Psyllid ID: psy1588

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------
MRFVEGHSSNNRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNPVLEALSAKNEP
ccEEcccEEEcccEEEccccccccccccccccccccccccccccccccEEEEEccHHHHHHHcccccc
cccccccEEEccEEEEEEEcccccccccccccccccccccccHcccccHHHHccccccHHHHHccccc
mrfveghssnnrlishtpvdtlpfggvgmsgmgayhgkysfdtfthrksclvkdynpVLEALSAKNEP
mrfveghssnnrlishtpvdtlpfGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNPVLealsaknep
MRFVEGHSSNNRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNPVLEALSAKNEP
***************HTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNPVLE********
*RFVEGHSSNNRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNPVLEALSAKNEP
*********NNRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNPVLEALSAKNEP
****EGHSSNNRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNPVLEALSAKNEP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRFVEGHSSNNRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNPVLEALSAKNEP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query68 2.2.26 [Sep-21-2011]
P30839484 Fatty aldehyde dehydrogen yes N/A 0.705 0.099 0.645 1e-13
P47740484 Fatty aldehyde dehydrogen yes N/A 0.705 0.099 0.645 1e-13
P11883453 Aldehyde dehydrogenase, d no N/A 0.705 0.105 0.687 2e-13
P47739453 Aldehyde dehydrogenase, d no N/A 0.705 0.105 0.666 6e-13
Q60HH8485 Fatty aldehyde dehydrogen N/A N/A 0.705 0.098 0.583 4e-12
P51648485 Fatty aldehyde dehydrogen yes N/A 0.705 0.098 0.583 4e-12
P30838453 Aldehyde dehydrogenase, d no N/A 0.882 0.132 0.507 5e-12
Q5RF60485 Fatty aldehyde dehydrogen no N/A 0.705 0.098 0.583 5e-12
P43353468 Aldehyde dehydrogenase fa no N/A 0.75 0.108 0.547 1e-11
A3RF36453 Aldehyde dehydrogenase, d no N/A 0.882 0.132 0.507 2e-11
>sp|P30839|AL3A2_RAT Fatty aldehyde dehydrogenase OS=Rattus norvegicus GN=Aldh3a2 PE=1 SV=1 Back     alignment and function desciption
 Score = 75.1 bits (183), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 31/48 (64%), Positives = 39/48 (81%)

Query: 6   GHSSNNRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVK 53
           G  + N +I H  V++LPFGGVG SGMGAYHGKYSFDTF+H++ CL+K
Sbjct: 381 GGVTGNDVIMHFTVNSLPFGGVGASGMGAYHGKYSFDTFSHQRPCLLK 428

Rattus norvegicus (taxid: 10116)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 3
>sp|P47740|AL3A2_MOUSE Fatty aldehyde dehydrogenase OS=Mus musculus GN=Aldh3a2 PE=2 SV=2 Back     alignment and function description
>sp|P11883|AL3A1_RAT Aldehyde dehydrogenase, dimeric NADP-preferring OS=Rattus norvegicus GN=Aldh3a1 PE=1 SV=3 Back     alignment and function description
>sp|P47739|AL3A1_MOUSE Aldehyde dehydrogenase, dimeric NADP-preferring OS=Mus musculus GN=Aldh3a1 PE=2 SV=2 Back     alignment and function description
>sp|Q60HH8|AL3A2_MACFA Fatty aldehyde dehydrogenase OS=Macaca fascicularis GN=ALDH3A2 PE=2 SV=1 Back     alignment and function description
>sp|P51648|AL3A2_HUMAN Fatty aldehyde dehydrogenase OS=Homo sapiens GN=ALDH3A2 PE=1 SV=1 Back     alignment and function description
>sp|P30838|AL3A1_HUMAN Aldehyde dehydrogenase, dimeric NADP-preferring OS=Homo sapiens GN=ALDH3A1 PE=1 SV=3 Back     alignment and function description
>sp|Q5RF60|AL3A2_PONAB Fatty aldehyde dehydrogenase OS=Pongo abelii GN=ALDH3A2 PE=2 SV=1 Back     alignment and function description
>sp|P43353|AL3B1_HUMAN Aldehyde dehydrogenase family 3 member B1 OS=Homo sapiens GN=ALDH3B1 PE=2 SV=1 Back     alignment and function description
>sp|A3RF36|AL3A1_CANFA Aldehyde dehydrogenase, dimeric NADP-preferring OS=Canis familiaris GN=ALDH3A1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
383848954 542 PREDICTED: aldehyde dehydrogenase family 0.970 0.121 0.571 5e-17
193683363 502 PREDICTED: aldehyde dehydrogenase, dimer 0.852 0.115 0.655 1e-16
158292606 494 AGAP005124-PA [Anopheles gambiae str. PE 0.852 0.117 0.637 2e-16
328722598 587 PREDICTED: aldehyde dehydrogenase, dimer 0.852 0.098 0.655 3e-16
158292608 494 AGAP005124-PB [Anopheles gambiae str. PE 0.852 0.117 0.637 4e-16
328722601 503 PREDICTED: aldehyde dehydrogenase, dimer 0.852 0.115 0.637 4e-16
442622753 501 aldehyde dehydrogenase type III, isoform 0.926 0.125 0.634 6e-16
442622748 498 aldehyde dehydrogenase type III, isoform 0.926 0.126 0.634 6e-16
25012904 497 RH21091p [Drosophila melanogaster] 0.926 0.126 0.634 6e-16
45552499 497 aldehyde dehydrogenase type III, isoform 0.926 0.126 0.634 7e-16
>gi|383848954|ref|XP_003700112.1| PREDICTED: aldehyde dehydrogenase family 3 member B1-like [Megachile rotundata] Back     alignment and taxonomy information
 Score = 91.7 bits (226), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 4/70 (5%)

