBL87030.1| ptx protein [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 92 | ||||||
| FB|FBgn0020912 | 509 | Ptx1 "Ptx1" [Drosophila melano | 0.782 | 0.141 | 0.6 | 1.7e-16 | |
| ZFIN|ZDB-GENE-041229-4 | 293 | pitx3 "paired-like homeodomain | 0.728 | 0.228 | 0.541 | 9.1e-14 | |
| UNIPROTKB|F1MU46 | 314 | PITX1 "Uncharacterized protein | 0.771 | 0.226 | 0.488 | 2.9e-13 | |
| RGD|69253 | 315 | Pitx1 "paired-like homeodomain | 0.782 | 0.228 | 0.488 | 2.9e-13 | |
| UNIPROTKB|E1C143 | 292 | PITX3 "Uncharacterized protein | 0.728 | 0.229 | 0.529 | 3.4e-13 | |
| UNIPROTKB|E2RRG5 | 313 | PITX1 "Uncharacterized protein | 0.771 | 0.226 | 0.488 | 3.7e-13 | |
| UNIPROTKB|P78337 | 314 | PITX1 "Pituitary homeobox 1" [ | 0.771 | 0.226 | 0.488 | 3.7e-13 | |
| MGI|MGI:107374 | 315 | Pitx1 "paired-like homeodomain | 0.771 | 0.225 | 0.488 | 3.8e-13 | |
| UNIPROTKB|P56673 | 311 | PITX1 "Pituitary homeobox 1" [ | 0.760 | 0.225 | 0.5 | 6e-13 | |
| UNIPROTKB|D6RFI4 | 290 | PITX2 "Pituitary homeobox 2" [ | 0.673 | 0.213 | 0.538 | 9.7e-13 |
| FB|FBgn0020912 Ptx1 "Ptx1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 212 (79.7 bits), Expect = 1.7e-16, P = 1.7e-16
Identities = 51/85 (60%), Positives = 56/85 (65%)
Query: 3 ELMALWL-----RVRVWFKNRRAKWRKRERXXXXXXXXXXVDFKNGFSTQFNGLMQTFPD 57
E +A+W RVRVWFKNRRAKWRKRER DFK+GF TQF MQ F D
Sbjct: 295 EEIAMWTNLTEARVRVWFKNRRAKWRKRERNAMNAAVAAA-DFKSGFGTQF---MQPFAD 350
Query: 58 TDSLYTSAYSSYNNWASKVPSPLGT 82
DSLY+S Y YNNW +KVPSPLGT
Sbjct: 351 -DSLYSS-YP-YNNW-TKVPSPLGT 371
|
|
| ZFIN|ZDB-GENE-041229-4 pitx3 "paired-like homeodomain transcription factor 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MU46 PITX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|69253 Pitx1 "paired-like homeodomain 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C143 PITX3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RRG5 PITX1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P78337 PITX1 "Pituitary homeobox 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:107374 Pitx1 "paired-like homeodomain transcription factor 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P56673 PITX1 "Pituitary homeobox 1" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RFI4 PITX2 "Pituitary homeobox 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 92 | |||
| pfam00046 | 57 | pfam00046, Homeobox, Homeobox domain | 1e-05 | |
| cd00086 | 59 | cd00086, homeodomain, Homeodomain; DNA binding dom | 1e-04 | |
| smart00389 | 57 | smart00389, HOX, Homeodomain | 8e-04 |
| >gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain | Back alignment and domain information |
|---|
Score = 38.6 bits (91), Expect = 1e-05
Identities = 10/15 (66%), Positives = 15/15 (100%)
Query: 10 RVRVWFKNRRAKWRK 24
+V+VWF+NRRAKW++
Sbjct: 43 QVKVWFQNRRAKWKR 57
|
Length = 57 |
| >gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|197696 smart00389, HOX, Homeodomain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 92 | |||
| KOG0485|consensus | 268 | 99.39 | ||
| KOG0489|consensus | 261 | 99.37 | ||
| KOG0484|consensus | 125 | 99.34 | ||
| KOG0488|consensus | 309 | 99.32 | ||
| KOG0842|consensus | 307 | 99.29 | ||
| KOG0486|consensus | 351 | 99.24 | ||
| KOG0850|consensus | 245 | 99.24 | ||
| KOG0487|consensus | 308 | 99.21 | ||
| KOG0848|consensus | 317 | 99.18 | ||
| KOG0492|consensus | 246 | 99.15 | ||
| KOG0843|consensus | 197 | 99.12 | ||
| KOG2251|consensus | 228 | 98.95 | ||
| KOG0847|consensus | 288 | 98.92 | ||
| KOG0494|consensus | 332 | 98.91 | ||
| KOG0844|consensus | 408 | 98.88 | ||
| KOG0491|consensus | 194 | 98.85 | ||
| KOG0483|consensus | 198 | 98.83 | ||
| KOG4577|consensus | 383 | 98.69 | ||
| KOG0493|consensus | 342 | 98.45 | ||
| KOG0490|consensus | 235 | 98.43 | ||
| PF00046 | 57 | Homeobox: Homeobox domain not present here.; Inter | 98.26 | |