Query: 3   FVEGHSSN----NRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNPV 58
           F+E  SS     N +I H  VDT+PFGGVG SGMGAYHGKY+FDTF H+K CL+KDYN +
Sbjct: 419 FLENTSSGGVCVNDVIMHAQVDTIPFGGVGYSGMGAYHGKYTFDTFVHKKGCLIKDYNRL 478

Query: 59  LEALSAKNEP 68
           +E++++   P
Sbjct: 479 IESIASCRYP 488

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193683363|ref|XP_001950992.1| PREDICTED: aldehyde dehydrogenase, dimeric NADP-preferring-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|158292606|ref|XP_001688503.1| AGAP005124-PA [Anopheles gambiae str. PEST] gi|157017070|gb|EDO64086.1| AGAP005124-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|328722598|ref|XP_003247611.1| PREDICTED: aldehyde dehydrogenase, dimeric NADP-preferring-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|158292608|ref|XP_001688504.1| AGAP005124-PB [Anopheles gambiae str. PEST] gi|157017071|gb|EDO64087.1| AGAP005124-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|328722601|ref|XP_003247612.1| PREDICTED: aldehyde dehydrogenase, dimeric NADP-preferring-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|442622753|ref|NP_001260775.1| aldehyde dehydrogenase type III, isoform U [Drosophila melanogaster] gi|440214168|gb|AGB93308.1| aldehyde dehydrogenase type III, isoform U [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442622748|ref|NP_001260773.1| aldehyde dehydrogenase type III, isoform S [Drosophila melanogaster] gi|440214166|gb|AGB93306.1| aldehyde dehydrogenase type III, isoform S [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|25012904|gb|AAN71539.1| RH21091p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|45552499|ref|NP_995772.1| aldehyde dehydrogenase type III, isoform E [Drosophila melanogaster] gi|45445663|gb|AAM68898.2| aldehyde dehydrogenase type III, isoform E [Drosophila melanogaster] gi|201065961|gb|ACH92390.1| FI07249p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
FB|FBgn0010548563 Aldh-III "Aldehyde dehydrogena 0.926 0.111 0.634 2.1e-16
MGI|MGI:1353452484 Aldh3a2 "aldehyde dehydrogenas 0.705 0.099 0.645 1.6e-12
RGD|61866484 Aldh3a2 "aldehyde dehydrogenas 0.705 0.099 0.645 1.6e-12
UNIPROTKB|P30839484 Aldh3a2 "Fatty aldehyde dehydr 0.705 0.099 0.645 1.6e-12
UNIPROTKB|D4A137507 Aldh3a2 "Aldehyde dehydrogenas 0.705 0.094 0.645 1.7e-12
RGD|2088453 Aldh3a1 "aldehyde dehydrogenas 0.705 0.105 0.687 2.2e-12
MGI|MGI:1353451453 Aldh3a1 "aldehyde dehydrogenas 0.911 0.136 0.571 2.9e-12
UNIPROTKB|F1NH33490 ALDH3A2 "Aldehyde dehydrogenas 0.720 0.1 0.632 3.4e-12
UNIPROTKB|A6QQT4485 ALDH3A2 "Aldehyde dehydrogenas 0.764 0.107 0.571 5.4e-12
UNIPROTKB|F1SDC4488 ALDH3A1 "Aldehyde dehydrogenas 0.882 0.122 0.553 7e-12
FB|FBgn0010548 Aldh-III "Aldehyde dehydrogenase type III" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 212 (79.7 bits), Expect = 2.1e-16, P = 2.1e-16
 Identities = 40/63 (63%), Positives = 46/63 (73%)

Query:     6 GHSSNNRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNPVLEALSAK 65
             G  S+N  I H  VD LPFGGVGMSGMG YHGKY F+TFTH+KSCL KD +P+ E LS+ 
Sbjct:   449 GGFSSNETIMHCGVDVLPFGGVGMSGMGRYHGKYGFETFTHKKSCLGKDLSPLGEKLSSA 508

Query:    66 NEP 68
               P
Sbjct:   509 RYP 511
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006081 "cellular aldehyde metabolic process" evidence=IEA
GO:0004030 "aldehyde dehydrogenase [NAD(P)+
GO:0005811 "lipid particle" evidence=IDA
MGI|MGI:1353452 Aldh3a2 "aldehyde dehydrogenase family 3, subfamily A2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61866 Aldh3a2 "aldehyde dehydrogenase 3 family, member A2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P30839 Aldh3a2 "Fatty aldehyde dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A137 Aldh3a2 "Aldehyde dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2088 Aldh3a1 "aldehyde dehydrogenase 3 family, member A1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1353451 Aldh3a1 "aldehyde dehydrogenase family 3, subfamily A1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NH33 ALDH3A2 "Aldehyde dehydrogenase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6QQT4 ALDH3A2 "Aldehyde dehydrogenase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SDC4 ALDH3A1 "Aldehyde dehydrogenase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P51648AL3A2_HUMAN1, ., 2, ., 1, ., 30.58330.70580.0989yesN/A
P30839AL3A2_RAT1, ., 2, ., 1, ., 30.64580.70580.0991yesN/A
P39616ALDH2_BACSU1, ., 2, ., 1, ., 30.56520.66170.0986yesN/A
P47740AL3A2_MOUSE1, ., 2, ., 1, ., 30.64580.70580.0991yesN/A
Q70DU8AL3H1_ARATH1, ., 2, ., 1, ., 30.60460.63230.0888yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
cd07132443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 1e-26
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 4e-21
cd07136449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 1e-18
cd07137432 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase 3e-18
cd07135436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 7e-18
PTZ00381493 PTZ00381, PTZ00381, aldehyde dehydrogenase family 5e-17
cd07133434 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd 2e-15
PLN02203484 PLN02203, PLN02203, aldehyde dehydrogenase 2e-15
PLN02174484 PLN02174, PLN02174, aldehyde dehydrogenase family 3e-14
cd07134433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 3e-11
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 3e-11
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 9e-11
COG1012472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 1e-10
pfam00171459 pfam00171, Aldedh, Aldehyde dehydrogenase family 5e-06
cd07104431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 4e-05
cd07150451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 9e-05
cd07093455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 1e-04
cd07118454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 3e-04
TIGR02299488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 4e-04
cd07115453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 5e-04
cd07144484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 6e-04
cd07099453 cd07099, ALDH_DDALDH, Methylomonas sp 0.001
PLN02466538 PLN02466, PLN02466, aldehyde dehydrogenase family 0.003
cd07142476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 0.004
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information 
 Score = 99.6 bits (249), Expect = 1e-26
 Identities = 37/67 (55%), Positives = 47/67 (70%), Gaps = 6/67 (8%)

Query: 2   RFVEGHSSN----NRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNP 57
           + +   SS     N  I H  +D+LPFGGVG SGMGAYHGKYSFDTF+H++SCLVK  N 
Sbjct: 372 KILSNTSSGGVCVNDTIMHYTLDSLPFGGVGNSGMGAYHGKYSFDTFSHKRSCLVKSLN- 430