| COG5576 | 156 | Homeodomain-containing transcription factor [Trans | 98.19 | |
| cd00086 | 59 | homeodomain Homeodomain; DNA binding domains invol | 97.76 | |
| smart00389 | 56 | HOX Homeodomain. DNA-binding factors that are invo | 97.67 | |
| KOG0849|consensus | 354 | 97.57 | ||
| TIGR01565 | 58 | homeo_ZF_HD homeobox domain, ZF-HD class. This mod | 97.31 | |
| KOG3802|consensus | 398 | 96.95 | ||
| KOG0775|consensus | 304 | 95.75 | ||
| KOG0774|consensus | 334 | 94.61 | ||
| KOG0490|consensus | 235 | 94.53 | ||
| KOG1168|consensus | 385 | 94.16 | ||
| PF05920 | 40 | Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 | 93.14 |
| >KOG0485|consensus | Back alignment and domain information |
|---|
Probab=99.39 E-value=4.2e-13 Score=96.96 Aligned_cols=34 Identities=32% Similarity=0.670 Sum_probs=29.0
Q ss_pred Chhhhhhh-----cccccccccchhHHHHHHHHHHHHHH
Q psy15889 1 MGELMALW-----LRVRVWFKNRRAKWRKRERNAMNAAA 34 (92)
Q Consensus 1 ~R~eLA~~-----~qVkiWFQNRRaK~rr~~~~~~~~~~ 34 (92)
+|..||++ +||||||||||.||||+.....+...
T Consensus 133 eRa~LA~sLqLTETQVKIWFQNRRnKwKRq~aad~ea~s 171 (268)
T KOG0485|consen 133 ERAGLAASLQLTETQVKIWFQNRRNKWKRQYAADLEAAS 171 (268)
T ss_pred HHhHHHHhhhhhhhhhhhhhhhhhHHHHHHHhhhhhhhh
Confidence 57778888 99999999999999999988776543
|
|
| >KOG0489|consensus | Back alignment and domain information |
|---|
| >KOG0484|consensus | Back alignment and domain information |
|---|
| >KOG0488|consensus | Back alignment and domain information |
|---|
| >KOG0842|consensus | Back alignment and domain information |
|---|
| >KOG0486|consensus | Back alignment and domain information |
|---|
| >KOG0850|consensus | Back alignment and domain information |
|---|
| >KOG0487|consensus | Back alignment and domain information |
|---|
| >KOG0848|consensus | Back alignment and domain information |
|---|
| >KOG0492|consensus | Back alignment and domain information |
|---|
| >KOG0843|consensus | Back alignment and domain information |
|---|
| >KOG2251|consensus | Back alignment and domain information |
|---|
| >KOG0847|consensus | Back alignment and domain information |
|---|
| >KOG0494|consensus | Back alignment and domain information |
|---|
| >KOG0844|consensus | Back alignment and domain information |
|---|
| >KOG0491|consensus | Back alignment and domain information |
|---|
| >KOG0483|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG0493|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >PF00046 Homeobox: Homeobox domain not present here | Back alignment and domain information |
|---|
| >COG5576 Homeodomain-containing transcription factor [Transcription] | Back alignment and domain information |
|---|
| >cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner | Back alignment and domain information |
|---|
| >smart00389 HOX Homeodomain | Back alignment and domain information |
|---|
| >KOG0849|consensus | Back alignment and domain information |
|---|
| >TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class | Back alignment and domain information |
|---|
| >KOG3802|consensus | Back alignment and domain information |
|---|
| >KOG0775|consensus | Back alignment and domain information |
|---|
| >KOG0774|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG1168|consensus | Back alignment and domain information |
|---|
| >PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 92 | ||||
| 2l7m_P | 68 | Solution Structure Of The Pitx2 Homeodomain R24h Mu | 3e-04 | ||
| 2l7f_P | 68 | Solution Structure Of The Pitx2 Homeodomain Length | 3e-04 |
| >pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 | Back alignment and structure |
|
| >pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 92 | |||