Query: 58  VLEALSA 64
            +E L++
Sbjct: 431 -MEKLNS 436

NAD(P)+-dependent, aldehyde dehydrogenase, family 3 members A1 and B1 (ALDH3A1, ALDH3B1, EC=1.2.1.5) and fatty aldehyde dehydrogenase, family 3 member A2 (ALDH3A2, EC=1.2.1.3), and similar sequences are included in this CD. Human ALDH3A1 is a homodimer with a critical role in cellular defense against oxidative stress; it catalyzes the oxidation of various cellular membrane lipid-derived aldehydes. Corneal crystalline ALDH3A1 protects the cornea and underlying lens against UV-induced oxidative stress. Human ALDH3A2, a microsomal homodimer, catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acids. Human ALDH3B1 is highly expressed in the kidney and liver and catalyzes the oxidation of various medium- and long-chain saturated and unsaturated aliphatic aldehydes. Length = 443
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|143455 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>gnl|CDD|240392 PTZ00381, PTZ00381, aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|165847 PLN02203, PLN02203, aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|177831 PLN02174, PLN02174, aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 68
PTZ00381493 aldehyde dehydrogenase family protein; Provisional 99.53
PLN02174484 aldehyde dehydrogenase family 3 member H1 99.51
PLN02203484 aldehyde dehydrogenase 99.44
KOG2450|consensus501 99.42
cd07132443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 99.38
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 99.38
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 99.37
cd07136449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 99.36
PRK11241482 gabD succinate-semialdehyde dehydrogenase I; Provi 99.36
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 99.36
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 99.35
cd07140486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 99.35
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 99.35
PLN02766501 coniferyl-aldehyde dehydrogenase 99.34
PLN02467503 betaine aldehyde dehydrogenase 99.34
PRK10090409 aldehyde dehydrogenase A; Provisional 99.34
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 99.34
PRK13252488 betaine aldehyde dehydrogenase; Provisional 99.33
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 99.32
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 99.32
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 99.31
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 99.31
PLN02466538 aldehyde dehydrogenase family 2 member 99.31
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 99.3
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 99.3
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 99.3
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 99.3
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 99.3
PLN02278498 succinic semialdehyde dehydrogenase 99.29
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 99.29
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 99.29
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 99.29
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 99.29
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 99.29
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 99.29
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 99.28
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 99.27
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 99.27
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 99.27
KOG2456|consensus477 99.27
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 99.27
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 99.27
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 99.27
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 99.26
PLN02315508 aldehyde dehydrogenase family 7 member 99.26
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 99.26
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 99.26
cd07119482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 99.26
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 99.25
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 99.25
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 99.25
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 99.25
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 99.24
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 99.24
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 99.24
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 99.24
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 99.24
PLN00412496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 99.23
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 99.23
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 99.23
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 99.23
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 99.23
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 99.22
PLN02419604 methylmalonate-semialdehyde dehydrogenase [acylati 99.22
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 99.22
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 99.22
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 99.22
TIGR01236533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 99.22
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 99.21
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 99.21
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 99.21
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 99.21
PRK09407524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 99.21
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 99.2
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 99.2
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 99.2
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 99.2
TIGR01780448 SSADH succinate-semialdehyde dehydrogenase. SSADH 99.19
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 99.19
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 99.19
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 99.19
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 99.19
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 99.18
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 99.18
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 99.18
KOG2451|consensus503 99.17
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 99.17
cd07125518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 99.16
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 99.16
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 99.15
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 99.15
cd07123522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 99.14
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 99.13
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 99.12
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 99.12
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 99.11
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 99.1
TIGR03240484 arg_catab_astD succinylglutamic semialdehyde dehyd 99.02
PRK09457487 astD succinylglutamic semialdehyde dehydrogenase; 99.02
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 99.02
KOG2452|consensus881 98.98
PRK119041038 bifunctional proline dehydrogenase/pyrroline-5-car 98.94
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 98.93
cd07128513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 98.93
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 98.92
PRK11903521 aldehyde dehydrogenase; Provisional 98.9
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 98.89
TIGR02278 663 PaaN-DH phenylacetic acid degradation protein paaN 98.88
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 98.87
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 98.86
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 98.84
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 98.84
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 98.76
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 98.61
KOG2454|consensus583 98.6
cd07129454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 98.59
cd07084442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 98.45
PRK11809 1318 putA trifunctional transcriptional regulator/proli 98.35
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 98.14
cd07126489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 97.97
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 97.8
KOG2453|consensus507 97.45
PRK15398465 aldehyde dehydrogenase EutE; Provisional 97.25
COG4230 769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 96.63
KOG2455|consensus561 95.36
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 94.63
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 88.58
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 88.43
cd07081439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 88.34
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information 
Probab=99.53  E-value=1e-14  Score=101.80  Aligned_cols=65  Identities=45%  Similarity=0.689  Sum_probs=53.3

Q ss_pred             CeeeeEEEEcCCCCCCCCCCCccccCCCCCCCCcchHHHHHhhhhccEEEEeccchhhhhhcccCCC
Q psy1588           2 RFVEGHSSNNRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNPVLEALSAKNEP   68 (68)
Q Consensus         2 ~l~aG~V~IN~~~~~~~~~~~PfGG~k~SG~G~~~g~~~l~~~t~~k~v~~~~~~~~~~~~~~~~~~   68 (68)
                      ++++|.|+||+...+...+.+||||+|+||+|+++|.+++++|++.|+++.+..+.++.  ...+||
T Consensus       387 ~~~sG~v~IN~~~~~~~~~~~PFGG~g~SG~G~~~G~~g~~~fs~~k~v~~~~~~~~~~--~~~~~p  451 (493)
T PTZ00381        387 NTSSGAVVINDCVFHLLNPNLPFGGVGNSGMGAYHGKYGFDTFSHPKPVLNKSTGNSFD--LSLRYP  451 (493)
T ss_pred             hCCcceEEECCccccccCCCCCCCCcCcccccccchHHHHHhccceeEEEEccccccCc--ccccCC
Confidence            68999999998765434568999999999999999999999999999999886433222  566776

>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>KOG2450|consensus Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>KOG2456|consensus Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>KOG2451|consensus Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>KOG2452|consensus Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>KOG2454|consensus Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>KOG2453|consensus Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>KOG2455|consensus Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
1ad3_A452 Class 3 Aldehyde Dehydrogenase Complex With Nicotin 2e-14
3sza_A469 Crystal Structure Of Human Aldh3a1 - Apo Form Lengt 5e-13
3lv1_A457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 4e-08
3lns_A457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 4e-08
>pdb|1AD3|A Chain A, Class 3 Aldehyde Dehydrogenase Complex With Nicotinamide- Adenine-Dinucleotide Length = 452 Back     alignment and structure 
Iteration: 1

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 33/48 (68%), Positives = 38/48 (79%)
Query: 6   GHSSNNRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVK 53
           G  + N +I H  V TLPFGGVG SGMGAYHGK SF+TF+HR+SCLVK
Sbjct: 383 GGVTANDVIVHITVPTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVK 430
>pdb|3SZA|A Chain A, Crystal Structure Of Human Aldh3a1 - Apo Form Length = 469 Back     alignment and structure
>pdb|3LV1|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ Length = 457 Back     alignment and structure
>pdb|3LNS|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ And Benzoate Adduct Length = 457 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 3e-22
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 6e-22
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 6e-06
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 7e-06
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 3e-05
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 3e-05
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 4e-05
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 4e-05
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 6e-05
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 6e-05
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 6e-05
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 7e-05
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 7e-05
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 1e-04
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 1e-04
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 2e-04
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 2e-04
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 2e-04
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 2e-04
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 3e-04
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 4e-04
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 5e-04
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 5e-04
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
 Score = 86.5 bits (215), Expect = 3e-22
 Identities = 28/43 (65%), Positives = 36/43 (83%)

Query: 11  NRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVK 53
           N +I H  + +LPFGGVG SGMG+YHGK SF+TF+HR+SCLV+
Sbjct: 405 NDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFSHRRSCLVR 447
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query68
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 99.59
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 99.47
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 99.39
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 99.37
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 99.35
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 99.34
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 99.33
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 99.33
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 99.32
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 99.31
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 99.31
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 99.3
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 99.3
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 99.3
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 99.3
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 99.29
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 99.29
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 99.29
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 99.29
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 99.28
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 99.28
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 99.28
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 99.27
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 99.27
4h7n_A474 Aldehyde dehydrogenase; structural genomics, PSI-b 99.26
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 99.25
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 99.25
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 99.24
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 99.23
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 99.22
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 99.21
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 99.2
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 99.19
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 99.19
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 99.19
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 99.18
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 99.17
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 99.17
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 99.15
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 99.13
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 99.07
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 99.04
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 98.97
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 98.89
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 98.86
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 98.85
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 98.81
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 98.65
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 98.39
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 98.36
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 97.88
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
Probab=99.59  E-value=4.9e-16  Score=106.60  Aligned_cols=65  Identities=46%  Similarity=0.807  Sum_probs=55.2