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 6e-11 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 3e-10 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 6e-10 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 6e-10 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 2e-09 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 2e-09 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 3e-09 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 5e-09 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 1e-08 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 2e-08 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 3e-08 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 8e-08 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 1e-07 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 2e-07 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 3e-07 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 1e-06 | |
| 3d1n_I | 151 | POU domain, class 6, transcription factor 1; prote | 7e-06 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 1e-05 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 2e-05 | |
| 1au7_A | 146 | Protein PIT-1, GHF-1; complex (DNA-binding protein | 4e-05 | |
| 3l1p_A | 155 | POU domain, class 5, transcription factor 1; POU, | 9e-05 | |
| 1e3o_C | 160 | Octamer-binding transcription factor 1; transcript | 1e-04 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 2e-04 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 7e-04 |
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 | Back alignment and structure |
|---|
Score = 52.3 bits (126), Expect = 6e-11
Identities = 20/36 (55%), Positives = 23/36 (63%), Gaps = 5/36 (13%)
Query: 1 MGELMALWL-----RVRVWFKNRRAKWRKRERNAMN 31
E +A+W RVRVWFKNRRAKWRKRE +
Sbjct: 32 TREEIAVWTNLTEARVRVWFKNRRAKWRKREEFIVT 67
|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 | Back alignment and structure |
|---|
| >3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 | Back alignment and structure |
|---|
| >3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 | Back alignment and structure |
|---|
| >1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 92 | |||
| 2nzz_A | 37 | Penetratin conjugated GAS (374-394) peptide; confo | 99.41 | |
| 3a03_A | 56 | T-cell leukemia homeobox protein 2; homeodomain, d | 99.11 | |
| 2ecb_A | 89 | Zinc fingers and homeoboxes protein 1; homeobox do | 99.1 | |
| 1x2m_A | 64 | LAG1 longevity assurance homolog 6; homeobox domai | 99.1 | |
| 2cue_A | 80 | Paired box protein PAX6; homeobox domain, transcri | 99.08 | |
| 1puf_A | 77 | HOX-1.7, homeobox protein HOX-A9; homeodomian, pro | 99.05 | |
| 3a01_A | 93 | Homeodomain-containing protein; homeodomain, prote | 99.05 | |
| 3nau_A | 66 | Zinc fingers and homeoboxes protein 2; ZHX2, corep | 99.04 | |
| 1uhs_A | 72 | HOP, homeodomain only protein; structural genomics | 99.03 | |
| 3a02_A | 60 | Homeobox protein aristaless; homeodomain, developm | 99.03 | |
| 2hi3_A | 73 | Homeodomain-only protein; transcription; NMR {Mus | 99.03 | |
| 2cqx_A | 72 | LAG1 longevity assurance homolog 5; homeodomain, D | 99.02 | |
| 2h1k_A | 63 | IPF-1, pancreatic and duodenal homeobox 1, homeodo | 99.01 | |
| 1yz8_P | 68 | Pituitary homeobox 2; DNA binding protein, transcr | 99.0 | |
| 1nk2_P | 77 | Homeobox protein VND; homeodomain, DNA-binding pro | 99.0 | |
| 1ahd_P | 68 | Antennapedia protein mutant; DNA binding protein/D | 99.0 | |
| 2l9r_A | 69 | Homeobox protein NKX-3.1; structural genomics, nor | 98.99 | |
| 2ecc_A | 76 | Homeobox and leucine zipper protein homez; homeobo | 98.98 | |
| 1fjl_A | 81 | Paired protein; DNA-binding protein, paired BOX, t | 98.97 | |
| 2da4_A | 80 | Hypothetical protein DKFZP686K21156; homeobox doma | 98.97 | |
| 2dmq_A | 80 | LIM/homeobox protein LHX9; homeobox domain, three | 98.97 | |
| 2dms_A | 80 | Homeobox protein OTX2; homeobox domain, three heli | 98.96 | |
| 1zq3_P | 68 | PRD-4, homeotic bicoid protein; protein-DNA comple | 98.96 | |
| 1b8i_A | 81 | Ultrabithorax, protein (ultrabithorax homeotic pro | 98.96 | |
| 2dmp_A | 89 | Zinc fingers and homeoboxes protein 2; homeobox do | 98.96 | |
| 2da5_A | 75 | Zinc fingers and homeoboxes protein 3; homeobox do | 98.95 | |
| 2hdd_A | 61 | Protein (engrailed homeodomain Q50K); DNA binding, | 98.95 | |
| 1ig7_A | 58 | Homeotic protein MSX-1; helix-turn-helix, transcri | 98.94 | |
| 2dmt_A | 80 | Homeobox protein BARH-like 1; homeobox domain, thr | 98.94 | |
| 1ftt_A | 68 | TTF-1 HD, thyroid transcription factor 1 homeodoma | 98.93 | |
| 2e1o_A | 70 | Homeobox protein PRH; DNA binding protein, structu | 98.93 | |
| 2kt0_A | 84 | Nanog, homeobox protein nanog; homeodomain, struct | 98.93 | |
| 2dmu_A | 70 | Homeobox protein goosecoid; homeobox domain, three | 98.93 | |
| 2vi6_A | 62 | Homeobox protein nanog; homeodomain, DNA-binding, | 98.91 | |
| 1jgg_A | 60 | Segmentation protein EVEN-skipped; homeodomain, pr | 98.91 | |
| 2da3_A | 80 | Alpha-fetoprotein enhancer binding protein; homeob | 98.9 | |
| 2ly9_A | 74 | Zinc fingers and homeoboxes protein 1; structural | 98.89 | |
| 3nar_A | 96 | ZHX1, zinc fingers and homeoboxes protein 1; corep | 98.88 | |
| 2cra_A | 70 | Homeobox protein HOX-B13; DNA-binding, transcripti | 98.88 | |
| 2l7z_A | 73 | Homeobox protein HOX-A13; gene regulation; NMR {Ho | 98.88 | |
| 1b72_B | 87 | Protein (PBX1); homeodomain, DNA, complex, DNA-bin | 98.88 | |
| 2da1_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 98.87 | |
| 2m0c_A | 75 | Homeobox protein aristaless-like 4; structural gen | 98.87 | |
| 2da2_A | 70 | Alpha-fetoprotein enhancer binding protein; homeob | 98.85 | |
| 1k61_A | 60 | Mating-type protein alpha-2; protein-DNA complex, | 98.84 | |
| 3rkq_A | 58 | Homeobox protein NKX-2.5; helix-turn-helix, DNA bi | 98.83 | |
| 2e19_A | 64 | Transcription factor 8; homeobox domain, structura | 98.83 | |
| 2djn_A | 70 | Homeobox protein DLX-5; structural genomics, NPPSF | 98.83 | |
| 2dn0_A | 76 | Zinc fingers and homeoboxes protein 3; triple home | 98.82 | |
| 1x2n_A | 73 | Homeobox protein pknox1; homeobox domain, structur | 98.81 | |
| 2k40_A | 67 | Homeobox expressed in ES cells 1; thermostable hom | 98.8 | |
| 1puf_B | 73 | PRE-B-cell leukemia transcription factor-1; homeod | 98.78 | |
| 1bw5_A | 66 | ISL-1HD, insulin gene enhancer protein ISL-1; DNA- | 98.78 | |
| 1le8_B | 83 | Mating-type protein alpha-2; matalpha2, isothermal | 98.75 | |
| 2dmn_A | 83 | Homeobox protein TGIF2LX; TGFB-induced factor 2-li | 98.74 | |
| 1akh_A | 61 | Protein (mating-type protein A-1); complex (TWO DN | 98.74 | |
| 1du6_A | 64 | PBX1, homeobox protein PBX1; homeodomain, gene reg | 98.73 | |
| 2da6_A | 102 | Hepatocyte nuclear factor 1-beta; homeobox domain, | 98.72 | |
| 2xsd_C | 164 | POU domain, class 3, transcription factor 1; trans | 98.71 | |
| 3k2a_A | 67 | Homeobox protein MEIS2; homeobox domain, DNA-bindi | 98.69 | |
| 2cuf_A | 95 | FLJ21616 protein; homeobox domain, hepatocyte tran | 98.61 | |
| 2lk2_A | 89 | Homeobox protein TGIF1; NESG, structural genomics, | 98.5 | |
| 2d5v_A | 164 | Hepatocyte nuclear factor 6; transcription factor, | 98.44 | |
| 1wi3_A | 71 | DNA-binding protein SATB2; homeodomain, helix-turn | 98.21 | |
| 2da7_A | 71 | Zinc finger homeobox protein 1B; homeobox domain, | 98.07 | |
| 1lfb_A | 99 | Liver transcription factor (LFB1); transcription r | 98.02 |
| >2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A | Back alignment and structure |
|---|
Probab=99.41 E-value=5.9e-14 Score=74.96 Aligned_cols=21 Identities=48% Similarity=1.107 Sum_probs=18.8
Q ss_pred cccccccccchhHHHHHHHHH
Q psy15889 9 LRVRVWFKNRRAKWRKRERNA 29 (92)
Q Consensus 9 ~qVkiWFQNRRaK~rr~~~~~ 29 (92)
+||+||||||||||||.+...
T Consensus 1 rQVkIWFQNRRaK~Kk~~~~~ 21 (37)
T 2nzz_A 1 RQIKIWFQNRRMKWKKRVFND 21 (37)
T ss_dssp CCTTTTTTCSHHHHTSSHHHH
T ss_pred CCceeccHHHHHHHHHHhHHH
Confidence 589999999999999988764
|
| >3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A | Back alignment and structure |
|---|
| >3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A | Back alignment and structure |
|---|
| >2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} | Back alignment and structure |
|---|
| >1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P | Back alignment and structure |
|---|
| >1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A | Back alignment and structure |
|---|
| >1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A | Back alignment and structure |
|---|
| >2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B | Back alignment and structure |
|---|
| >2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* | Back alignment and structure |
|---|
| >2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A | Back alignment and structure |
|---|
| >1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} | Back alignment and structure |
|---|
| >1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* | Back alignment and structure |
|---|
| >1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P | Back alignment and structure |
|---|
| >2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* | Back alignment and structure |
|---|
| >1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* | Back alignment and structure |
|---|
| >2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* | Back alignment and structure |
|---|
| >1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A | Back alignment and structure |
|---|
| >1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 92 | ||||
| d2cuea1 | 68 | a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H | 1e-06 | |
| d1bw5a_ | 66 | a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { | 1e-06 | |
| d1b72a_ | 88 | a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo | 2e-06 | |
| d1pufa_ | 77 | a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m | 3e-06 | |
| d2cufa1 | 82 | a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM | 4e-06 | |
| d1zq3p1 | 67 | a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl | 6e-06 | |
| d1ftta_ | 68 | a.4.1.1 (A:) Thyroid transcription factor 1 homeod | 1e-05 | |
| d9anta_ | 56 | a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila | 2e-05 | |
| d1jgga_ | 57 | a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( | 2e-05 | |
| d2craa1 | 58 | a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( | 2e-05 | |
| d1fjla_ | 65 | a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila | 3e-05 | |
| d2e1oa1 | 57 | a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo | 3e-05 | |
| d1uhsa_ | 72 | a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse | 3e-05 | |
| d1yz8p1 | 60 | a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo | 3e-05 | |
| d1ig7a_ | 58 | a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu | 4e-05 | |
| d1x2ma1 | 52 | a.4.1.1 (A:8-59) Lag1 longevity assurance homolog | 5e-05 | |
| d1lfba_ | 78 | a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN | 1e-04 | |
| d1pufb_ | 73 | a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 | 2e-04 | |
| d1vnda_ | 77 | a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi | 0.001 | |
| d2cqxa1 | 59 | a.4.1.1 (A:8-66) LAG1 longevity assurance homolog | 0.001 | |
| d1le8a_ | 53 | a.4.1.1 (A:) Mating type protein A1 Homeodomain {B | 0.001 | |
| d1k61a_ | 60 | a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast | 0.001 | |
| d1au7a1 | 58 | a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra | 0.003 | |
| d1ocpa_ | 67 | a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus | 0.004 | |
| d1p7ia_ | 53 | a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel | 0.004 | |
| d2ecba1 | 76 | a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote | 0.004 |
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Paired box protein pax6 species: Human (Homo sapiens) [TaxId: 9606]
Score = 40.2 bits (94), Expect = 1e-06
Identities = 12/18 (66%), Positives = 16/18 (88%)
Query: 10 RVRVWFKNRRAKWRKRER 27
R++VWF NRRAKWR+ E+
Sbjct: 44 RIQVWFSNRRAKWRREEK 61
|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 | Back information, alignment and structure |
|---|
| >d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 | Back information, alignment and structure |
|---|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 92 | |||
| d9anta_ | 56 | Antennapedia Homeodomain {Drosophila melanogaster | 99.16 | |
| d1uhsa_ | 72 | Homeodomain-only protein, Hop {Mouse (Mus musculus | 99.11 | |
| d1zq3p1 | 67 | Homeotic bicoid protein {Fruit fly (Drosophila mel | 99.07 | |
| d1jgga_ | 57 | Even-skipped homeodomain {Fruit fly (Drosophila me | 99.06 | |
| d2craa1 | 58 | Homeobox protein hox-b13 {Human (Homo sapiens) [Ta | 99.05 | |
| d1pufa_ | 77 | Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax | 99.03 | |
| d2e1oa1 | 57 | Homeobox protein prh {Human (Homo sapiens) [TaxId: | 99.02 | |
| d1ig7a_ | 58 | Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 | 99.0 | |
| d1fjla_ | 65 | Paired protein {Fruit fly (Drosophila melanogaster | 98.94 | |
| d1p7ia_ | 53 | Engrailed Homeodomain {Drosophila melanogaster [Ta | 98.93 | |
| d1yz8p1 | 60 | Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: | 98.91 | |
| d2cuea1 | 68 | Paired box protein pax6 {Human (Homo sapiens) [Tax | 98.89 | |
| d1ftta_ | 68 | Thyroid transcription factor 1 homeodomain {Rat (R | 98.8 | |
| d1vnda_ | 77 | VND/NK-2 protein {Fruit fly (Drosophila melanogast | 98.79 | |
| d2cufa1 | 82 | Homeobox-containing protein 1, HMBOX1 (Flj21616) { | 98.78 | |
| d1x2ma1 | 52 | Lag1 longevity assurance homolog 6, LASS6 {Mouse ( | 98.76 | |
| d1e3oc1 | 57 | Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId | 98.74 | |
| d1le8a_ | 53 | Mating type protein A1 Homeodomain {Baker's yeast | 98.68 | |
| d1ocpa_ | 67 | Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId | 98.67 | |
| d1au7a1 | 58 | Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta | 98.65 | |
| d1wi3a_ | 71 | DNA-binding protein SATB2 {Human (Homo sapiens) [T | 98.62 | |
| d2ecba1 | 76 | Zinc fingers and homeoboxes protein 1, ZHX1 {Human | 98.61 | |
| d2cqxa1 | 59 | LAG1 longevity assurance homolog 5, LASS5 {Mouse ( | 98.61 | |
| d2ecca1 | 76 | Homeobox-leucine zipper protein Homez {Human (Homo | 98.57 | |
| d1bw5a_ | 66 | Insulin gene enhancer protein isl-1 {Rat (Rattus n | 98.54 | |
| d1pufb_ | 73 | pbx1 {Human (Homo sapiens) [TaxId: 9606]} | 98.47 | |
| d1k61a_ | 60 | mat alpha2 Homeodomain {Baker's yeast (Saccharomyc | 98.43 | |
| d1s7ea1 | 50 | Hepatocyte nuclear factor 6 {Mouse (Mus musculus) | 98.28 | |
| d1lfba_ | 78 | Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat | 98.14 | |
| d1x2na1 | 62 | Homeobox protein pknox1 {Human (Homo sapiens) [Tax | 97.96 |
| >d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Homeodomain domain: Antennapedia Homeodomain species: Drosophila melanogaster [TaxId: 7227]
Probab=99.16 E-value=5.1e-13 Score=75.78 Aligned_cols=25 Identities=36% Similarity=0.777 Sum_probs=22.5
Q ss_pred Chhhhhhh-----cccccccccchhHHHHH
Q psy15889 1 MGELMALW-----LRVRVWFKNRRAKWRKR 25 (92)
Q Consensus 1 ~R~eLA~~-----~qVkiWFQNRRaK~rr~ 25 (92)
+|++||.. .+|+|||||||+|+||+
T Consensus 26 ~r~~LA~~l~l~~~~V~iWFQNrRak~kk~ 55 (56)
T d9anta_ 26 RRIEIAHALSLTERQIKIWFQNRRMKWKKE 55 (56)
T ss_dssp HHHHHHHHHTCCHHHHHHHHHHHHHHHHHC
T ss_pred HHHHHHHHhCCChhHeeeccccchhhhhhc
Confidence 37889988 99999999999999984
|
| >d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|