Q ss_pred             CeeeeEEEEcCCCCCCCCCCCccccCCCCCCCCcchHHHHHhhhhccEEEEeccchhhhhhcccCCC
Q psy1588           2 RFVEGHSSNNRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNPVLEALSAKNEP   68 (68)
Q Consensus         2 ~l~aG~V~IN~~~~~~~~~~~PfGG~k~SG~G~~~g~~~l~~~t~~k~v~~~~~~~~~~~~~~~~~~   68 (68)
                      +|++|+|+||+...+...+.+||||+|+||+|+++|.+++++|++.|+|++++.+.  +.+.+++||
T Consensus       396 ~l~~G~V~vN~~~~~~~~~~~PfGG~k~SG~Gr~~G~~g~~~ft~~K~v~~~~~~~--~~~~~~~yp  460 (469)
T 3sza_A          396 ETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFSHRRSCLVRPLMN--DEGLKVRYP  460 (469)
T ss_dssp             HCCCSEEEESCSSGGGSCTTSCBCCCGGGEECCBSTHHHHHHTEEEEEEEECCSSC--CGGGGGGSS
T ss_pred             hCCcceEEEeCCCCCCCCCCCCcCCccccccCccchHHHHHHhhCeeEEEECCccc--ccccccccC
Confidence            68999999999753324578999999999999999999999999999999987553  555678887
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 68
d1ad3a_446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 9e-16
d1bxsa_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 3e-14
d1o04a_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 9e-14
d1wnda_474 c.82.1.1 (A:) Putative betaine aldehyde dehydrogen 2e-13
d1a4sa_503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 3e-13
d1euha_474 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 5e-13
d1ky8a_499 c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 5e-13
d1uzba_516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 3e-11
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 5e-05
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 67.3 bits (163), Expect = 9e-16
 Identities = 32/43 (74%), Positives = 36/43 (83%)

Query: 11  NRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVK 53
           N +I H  V TLPFGGVG SGMGAYHGK SF+TF+HR+SCLVK
Sbjct: 387 NDVIVHITVPTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVK 429
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query68
d1ad3a_446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 99.6
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 99.47
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 99.4
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 99.36
d1ky8a_499 Non-phosphorylating glyceraldehyde-3-phosphate deh 99.33
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 99.31
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 99.28
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 99.27
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 98.3
d1ez0a_504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 97.56
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 91.82
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.60  E-value=1.3e-16  Score=106.80  Aligned_cols=66  Identities=53%  Similarity=0.849  Sum_probs=56.6

Q ss_pred             CCeeeeEEEEcCCCCCCCCCCCccccCCCCCCCCcchHHHHHhhhhccEEEEeccchhhhhhcccCCC
Q psy1588           1 MRFVEGHSSNNRLISHTPVDTLPFGGVGMSGMGAYHGKYSFDTFTHRKSCLVKDYNPVLEALSAKNEP   68 (68)
Q Consensus         1 ~~l~aG~V~IN~~~~~~~~~~~PfGG~k~SG~G~~~g~~~l~~~t~~k~v~~~~~~~~~~~~~~~~~~   68 (68)
                      .+|++|.|+||+...+...+.+||||+|+||+|+++|.+++++||+.|++++++.+.  +.+.++|||
T Consensus       377 ~~l~~G~v~iN~~~~~~~~~~~PfGG~k~SG~G~~~g~~~l~~ft~~k~v~~~~~~~--~~~~~~~~p  442 (446)
T d1ad3a_         377 AETSSGGVTANDVIVHITVPTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVKSLLN--EEAHKARYP  442 (446)
T ss_dssp             TTCCCSEEEESSSSGGGGCTTSCCCCCGGGEECCCSTHHHHHHTEEEEEEEECCCCC--CCTTGGGSS
T ss_pred             HhCCEeEEEEeCCccCCCCCCCCccccccceeccchHHHHHHHHhceeEEEEccCCC--CccccccCC
Confidence            468999999998754334578999999999999999999999999999999987653  667889987
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure