Psyllid ID: psy15895


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
LLVQPNFNHHYSTQAEAASNDNAEKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFPTDHDHGKLEIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARSGS
ccccccccccccHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEcccccEEEEEEccccccHHHHHHcccccccccc
cccccccccccHHHcHHHHccccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHccccccccccEEEEEEccccEEEEEEccccccHHHHHHHccccccHHH
llvqpnfnhhystqaeaasndnaekHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQlsevmpfptdhdhgkleiristdkqnriltiqdsgigmtKEELKSNLGTIARSGS
llvqpnfnhhystqaeaasndnAEKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVmpfptdhdhgkleiristdkqnrILTIqdsgigmtkeelksnlgtiarsgs
LLVQPNFNHHYSTQAEAASNDNAEKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFPTDHDHGKLEIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARSGS
*******************************TRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPF********LEIRI******RILTI************************
*****************************AETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFPTDHDHGKLEIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARS**
LLVQPNFNHHYSTQAEAASNDNAEKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFPTDHDHGKLEIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARSGS
**************A****NDNAEKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFPTDHDHGKLEIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LLVQPNFNHHYSTQAEAASNDNAEKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFPTDHDHGKLEIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARSGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query124 2.2.26 [Sep-21-2011]
Q5XHZ0 706 Heat shock protein 75 kDa yes N/A 0.814 0.143 0.644 5e-31
Q2TBI4 703 Heat shock protein 75 kDa yes N/A 0.814 0.143 0.635 3e-30
Q9CQN1 706 Heat shock protein 75 kDa yes N/A 0.814 0.143 0.635 4e-30
Q12931 704 Heat shock protein 75 kDa yes N/A 0.758 0.133 0.66 2e-29
P36183 809 Endoplasmin homolog OS=Ho N/A N/A 0.814 0.124 0.584 2e-27
P35016 817 Endoplasmin homolog OS=Ca N/A N/A 0.806 0.122 0.571 3e-26
Q9STX5 823 Endoplasmin homolog OS=Ar yes N/A 0.822 0.123 0.582 3e-26
O43109 701 Heat shock protein 90 hom yes N/A 0.790 0.139 0.582 5e-26
A0KL53 641 Chaperone protein HtpG OS yes N/A 0.806 0.156 0.553 7e-26
A4SLY0 637 Chaperone protein HtpG OS yes N/A 0.806 0.156 0.553 8e-26
>sp|Q5XHZ0|TRAP1_RAT Heat shock protein 75 kDa, mitochondrial OS=Rattus norvegicus GN=Trap1 PE=1 SV=1 Back     alignment and function desciption
 Score =  132 bits (332), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 82/107 (76%), Gaps = 6/107 (5%)

Query: 18  ASNDNAEKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFP 77
           A   +  KHEFQAET+ LLDIVA+SLYS+KEVFIRELISNASDALEKLR+ ++ E    P
Sbjct: 82  AVQGSVSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNASDALEKLRHKRVCEGQVLP 141

Query: 78  TDHDHGKLEIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARSGS 124
                 ++EI + TD +   +TIQD+GIGMTKEEL SNLGTIARSGS
Sbjct: 142 ------EMEIHLQTDAEKGTITIQDTGIGMTKEELVSNLGTIARSGS 182




Chaperone that expresses an ATPase activity.
Rattus norvegicus (taxid: 10116)
>sp|Q2TBI4|TRAP1_BOVIN Heat shock protein 75 kDa, mitochondrial OS=Bos taurus GN=TRAP1 PE=2 SV=1 Back     alignment and function description
>sp|Q9CQN1|TRAP1_MOUSE Heat shock protein 75 kDa, mitochondrial OS=Mus musculus GN=Trap1 PE=1 SV=1 Back     alignment and function description
>sp|Q12931|TRAP1_HUMAN Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens GN=TRAP1 PE=1 SV=3 Back     alignment and function description
>sp|P36183|ENPL_HORVU Endoplasmin homolog OS=Hordeum vulgare PE=2 SV=1 Back     alignment and function description
>sp|P35016|ENPL_CATRO Endoplasmin homolog OS=Catharanthus roseus GN=HSP90 PE=2 SV=1 Back     alignment and function description
>sp|Q9STX5|ENPL_ARATH Endoplasmin homolog OS=Arabidopsis thaliana GN=SHD PE=1 SV=1 Back     alignment and function description
>sp|O43109|HSP90_PODAS Heat shock protein 90 homolog OS=Podospora anserina GN=MOD-E PE=3 SV=1 Back     alignment and function description
>sp|A0KL53|HTPG_AERHH Chaperone protein HtpG OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / NCIB 9240) GN=htpG PE=3 SV=1 Back     alignment and function description
>sp|A4SLY0|HTPG_AERS4 Chaperone protein HtpG OS=Aeromonas salmonicida (strain A449) GN=htpG PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
242009900 689 heat shock protein 75 kDa, putative [Ped 0.758 0.136 0.808 3e-35
382929294 693 Hsp90-related protein TRAP1 [Bombyx mori 0.911 0.163 0.661 2e-34
156553644 702 PREDICTED: heat shock protein 75 kDa, mi 0.822 0.145 0.747 5e-34
328699750 684 PREDICTED: heat shock protein 75 kDa, mi 0.814 0.147 0.742 1e-33
307210680 707 Heat shock protein 75 kDa, mitochondrial 0.967 0.169 0.672 2e-33
332019421 692 Heat shock protein 75 kDa, mitochondrial 0.975 0.174 0.597 3e-33
383855638 694 PREDICTED: heat shock protein 75 kDa, mi 0.887 0.158 0.655 8e-33
195331851 691 GM20868 [Drosophila sechellia] gi|194124 0.927 0.166 0.681 9e-33
307179929 694 Heat shock protein 75 kDa, mitochondrial 0.991 0.177 0.598 1e-32
6466460 686 Hsp90-related protein TRAP1 [Drosophila 0.927 0.167 0.672 3e-32
>gi|242009900|ref|XP_002425720.1| heat shock protein 75 kDa, putative [Pediculus humanus corporis] gi|212509621|gb|EEB12982.1| heat shock protein 75 kDa, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 80/99 (80%), Positives = 84/99 (84%), Gaps = 5/99 (5%)

Query: 26  HEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFPTDHDHGKL 85
           HEF+AET+MLLDIVAKSLYSDKEVFIRELISNASDALEKLRY  LSE   F T      L
Sbjct: 73  HEFKAETKMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYTSLSEGKSFDT-----PL 127

Query: 86  EIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARSGS 124
           EI I TDKQNRI+TIQD+GIGMTKEEL SNLGTIARSGS
Sbjct: 128 EIHIGTDKQNRIITIQDTGIGMTKEELVSNLGTIARSGS 166




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|382929294|gb|AFG30049.1| Hsp90-related protein TRAP1 [Bombyx mori] Back     alignment and taxonomy information
>gi|156553644|ref|XP_001600436.1| PREDICTED: heat shock protein 75 kDa, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328699750|ref|XP_001948190.2| PREDICTED: heat shock protein 75 kDa, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307210680|gb|EFN87103.1| Heat shock protein 75 kDa, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332019421|gb|EGI59905.1| Heat shock protein 75 kDa, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383855638|ref|XP_003703317.1| PREDICTED: heat shock protein 75 kDa, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|195331851|ref|XP_002032612.1| GM20868 [Drosophila sechellia] gi|194124582|gb|EDW46625.1| GM20868 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|307179929|gb|EFN68064.1| Heat shock protein 75 kDa, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|6466460|gb|AAD29307.2|AF115775_1 Hsp90-related protein TRAP1 [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query124
FB|FBgn0026761 691 Trap1 "Trap1" [Drosophila mela 0.911 0.163 0.684 6.4e-31
RGD|1359733 706 Trap1 "TNF receptor-associated 0.879 0.154 0.612 2.7e-28
UNIPROTKB|J9NSW0 702 TRAP1 "Uncharacterized protein 0.879 0.155 0.603 5.7e-28
UNIPROTKB|F1PXQ9 705 TRAP1 "Uncharacterized protein 0.879 0.154 0.603 5.7e-28
UNIPROTKB|F1RK45 701 TRAP1 "Uncharacterized protein 0.782 0.138 0.650 9.3e-28
UNIPROTKB|Q2TBI4 703 TRAP1 "Heat shock protein 75 k 0.879 0.155 0.603 1.5e-27
MGI|MGI:1915265 706 Trap1 "TNF receptor-associated 0.879 0.154 0.603 2.6e-27
UNIPROTKB|F5H897 651 TRAP1 "Heat shock protein 75 k 0.822 0.156 0.620 4.4e-27
UNIPROTKB|Q12931 704 TRAP1 "Heat shock protein 75 k 0.879 0.154 0.586 5.4e-27
UNIPROTKB|F1NU73 704 TRAP1 "Uncharacterized protein 0.774 0.136 0.656 6.9e-27
FB|FBgn0026761 Trap1 "Trap1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 348 (127.6 bits), Expect = 6.4e-31, P = 6.4e-31
 Identities = 78/114 (68%), Positives = 85/114 (74%)

Query:    11 YSTQAEAASNDNAEKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQL 70
             YST+ + AS    +KHEFQAETR LLDIVA+SLYSD EVF+RELISNASDALEK RY  L
Sbjct:    51 YSTETKQASGSVVDKHEFQAETRQLLDIVARSLYSDHEVFVRELISNASDALEKFRYTSL 110

Query:    71 SEVMPFPTDHDHGKLEIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARSGS 124
             S         D   LEIRI+TDK    L IQD+GIGMTKEEL SNLGTIARSGS
Sbjct:   111 SAGGENLAGKDR-PLEIRITTDKPLMQLIIQDTGIGMTKEELVSNLGTIARSGS 163




GO:0005739 "mitochondrion" evidence=ISS
GO:0016887 "ATPase activity" evidence=ISS
GO:0006950 "response to stress" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006457 "protein folding" evidence=IEA
GO:0051082 "unfolded protein binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
RGD|1359733 Trap1 "TNF receptor-associated protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSW0 TRAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PXQ9 TRAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RK45 TRAP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TBI4 TRAP1 "Heat shock protein 75 kDa, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1915265 Trap1 "TNF receptor-associated protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F5H897 TRAP1 "Heat shock protein 75 kDa, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q12931 TRAP1 "Heat shock protein 75 kDa, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NU73 TRAP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A7FV42HTPG_CLOB1No assigned EC number0.51960.78220.1549yesN/A
A9NB44HTPG_COXBRNo assigned EC number0.55880.79830.1563yesN/A
A9KGQ8HTPG_COXBNNo assigned EC number0.54900.79830.1563yesN/A
P41887HSP90_SCHPONo assigned EC number0.51450.80640.1420yesN/A
Q97E05HTPG_CLOABNo assigned EC number0.53530.75800.1506yesN/A
Q24VT7HTPG_DESHYNo assigned EC number0.56070.74190.1498yesN/A
Q1C4P8HTPG_YERPANo assigned EC number0.53460.79030.1570yesN/A
Q9CQN1TRAP1_MOUSENo assigned EC number0.63550.81450.1430yesN/A
Q65CZ5HTPG_BACLDNo assigned EC number0.58410.77410.1533yesN/A
P15108HSC82_YEASTNo assigned EC number0.52940.79830.1404yesN/A
Q2TBI4TRAP1_BOVINNo assigned EC number0.63550.81450.1436yesN/A
A4TPA5HTPG_YERPPNo assigned EC number0.53460.79030.1570yesN/A
Q9STX5ENPL_ARATHNo assigned EC number0.58250.82250.1239yesN/A
Q86L04TRAP1_DICDINo assigned EC number0.55960.750.1308yesN/A
P40292HSP90_ASPFUNo assigned EC number0.57690.79830.1402yesN/A
Q6D7Z6HTPG_ERWCTNo assigned EC number0.53460.79030.1562yesN/A
C1FPN9HTPG_CLOBJNo assigned EC number0.51960.78220.1549yesN/A
Q0A738HTPG_ALHEHNo assigned EC number0.50460.83870.1595yesN/A
Q83EL0HTPG_COXBUNo assigned EC number0.55880.79830.1563yesN/A
A5I3B0HTPG_CLOBHNo assigned EC number0.51960.78220.1549yesN/A
O43109HSP90_PODASNo assigned EC number0.58250.79030.1398yesN/A
A4SLY0HTPG_AERS4No assigned EC number0.55330.80640.1569yesN/A
Q313E8HTPG_DESDGNo assigned EC number0.55330.79030.1540yesN/A
P58482HTPG_YERPENo assigned EC number0.53460.79030.1575yesN/A
P02829HSP82_YEASTNo assigned EC number0.52940.79830.1396yesN/A
Q0AHI5HTPG_NITECNo assigned EC number0.51920.81450.1578yesN/A
Q7N0P4HTPG_PHOLLNo assigned EC number0.53460.79030.1555yesN/A
Q1CL28HTPG_YERPNNo assigned EC number0.53460.79030.1570yesN/A
B2A875HTPG_NATTJNo assigned EC number0.56560.77410.1531yesN/A
Q12931TRAP1_HUMANNo assigned EC number0.660.75800.1335yesN/A
A0KL53HTPG_AERHHNo assigned EC number0.55330.80640.1560yesN/A
A6TKN0HTPG_ALKMQNo assigned EC number0.53460.77410.1533yesN/A
Q9KE51HTPG_BACHDNo assigned EC number0.53920.78220.1552yesN/A
A1JNB3HTPG_YERE8No assigned EC number0.53460.79030.1570yesN/A
Q66DP8HTPG_YERPSNo assigned EC number0.53460.79030.1570yesN/A
Q5QWR2HTPG_IDILONo assigned EC number0.51480.79030.1538yesN/A
C3KXP4HTPG_CLOB6No assigned EC number0.51960.78220.1549yesN/A
Q5WJE6HTPG_BACSKNo assigned EC number0.52940.78220.1552yesN/A
A2SKM5HTPG_METPPNo assigned EC number0.51450.80640.16yesN/A
Q5XHZ0TRAP1_RATNo assigned EC number0.64480.81450.1430yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
PRK05218 613 PRK05218, PRK05218, heat shock protein 90; Provisi 2e-48
COG0326 623 COG0326, HtpG, Molecular chaperone, HSP90 family [ 9e-40
PTZ00130 814 PTZ00130, PTZ00130, heat shock protein 90; Provisi 4e-28
PTZ00272 701 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp 3e-25
PRK14083 601 PRK14083, PRK14083, HSP90 family protein; Provisio 5e-14
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; 9e-08
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPas 4e-05
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyras 1e-04
>gnl|CDD|235366 PRK05218, PRK05218, heat shock protein 90; Provisional Back     alignment and domain information
 Score =  162 bits (413), Expect = 2e-48
 Identities = 58/103 (56%), Positives = 77/103 (74%), Gaps = 3/103 (2%)

Query: 22  NAEKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFPTDHD 81
             E  EFQAE + LL ++  SLYS+KE+F+RELISNASDA++KLR+  L++  P   +  
Sbjct: 2   AMETGEFQAEVKQLLHLMIHSLYSNKEIFLRELISNASDAIDKLRFEALTD--PALYE-G 58

Query: 82  HGKLEIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARSGS 124
            G L+IRIS DK+ R LTI D+GIGMT+EE+  NLGTIA+SG+
Sbjct: 59  DGDLKIRISFDKEARTLTISDNGIGMTREEVIENLGTIAKSGT 101


Length = 613

>gnl|CDD|223403 COG0326, HtpG, Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185466 PTZ00130, PTZ00130, heat shock protein 90; Provisional Back     alignment and domain information
>gnl|CDD|240341 PTZ00272, PTZ00272, heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>gnl|CDD|237603 PRK14083, PRK14083, HSP90 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238030 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|214643 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|217081 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 124
COG0326 623 HtpG Molecular chaperone, HSP90 family [Posttransl 99.91
PTZ00272 701 heat shock protein 83 kDa (Hsp83); Provisional 99.87
PTZ00130 814 heat shock protein 90; Provisional 99.86
KOG0019|consensus 656 99.84
PRK05218 613 heat shock protein 90; Provisional 99.82
KOG0020|consensus 785 99.81
PRK14083 601 HSP90 family protein; Provisional 99.73
PF13589137 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and 98.93
COG4191603 Signal transduction histidine kinase regulating C4 98.76
PF02518111 HATPase_c: Histidine kinase-, DNA gyrase B-, and H 98.69
COG1389 538 DNA topoisomerase VI, subunit B [DNA replication, 98.67
TIGR02938494 nifL_nitrog nitrogen fixation negative regulator N 98.42
PRK11006430 phoR phosphate regulon sensor protein; Provisional 98.4
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Si 98.39
PRK10755356 sensor protein BasS/PmrB; Provisional 98.38
TIGR01386457 cztS_silS_copS heavy metal sensor kinase. Members 98.37
COG5002459 VicK Signal transduction histidine kinase [Signal 98.37
COG0642336 BaeS Signal transduction histidine kinase [Signal 98.35
PRK09303380 adaptive-response sensory kinase; Validated 98.35
TIGR02916679 PEP_his_kin putative PEP-CTERM system histidine ki 98.33
PRK10549466 signal transduction histidine-protein kinase BaeS; 98.33
COG3290537 CitA Signal transduction histidine kinase regulati 98.32
PRK10364457 sensor protein ZraS; Provisional 98.3
PRK11086542 sensory histidine kinase DcuS; Provisional 98.3
PRK15347 921 two component system sensor kinase SsrA; Provision 98.23
PRK10490895 sensor protein KdpD; Provisional 98.17
PRK04184 535 DNA topoisomerase VI subunit B; Validated 98.16
PRK10604433 sensor protein RstB; Provisional 98.15
PRK14868 795 DNA topoisomerase VI subunit B; Provisional 98.14
PRK13837 828 two-component VirA-like sensor kinase; Provisional 98.14
PRK11100475 sensory histidine kinase CreC; Provisional 98.14
TIGR00585 312 mutl DNA mismatch repair protein MutL. All protein 98.11
TIGR02956 968 TMAO_torS TMAO reductase sytem sensor TorS. This p 98.11
TIGR03785703 marine_sort_HK proteobacterial dedicated sortase s 98.1
PRK11091 779 aerobic respiration control sensor protein ArcB; P 98.08
PRK11466 914 hybrid sensory histidine kinase TorS; Provisional 98.07
PRK11360607 sensory histidine kinase AtoS; Provisional 98.05
PRK15053545 dpiB sensor histidine kinase DpiB; Provisional 98.05
PRK10618 894 phosphotransfer intermediate protein in two-compon 98.05
PRK09467435 envZ osmolarity sensor protein; Provisional 98.05
PRK09470461 cpxA two-component sensor protein; Provisional 98.04
TIGR01052 488 top6b DNA topoisomerase VI, B subunit. This model 98.04
TIGR02966333 phoR_proteo phosphate regulon sensor kinase PhoR. 98.01
PRK10841 924 hybrid sensory kinase in two-component regulatory 97.98
PRK09835482 sensor kinase CusS; Provisional 97.98
PRK13560807 hypothetical protein; Provisional 97.98
COG0323 638 MutL DNA mismatch repair enzyme (predicted ATPase) 97.95
COG3920221 Signal transduction histidine kinase [Signal trans 97.93
PRK10815485 sensor protein PhoQ; Provisional 97.89
PRK00095 617 mutL DNA mismatch repair protein; Reviewed 97.87
PRK11073348 glnL nitrogen regulation protein NR(II); Provision 97.78
PRK13557 540 histidine kinase; Provisional 97.78
PRK14867 659 DNA topoisomerase VI subunit B; Provisional 97.77
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine 97.73
PRK04069161 serine-protein kinase RsbW; Provisional 97.7
PRK11107 919 hybrid sensory histidine kinase BarA; Provisional 97.69
PRK10337449 sensor protein QseC; Provisional 97.68
cd00075103 HATPase_c Histidine kinase-like ATPases; This fami 97.62
PRK10547 670 chemotaxis protein CheA; Provisional 97.62
PRK11644495 sensory histidine kinase UhpB; Provisional 97.58
COG2972456 Predicted signal transduction protein with a C-ter 97.57
COG5000712 NtrY Signal transduction histidine kinase involved 97.55
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 97.51
COG3852363 NtrB Signal transduction histidine kinase, nitroge 97.49
PRK05559 631 DNA topoisomerase IV subunit B; Reviewed 97.48
PRK09959 1197 hybrid sensory histidine kinase in two-component r 97.44
TIGR01924159 rsbW_low_gc serine-protein kinase RsbW. This model 97.38
TIGR01925137 spIIAB anti-sigma F factor. This model describes t 97.32
COG4251750 Bacteriophytochrome (light-regulated signal transd 97.28
COG0643 716 CheA Chemotaxis protein histidine kinase and relat 97.27
PRK10935565 nitrate/nitrite sensor protein NarQ; Provisional 97.21
PF13581125 HATPase_c_2: Histidine kinase-like ATPase domain 97.18
COG3850574 NarQ Signal transduction histidine kinase, nitrate 97.08
PRK03660146 anti-sigma F factor; Provisional 97.06
PRK13559361 hypothetical protein; Provisional 96.99
COG4585365 Signal transduction histidine kinase [Signal trans 96.94
COG4192673 Signal transduction histidine kinase regulating ph 96.9
smart00433 594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomeras 96.81
PRK05644 638 gyrB DNA gyrase subunit B; Validated 96.62
TIGR01055 625 parE_Gneg DNA topoisomerase IV, B subunit, proteob 96.45
TIGR01059 654 gyrB DNA gyrase, B subunit. This model describes t 96.39
KOG0787|consensus414 96.21
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein 96.06
PRK14939 756 gyrB DNA gyrase subunit B; Provisional 95.71
COG3275557 LytS Putative regulator of cell autolysis [Signal 95.22
COG3851497 UhpB Signal transduction histidine kinase, glucose 94.63
TIGR01058 637 parE_Gpos DNA topoisomerase IV, B subunit, Gram-po 94.41
KOG1978|consensus 672 93.47
KOG1977|consensus 1142 93.4
PF14501100 HATPase_c_5: GHKL domain 92.57
PLN03128 1135 DNA topoisomerase 2; Provisional 92.1
PLN03237 1465 DNA topoisomerase 2; Provisional 91.83
PTZ00108 1388 DNA topoisomerase 2-like protein; Provisional 91.53
PHA02569 602 39 DNA topoisomerase II large subunit; Provisional 91.15
COG4564459 Signal transduction histidine kinase [Signal trans 90.43
PTZ00109 903 DNA gyrase subunit b; Provisional 90.41
KOG1979|consensus 694 89.92
COG0187 635 GyrB Type IIA topoisomerase (DNA gyrase/topo II, t 89.58
COG5381184 Uncharacterized protein conserved in bacteria [Fun 81.94
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.91  E-value=8.8e-25  Score=188.20  Aligned_cols=99  Identities=58%  Similarity=0.842  Sum_probs=91.2

Q ss_pred             cceeEehhhhhhhHHHHhhhhcCcHHHHHHHHHhhHHHHHHHHhhhcccCCCCCCCCCCCCeEEEEEEEcCCceEEEEEE
Q psy15895         23 AEKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFPTDHDHGKLEIRISTDKQNRILTIQD  102 (124)
Q Consensus        23 ~e~~~f~~ei~~~l~ll~~~~y~~~~v~l~eLl~NA~dA~~~ik~~~ln~~~~~eam~~~g~i~I~i~~~~~~~~I~I~D  102 (124)
                      .++..||+++.+++++|++.+|++++||+||||+||.|||.|+||..+..+...   ...+.++|++..++++.+|+|+|
T Consensus         4 ~e~~~Fq~ev~~ll~lmihSlYSnKeIFLRELISNAsDAidKlr~~al~~~~~~---~~~~~~~I~i~~Dk~~kTLtI~D   80 (623)
T COG0326           4 QETRGFQAEVKQLLDLMIHSLYSNKEIFLRELISNASDAIDKLRFEALSDPELG---EGDSDLRIRISFDKDNKTLTISD   80 (623)
T ss_pred             hhhhhhhHHHHHHHHHHHHhccCCcHHHHHHHHhhhHHHHHHHHHHhccCcccc---CCCCCceEEEEEcccCCEEEEEe
Confidence            467889999999999999999999999999999999999999999988766543   34568999999999999999999


Q ss_pred             cCCCCCHHHHHhhccccccCCC
Q psy15895        103 SGIGMTKEELKSNLGTIARSGS  124 (124)
Q Consensus       103 nGiGM~~e~l~~~l~~i~~S~~  124 (124)
                      |||||+++++.++|||||+||+
T Consensus        81 NGIGMT~~Ev~~~LgTIAkSgT  102 (623)
T COG0326          81 NGIGMTKDEVIENLGTIAKSGT  102 (623)
T ss_pred             CCCCCCHHHHHHHHHHhhhccH
Confidence            9999999999999999999996



>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>KOG0019|consensus Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>KOG0020|consensus Back     alignment and domain information
>PRK14083 HSP90 family protein; Provisional Back     alignment and domain information
>PF13589 HATPase_c_3: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; PDB: 3IED_A 2XCM_B 2JKI_B 3OPD_A 2O1V_B 2GQP_A 2O1W_C 1YT2_A 1TC6_A 2H8M_B Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PF02518 HATPase_c: Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase; InterPro: IPR003594 This domain is found in several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases [], heat shock protein HSP90 [, , ], phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK14868 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>TIGR03785 marine_sort_HK proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>PRK15053 dpiB sensor histidine kinase DpiB; Provisional Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK14867 DNA topoisomerase VI subunit B; Provisional Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR01924 rsbW_low_gc serine-protein kinase RsbW Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK10935 nitrate/nitrite sensor protein NarQ; Provisional Back     alignment and domain information
>PF13581 HATPase_c_2: Histidine kinase-like ATPase domain Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit, proteobacterial Back     alignment and domain information
>TIGR01059 gyrB DNA gyrase, B subunit Back     alignment and domain information
>KOG0787|consensus Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PRK14939 gyrB DNA gyrase subunit B; Provisional Back     alignment and domain information
>COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit, Gram-positive Back     alignment and domain information
>KOG1978|consensus Back     alignment and domain information
>KOG1977|consensus Back     alignment and domain information
>PF14501 HATPase_c_5: GHKL domain Back     alignment and domain information
>PLN03128 DNA topoisomerase 2; Provisional Back     alignment and domain information
>PLN03237 DNA topoisomerase 2; Provisional Back     alignment and domain information
>PTZ00108 DNA topoisomerase 2-like protein; Provisional Back     alignment and domain information
>PHA02569 39 DNA topoisomerase II large subunit; Provisional Back     alignment and domain information
>COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00109 DNA gyrase subunit b; Provisional Back     alignment and domain information
>KOG1979|consensus Back     alignment and domain information
>COG0187 GyrB Type IIA topoisomerase (DNA gyrase/topo II, topoisomerase IV), B subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG5381 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
4gqt_A 227 N-Terminal Domain Of C. Elegans Hsp90 Length = 227 8e-26
3peh_A 281 Crystal Structure Of The N-Terminal Domain Of An Hs 3e-25
1ah8_A 220 Structure Of The Orthorhombic Form Of The N-Termina 3e-24
2bre_A 219 Structure Of A Hsp90 Inhibitor Bound To The N-Termi 3e-24
1us7_A 214 Complex Of Hsp90 And P50 Length = 214 3e-24
2cg9_A 677 Crystal Structure Of An Hsp90-Sba1 Closed Chaperone 3e-24
1a4h_A 230 Structure Of The N-Terminal Domain Of The Yeast Hsp 3e-24
1zw9_A 240 Yeast Hsp82 In Complex With The Novel Hsp90 Inhibit 3e-24
2xx2_A 214 Macrolactone Inhibitor Bound To Hsp90 N-Term Length 3e-24
2cgf_A 225 A Radicicol Analogue Bound To The Atp Binding Site 3e-24
1am1_A 213 Atp Binding Site In The Hsp90 Molecular Chaperone L 3e-24
1bgq_A 225 Radicicol Bound To The Atp Binding Site Of The N-Te 3e-24
3hhu_A 224 Human Heat-Shock Protein 90 (Hsp90) In Complex With 6e-24
1uyi_A 236 Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benzyl)-2-F 7e-24
3d0b_A 232 Crystal Structure Of Benzamide Tetrahydro-4h-Carbaz 7e-24
2wep_A 220 Yeast Hsp90 N-Terminal Domain Li-Iv Mutant With Adp 7e-24
1uy6_A 236 Human Hsp90-Alpha With 9-Butyl-8-(3,4,5-Trimethoxy- 8e-24
2yi0_A 229 Structural Characterization Of 5-Aryl-4-(5-Substitu 8e-24
2ccs_A 236 Human Hsp90 With 4-Chloro-6-(4-Piperazin-1-Yl-1h-Py 8e-24
3qdd_A 237 Hsp90a N-Terminal Domain In Complex With Biib021 Le 9e-24
2fwy_A 256 Structure Of Human Hsp90-Alpha Bound To The Potent 9e-24
2bsm_A 235 Novel, Potent Small Molecule Inhibitors Of The Mole 1e-23
2ygf_A 220 L89v, L93i And V136m Mutant Of N-term Hsp90 Complex 1e-23
2yge_A 220 E88g-n92l Mutant Of N-term Hsp90 Complexed With Gel 1e-23
3c0e_A 240 Yeast Hsp82 N-Terminal Domain: Effects Of Mutants 9 2e-23
3k97_A 251 Hsp90 N-Terminal Domain In Complex With 4-Chloro-6- 2e-23
2qfo_A 207 Hsp90 Complexed With A143571 And A516383 Length = 2 3e-23
2qf6_A 207 Hsp90 Complexed With A56322 Length = 207 3e-23
1osf_A 215 Human Hsp90 In Complex With 17-desmethoxy-17-n,n- D 3e-23
3tuh_A 209 Crystal Structure Of The N-Terminal Domain Of An Hs 3e-23
2k5b_A 210 Human Cdc37-Hsp90 Docking Model Based On Nmr Length 3e-23
2jjc_A 218 Hsp90 Alpha Atpase Domain With Bound Small Molecule 3e-23
3k98_A 232 Hsp90 N-Terminal Domain In Complex With (1r)-2-(5-C 3e-23
3eko_A 226 Dihydroxylphenyl Amides As Inhibitors Of The Hsp90 3e-23
2xdu_A 236 Structre Of Hsp90 With Small Molecule Inhibitor Bou 3e-23
2yjw_A 209 Tricyclic Series Of Hsp90 Inhibitors Length = 209 4e-23
3h80_A 231 Crystal Structure Of The Amino-Terminal Domain Of H 4e-23
3bm9_A 226 Discovery Of Benzisoxazoles As Potent Inhibitors Of 4e-23
3inw_A 228 Hsp90 N-Terminal Domain With Pochoxime A Length = 2 4e-23
3b24_A 229 Hsp90 Alpha N-Terminal Domain In Complex With An Am 4e-23
2ye7_A 252 Hsp90 Inhibitors And Drugs From Fragment And Virtua 5e-23
3r4m_A 228 Optimization Of Potent, Selective, And Orally Bioav 5e-23
2xjj_A 249 Structre Of Hsp90 With Small Molecule Inhibitor Bou 5e-23
4awo_A 230 Complex Of Hsp90 Atpase Domain With Tropane Derived 5e-23
4eeh_A 229 Hsp90 Alpha N-Terminal Domain In Complex With An In 5e-23
4egh_A 232 Hsp90-Alpha Atpase Domain In Complex With (4-Hydrox 5e-23
1y4s_A 559 Conformation Rearrangement Of Heat Shock Protein 90 5e-23
2yee_A 252 Hsp90 Inhibitors And Drugs From Fragment And Virtua 5e-23
3ft5_A 249 Structure Of Hsp90 Bound With A Novel Fragment Leng 5e-23
1byq_A 228 Hsp90 N-Terminal Domain Bound To Adp-Mg Length = 22 5e-23
1yc1_A 264 Crystal Structures Of Human Hsp90alpha Complexed Wi 5e-23
2ye2_A 252 Hsp90 Inhibitors And Drugs From Fragment And Virtua 6e-23
2xjg_A 249 Structure Of Hsp90 With Small Molecule Inhibitor Bo 6e-23
3k60_A 223 Crystal Structure Of N-Terminal Domain Of Plasmodiu 6e-23
2iop_A 624 Crystal Structure Of Full-Length Htpg, The Escheric 6e-23
2ior_A 235 Crystal Structure Of The N-Terminal Domain Of Htpg, 7e-23
3o6o_A 214 Crystal Structure Of The N-Terminal Domain Of An Hs 1e-22
3opd_A 231 Crystal Structure Of The N-Terminal Domain Of An Hs 1e-22
3nmq_A 239 Hsp90b N-Terminal Domain In Complex With Ec44, A Py 2e-22
1uym_A 220 Human Hsp90-Beta With Pu3 (9-Butyl-8(3,4,5-Trimetho 2e-22
2yga_A 220 E88g-n92l Mutant Of N-term Hsp90 Complexed With Gel 2e-22
1u2o_A 236 Crystal Structure Of The N-Domain Of Grp94 Lacking 1e-21
1u0y_A 273 N-Domain Of Grp94, With The Charged Domain, In Comp 1e-21
1qy5_A 269 Crystal Structure Of The N-Domain Of The Er Hsp90 C 1e-21
2o1w_A 506 Structure Of N-Terminal Plus Middle Domains (N+m) O 4e-21
2xcm_A 214 Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord 4e-21
2o1u_A 666 Structure Of Full Length Grp94 With Amp-Pnp Bound L 4e-21
2esa_A 236 Grp94 N-Terminal Domain Bound To Geldanamycin: Effe 7e-21
2jki_A 223 Complex Of Hsp90 N-terminal And Sgt1 Cs Domain Leng 8e-21
2akp_A 186 Hsp90 Delta24-n210 Mutant Length = 186 8e-19
3ied_A 272 Crystal Structure Of N-Terminal Domain Of Plasmodiu 2e-16
>pdb|4GQT|A Chain A, N-Terminal Domain Of C. Elegans Hsp90 Length = 227 Back     alignment and structure

Iteration: 1

Score = 112 bits (279), Expect = 8e-26, Method: Compositional matrix adjust. Identities = 56/108 (51%), Positives = 81/108 (75%), Gaps = 5/108 (4%) Query: 18 ASNDNAEKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFP 77 A ++NAE FQAE L+ ++ + YS+KE+++RELISNASDAL+K+RY L+E P Sbjct: 3 AMSENAETFAFQAEIAQLMSLIINTFYSNKEIYLRELISNASDALDKIRYQALTE----P 58 Query: 78 TDHDHGK-LEIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARSGS 124 ++ D GK L I+I+ +K+ + LTI D+GIGMTK +L +NLGTIA+SG+ Sbjct: 59 SELDTGKELFIKITPNKEEKTLTIMDTGIGMTKADLVNNLGTIAKSGT 106
>pdb|3PEH|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Plasmodium Falciparum, Pfl1070c In The Presence Of A Thienopyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|1AH8|A Chain A, Structure Of The Orthorhombic Form Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone Length = 220 Back     alignment and structure
>pdb|2BRE|A Chain A, Structure Of A Hsp90 Inhibitor Bound To The N-Terminus Of Yeast Hsp90. Length = 219 Back     alignment and structure
>pdb|1US7|A Chain A, Complex Of Hsp90 And P50 Length = 214 Back     alignment and structure
>pdb|2CG9|A Chain A, Crystal Structure Of An Hsp90-Sba1 Closed Chaperone Complex Length = 677 Back     alignment and structure
>pdb|1A4H|A Chain A, Structure Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone In Complex With Geldanamycin Length = 230 Back     alignment and structure
>pdb|1ZW9|A Chain A, Yeast Hsp82 In Complex With The Novel Hsp90 Inhibitor 8-(6-Bromo- Benzo[1, 3]dioxol-5-Ylsulfanyl)-9-(3-Isopropylamino-Propyl)- Adenine Length = 240 Back     alignment and structure
>pdb|2XX2|A Chain A, Macrolactone Inhibitor Bound To Hsp90 N-Term Length = 214 Back     alignment and structure
>pdb|2CGF|A Chain A, A Radicicol Analogue Bound To The Atp Binding Site Of The N- Terminal Domain Of The Yeast Hsp90 Chaperone Length = 225 Back     alignment and structure
>pdb|1AM1|A Chain A, Atp Binding Site In The Hsp90 Molecular Chaperone Length = 213 Back     alignment and structure
>pdb|1BGQ|A Chain A, Radicicol Bound To The Atp Binding Site Of The N-Terminal Domain Of The Yeast Hsp90 Chaperone Length = 225 Back     alignment and structure
>pdb|3HHU|A Chain A, Human Heat-Shock Protein 90 (Hsp90) In Complex With {4-[3- (2,4-Dihydroxy-5-Isopropyl-Phenyl)-5-Thioxo- 1,5-Dihydro- [1,2,4]triazol-4-Yl]-Benzyl}-Carbamic Acid Ethyl Ester {zk 2819} Length = 224 Back     alignment and structure
>pdb|1UYI|A Chain A, Human Hsp90-Alpha With 8-(2,5-Dimethoxy-Benzyl)-2-Fluoro-9- Pent-9h-Purin-6-Ylamine Length = 236 Back     alignment and structure
>pdb|3D0B|A Chain A, Crystal Structure Of Benzamide Tetrahydro-4h-Carbazol-4-One Bound To Hsp90 Length = 232 Back     alignment and structure
>pdb|2WEP|A Chain A, Yeast Hsp90 N-Terminal Domain Li-Iv Mutant With Adp Length = 220 Back     alignment and structure
>pdb|1UY6|A Chain A, Human Hsp90-Alpha With 9-Butyl-8-(3,4,5-Trimethoxy-Benzyl)-9h-Purin-6-Ylamine Length = 236 Back     alignment and structure
>pdb|2YI0|A Chain A, Structural Characterization Of 5-Aryl-4-(5-Substituted-2-4- Dihydroxyphenyl)-1,2,3-Thiadiazole Hsp90 Inhibitors. Length = 229 Back     alignment and structure
>pdb|2CCS|A Chain A, Human Hsp90 With 4-Chloro-6-(4-Piperazin-1-Yl-1h-Pyrazol-3- Yl)-Benzene-1,2-Diol Length = 236 Back     alignment and structure
>pdb|3QDD|A Chain A, Hsp90a N-Terminal Domain In Complex With Biib021 Length = 237 Back     alignment and structure
>pdb|2FWY|A Chain A, Structure Of Human Hsp90-Alpha Bound To The Potent Water Soluble Inhibitor Pu-H64 Length = 256 Back     alignment and structure
>pdb|2BSM|A Chain A, Novel, Potent Small Molecule Inhibitors Of The Molecular Chaperone Hsp90 Discovered Through Structure-Based Design Length = 235 Back     alignment and structure
>pdb|2YGF|A Chain A, L89v, L93i And V136m Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 Back     alignment and structure
>pdb|2YGE|A Chain A, E88g-n92l Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 Back     alignment and structure
>pdb|3C0E|A Chain A, Yeast Hsp82 N-Terminal Domain: Effects Of Mutants 98-99 Ks- Aa Length = 240 Back     alignment and structure
>pdb|3K97|A Chain A, Hsp90 N-Terminal Domain In Complex With 4-Chloro-6-{[(2r)-2- (2-Methylphenyl)pyrrolidin-1-Yl]carbonyl}benzene-1, 3-Diol Length = 251 Back     alignment and structure
>pdb|2QFO|A Chain A, Hsp90 Complexed With A143571 And A516383 Length = 207 Back     alignment and structure
>pdb|2QF6|A Chain A, Hsp90 Complexed With A56322 Length = 207 Back     alignment and structure
>pdb|1OSF|A Chain A, Human Hsp90 In Complex With 17-desmethoxy-17-n,n- Dimethylaminoethylamino-geldanamycin Length = 215 Back     alignment and structure
>pdb|3TUH|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 In The Presence Of An The Inhibitor Ganetespib Length = 209 Back     alignment and structure
>pdb|2K5B|A Chain A, Human Cdc37-Hsp90 Docking Model Based On Nmr Length = 210 Back     alignment and structure
>pdb|2JJC|A Chain A, Hsp90 Alpha Atpase Domain With Bound Small Molecule Fragment Length = 218 Back     alignment and structure
>pdb|3K98|A Chain A, Hsp90 N-Terminal Domain In Complex With (1r)-2-(5-Chloro-2, 4-Dihydroxybenzoyl)-N-Ethylisoindoline-1-Carboxamide Length = 232 Back     alignment and structure
>pdb|3EKO|A Chain A, Dihydroxylphenyl Amides As Inhibitors Of The Hsp90 Molecular Chaperone Length = 226 Back     alignment and structure
>pdb|2XDU|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound Length = 236 Back     alignment and structure
>pdb|2YJW|A Chain A, Tricyclic Series Of Hsp90 Inhibitors Length = 209 Back     alignment and structure
>pdb|3H80|A Chain A, Crystal Structure Of The Amino-Terminal Domain Of Hsp90 From Leishmania Major, Lmjf33.0312:m1-K213 Length = 231 Back     alignment and structure
>pdb|3BM9|A Chain A, Discovery Of Benzisoxazoles As Potent Inhibitors Of Chaperone Hsp90 Length = 226 Back     alignment and structure
>pdb|3INW|A Chain A, Hsp90 N-Terminal Domain With Pochoxime A Length = 228 Back     alignment and structure
>pdb|3B24|A Chain A, Hsp90 Alpha N-Terminal Domain In Complex With An Aminotriazine Fragment Molecule Length = 229 Back     alignment and structure
>pdb|2YE7|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 Back     alignment and structure
>pdb|3R4M|A Chain A, Optimization Of Potent, Selective, And Orally Bioavailable Pyrrolodinopyrimidine-Containing Inhibitors Of Heat Shock Protein 90. Identification Of Development Candidate 2-Amino-4-{4-Chloro-2-[2-(4- Fluoro-1h-Pyrazol-1-Yl)ethoxy]-6-Methylphenyl}-N-(2,2- Difluoropropyl)-5,7-Dihydro-6h-Pyrrolo[3, 4-D]pyrimidine-6-Carboxamide Length = 228 Back     alignment and structure
>pdb|2XJJ|A Chain A, Structre Of Hsp90 With Small Molecule Inhibitor Bound Length = 249 Back     alignment and structure
>pdb|4AWO|A Chain A, Complex Of Hsp90 Atpase Domain With Tropane Derived Inhibitors Length = 230 Back     alignment and structure
>pdb|4EEH|A Chain A, Hsp90 Alpha N-Terminal Domain In Complex With An Inhibitor 3-(4- Hydroxy-Phenyl)-1h-Indazol-6-Ol Length = 229 Back     alignment and structure
>pdb|4EGH|A Chain A, Hsp90-Alpha Atpase Domain In Complex With (4-Hydroxyphenyl)morpholin- 4-Yl Methanone Length = 232 Back     alignment and structure
>pdb|1Y4S|A Chain A, Conformation Rearrangement Of Heat Shock Protein 90 Upon Adp Binding Length = 559 Back     alignment and structure
>pdb|2YEE|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 Back     alignment and structure
>pdb|3FT5|A Chain A, Structure Of Hsp90 Bound With A Novel Fragment Length = 249 Back     alignment and structure
>pdb|1BYQ|A Chain A, Hsp90 N-Terminal Domain Bound To Adp-Mg Length = 228 Back     alignment and structure
>pdb|1YC1|A Chain A, Crystal Structures Of Human Hsp90alpha Complexed With Dihydroxyphenylpyrazoles Length = 264 Back     alignment and structure
>pdb|2YE2|A Chain A, Hsp90 Inhibitors And Drugs From Fragment And Virtual Screening Length = 252 Back     alignment and structure
>pdb|2XJG|A Chain A, Structure Of Hsp90 With Small Molecule Inhibitor Bound Length = 249 Back     alignment and structure
>pdb|3K60|A Chain A, Crystal Structure Of N-Terminal Domain Of Plasmodium Falciparum Hsp90 (Pf07_0029) Bound To Adp Length = 223 Back     alignment and structure
>pdb|2IOP|A Chain A, Crystal Structure Of Full-Length Htpg, The Escherichia Coli Hsp90, Bound To Adp Length = 624 Back     alignment and structure
>pdb|2IOR|A Chain A, Crystal Structure Of The N-Terminal Domain Of Htpg, The Escherichia Coli Hsp90, Bound To Adp Length = 235 Back     alignment and structure
>pdb|3O6O|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Trypanosoma Brucei, Tb10.26.1080 In The Presence Of An The Inhibitor Biib021 Length = 214 Back     alignment and structure
>pdb|3OPD|A Chain A, Crystal Structure Of The N-Terminal Domain Of An Hsp90 From Trypanosoma Brucei, Tb10.26.1080 In The Presence Of A Benzamide Derivative Length = 231 Back     alignment and structure
>pdb|3NMQ|A Chain A, Hsp90b N-Terminal Domain In Complex With Ec44, A Pyrrolo-Pyrimidine Methoxypyridine Inhibitor Length = 239 Back     alignment and structure
>pdb|1UYM|A Chain A, Human Hsp90-Beta With Pu3 (9-Butyl-8(3,4,5-Trimethoxy-Benzyl)-9h-Purin-6-Ylamine) Length = 220 Back     alignment and structure
>pdb|2YGA|A Chain A, E88g-n92l Mutant Of N-term Hsp90 Complexed With Geldanamycin Length = 220 Back     alignment and structure
>pdb|1U2O|A Chain A, Crystal Structure Of The N-Domain Of Grp94 Lacking The Charged Domain In Complex With Neca Length = 236 Back     alignment and structure
>pdb|1U0Y|A Chain A, N-Domain Of Grp94, With The Charged Domain, In Complex With The Novel Ligand N-Propyl Carboxyamido Adenosine Length = 273 Back     alignment and structure
>pdb|1QY5|A Chain A, Crystal Structure Of The N-Domain Of The Er Hsp90 Chaperone Grp94 In Complex With The Specific Ligand Neca Length = 269 Back     alignment and structure
>pdb|2O1W|A Chain A, Structure Of N-Terminal Plus Middle Domains (N+m) Of Grp94 Length = 506 Back     alignment and structure
>pdb|2XCM|A Chain A, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 Domain Length = 214 Back     alignment and structure
>pdb|2O1U|A Chain A, Structure Of Full Length Grp94 With Amp-Pnp Bound Length = 666 Back     alignment and structure
>pdb|2ESA|A Chain A, Grp94 N-Terminal Domain Bound To Geldanamycin: Effects Of Mutants 168- 169 Ks-Aa Length = 236 Back     alignment and structure
>pdb|2JKI|A Chain A, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain Length = 223 Back     alignment and structure
>pdb|2AKP|A Chain A, Hsp90 Delta24-n210 Mutant Length = 186 Back     alignment and structure
>pdb|3IED|A Chain A, Crystal Structure Of N-Terminal Domain Of Plasmodium Falciparum Hsp90 (Pf14_0417) In Complex With Amppn Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query124
1y4s_A 559 Chaperone protein HTPG; HSP90, molecular chaperone 4e-54
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 5e-53
3peh_A 281 Endoplasmin homolog; structural genomics, structur 9e-53
2ior_A 235 Chaperone protein HTPG; heat shock protein, HSP90; 5e-52
3nmq_A 239 Heat shock protein HSP 90-beta; ATPase, chaperone- 1e-50
2gqp_A 236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 2e-50
3o0i_A 256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 5e-50
3t0h_A 228 Heat shock protein HSP 90-alpha; chaperone, ATPase 7e-50
2wer_A 220 ATP-dependent molecular chaperone HSP82; ATPase, A 9e-50
1qy5_A 269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 1e-49
1yc1_A 264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 1e-49
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 6e-49
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 2e-44
3ied_A 272 Heat shock protein; HSP90, chaperone, structural g 5e-41
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 3e-05
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 3e-04
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 3e-04
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Length = 559 Back     alignment and structure
 Score =  176 bits (449), Expect = 4e-54
 Identities = 51/103 (49%), Positives = 72/103 (69%), Gaps = 3/103 (2%)

Query: 22  NAEKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFPTDHD 81
             E   FQ+E + LL ++  SLYS+KE+F+RELISNASDA +KLR+  LS    +  D +
Sbjct: 3   GQETRGFQSEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFRALSNPDLYEGDGE 62

Query: 82  HGKLEIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARSGS 124
              L +R+S DK  R LTI D+G+GMT++E+  +LGTIA+SG+
Sbjct: 63  ---LRVRVSFDKDKRTLTISDNGVGMTRDEVIDHLGTIAKSGT 102


>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Length = 624 Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Length = 281 Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Length = 235 Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} Length = 239 Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Length = 236 Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Length = 256 Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Length = 228 Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Length = 220 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Length = 269 Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Length = 264 Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Length = 666 Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Length = 677 Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Length = 272 Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Length = 244 Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Length = 152 Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Length = 349 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
3ied_A 272 Heat shock protein; HSP90, chaperone, structural g 99.91
3peh_A 281 Endoplasmin homolog; structural genomics, structur 99.89
3nmq_A 239 Heat shock protein HSP 90-beta; ATPase, chaperone- 99.88
1qy5_A 269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 99.87
3o0i_A 256 HSP90AA1 protein; HSP90 heat-shock proteins, chape 99.86
3t0h_A 228 Heat shock protein HSP 90-alpha; chaperone, ATPase 99.85
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 99.84
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone 99.84
2gqp_A 236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 99.84
2wer_A 220 ATP-dependent molecular chaperone HSP82; ATPase, A 99.81
1y4s_A 559 Chaperone protein HTPG; HSP90, molecular chaperone 99.8
2ior_A 235 Chaperone protein HTPG; heat shock protein, HSP90; 99.8
1yc1_A 264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 99.79
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 99.78
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding dom 98.66
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 98.64
4ew8_A268 Sensor protein DIVL; signal transduction, two-comp 98.58
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinas 98.57
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, se 98.56
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bund 98.56
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, sign 98.53
1b63_A 333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 98.49
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine 98.47
4fpp_A247 Phosphotransferase; four helix bundle, bergerat fo 98.46
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 98.46
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 98.46
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozy; 98.46
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 98.44
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 98.44
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein 98.41
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 98.4
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, t 98.39
3sl2_A177 Sensor histidine kinase YYCG; ATP binding, intact 98.39
1b3q_A 379 Protein (chemotaxis protein CHEA); histine kinase, 98.36
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s 98.34
3na3_A 348 DNA mismatch repair protein MLH1; MUTL protein hom 98.31
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, G 98.31
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase doma 98.26
3h4l_A 367 DNA mismatch repair protein PMS1; ATP binding, DNA 98.25
3zxq_A124 Hypoxia sensor histidine kinase response regulato; 98.24
3zxo_A129 Redox sensor histidine kinase response regulator; 98.15
1h7s_A 365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 98.11
1mu5_A 471 Type II DNA topoisomerase VI subunit B; GHKL ATPas 98.09
3fv5_A 201 DNA topoisomerase 4 subunit B; topoisomerase IV B 98.04
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding 98.04
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 97.92
1kij_A 390 DNA gyrase subunit B; topoisomerase, gyrase B-coum 97.76
1s16_A 390 Topoisomerase IV subunit B; two-domain protein com 97.76
1ei1_A 391 DNA gyrase B, GYRB; ATPase domain, dimer, isomeras 97.68
4duh_A 220 DNA gyrase subunit B; structure-based drug design, 97.65
3ttz_A 198 DNA gyrase subunit B; protein-inhibitor complex, A 97.63
3cwv_A 369 DNA gyrase, B subunit, truncated; structural genom 97.59
4emv_A 226 DNA topoisomerase IV, B subunit; protein-inhibitor 97.46
1ixm_A192 SPO0B, protein (sporulation response regulatory pr 97.43
1zxm_A 400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozy 97.22
3lnu_A 408 Topoisomerase IV subunit B; PARE, ATP-binding, nuc 97.07
3ke6_A399 Protein RV1364C/MT1410; anti-sigma factor, anti-si 96.75
1pvg_A 418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA 96.69
4gfh_A 1177 DNA topoisomerase 2; topoisomerase, protein-DNA co 91.67
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structura genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum} Back     alignment and structure
Probab=99.91  E-value=3.6e-25  Score=174.07  Aligned_cols=116  Identities=49%  Similarity=0.678  Sum_probs=87.8

Q ss_pred             Ccccccchhh--hcccccceeEehhhhhhhHHHHhhhhcCcHHHHHHHHHhhHHHHHHHHhhhcccCCC---------C-
Q psy15895          8 NHHYSTQAEA--ASNDNAEKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVM---------P-   75 (124)
Q Consensus         8 ~~~~~~~~~~--~~~~~~e~~~f~~ei~~~l~ll~~~~y~~~~v~l~eLl~NA~dA~~~ik~~~ln~~~---------~-   75 (124)
                      .||.|.-.|.  +.....+++.||+|+.++|++|.+.+|+++.|||||||+||.|||.|+| ..+..++         + 
T Consensus         7 ~~~~~~~~~~~~~~~~~~e~~~Fqae~~~ll~li~~slYs~keiFlRELISNasDA~dK~r-~~l~~~~~~~~~~~~~~~   85 (272)
T 3ied_A            7 HHHHSSGRENLYFQGSPVEKYNFKAEVNKVMDIIVNSLYTDKDVFLRELISNASDACDKKR-IILENNKLIKDAEVVTNE   85 (272)
T ss_dssp             -------CCCCEETTEECEEEECCHHHHHHHHHHHHCTTCCTTHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHCC----
T ss_pred             ccccccchhhhhccccccceechHHHHHHHHHHHHhhcCCCHHHHHHHHHHhhHHHHHHHH-HhccChhhhhcccccccc
Confidence            3455544443  2233458999999999999999999999999999999999999999988 4443110         0 


Q ss_pred             ------------------------CCCCCCCCeEEEEEEEcCCceEEEEEEcCCCCCHHHHHhhccccccCCC
Q psy15895         76 ------------------------FPTDHDHGKLEIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARSGS  124 (124)
Q Consensus        76 ------------------------~eam~~~g~i~I~i~~~~~~~~I~I~DnGiGM~~e~l~~~l~~i~~S~~  124 (124)
                                              +|.....+.++|++..+++..+|+|.|||+||+++++.++|++||+||+
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~l~I~I~~Dk~~~tLtI~DNGiGMTkeeL~~~LgtIA~SGt  158 (272)
T 3ied_A           86 EIKNETEKEKTENVNESTDKKENVEEEKNDIKKLIIKIKPDKEKKTLTITDNGIGMDKSELINNLGTIAQSGT  158 (272)
T ss_dssp             ----------------------------CGGGGCCEEEEEETTTTEEEEEECSCCCCHHHHHHHTTCSCCHHH
T ss_pred             ccccccccccccccccccccccccccccCCCCCcEEEEEEeCCCCEEEEEeCCCCCCHHHHHHHHHHHhhcch
Confidence                                    0111234568899999999999999999999999999999999999984



>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
>3nmq_A Heat shock protein HSP 90-beta; ATPase, chaperone-chaperone inhibitor complex; HET: 7PP; 2.20A {Homo sapiens} SCOP: d.122.1.1 Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>3o0i_A HSP90AA1 protein; HSP90 heat-shock proteins, chaperone-inhibitor complex; HET: P54; 1.47A {Homo sapiens} PDB: 2fwz_A* 2fwy_A* 2h55_A* Back     alignment and structure
>3t0h_A Heat shock protein HSP 90-alpha; chaperone, ATPase; 1.20A {Homo sapiens} SCOP: d.122.1.1 PDB: 3r4m_A 3t0z_A* 3t10_A* 3t1k_A* 3t2s_A* 1uyl_A 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* ... Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 3o2f_A* 2esa_A* Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, ATP-binding, phosphoprotein, stress respo nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2yge_A* 2ygf_A* 2akp_A Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>4ew8_A Sensor protein DIVL; signal transduction, two-component regulatory system, hiska GHKL domain, structural genomics; 2.50A {Caulobacter crescentus} Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transfera; 1.60A {Escherichia coli} SCOP: d.122.1.3 Back     alignment and structure
>4fpp_A Phosphotransferase; four helix bundle, bergerat fold, CCKA, CTRA, CPDR, bacterial cytoplasme; 2.20A {Caulobacter crescentus} PDB: 4fmt_A Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: RED ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozy; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA, NATI project on protein structural and functional analyses; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure
>3sl2_A Sensor histidine kinase YYCG; ATP binding, intact ATP, bergerat fold, TR; HET: ATP; 1.61A {Bacillus subtilis} Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi-domai protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* 3ur1_A Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3zxq_A Hypoxia sensor histidine kinase response regulato; transferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3zxo_A Redox sensor histidine kinase response regulator; transferase; HET: MSE; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex, isomerase; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>4duh_A DNA gyrase subunit B; structure-based drug design, antibacterial, DNA gyrase B, GY isomerase-isomerase inhibitor complex; HET: DNA RLI; 1.50A {Escherichia coli} PDB: 1aj6_A* 1kzn_A* 3g7e_A* Back     alignment and structure
>3ttz_A DNA gyrase subunit B; protein-inhibitor complex, ATP-binding, structure-based drug antimicrobial, isomerase-isomerase inhibitor complex; HET: DNA 07N; 1.63A {Staphylococcus aureus} PDB: 3u2d_A* 3u2k_A* 3g75_A* 3g7b_A* Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, B-subunit binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus} Back     alignment and structure
>4emv_A DNA topoisomerase IV, B subunit; protein-inhibitor complex, ATP binding, structure-based drug antimicrobial, virtual screen; HET: DNA 0R9; 1.70A {Streptococcus pneumoniae GA47373} PDB: 4em7_A* Back     alignment and structure
>1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Back     alignment and structure
>3lnu_A Topoisomerase IV subunit B; PARE, ATP-binding, nucleotide-BI topoisomerase; 2.20A {Xanthomonas oryzae PV} PDB: 3lps_A* Back     alignment and structure
>3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* Back     alignment and structure
>4gfh_A DNA topoisomerase 2; topoisomerase, protein-DNA complex, DNA supercoiling, DNA replication; HET: DNA PTR TSP ANP; 4.41A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 124
d2gqpa1 227 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) 1e-33
d2iwxa1 213 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharo 3e-29
d1uyla_ 208 d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 7e-29
d2hkja3 219 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {A 0.004
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Length = 227 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: Heat shock protein 90, HSP90, N-terminal domain
domain: HSP90
species: Dog (Canis familiaris) [TaxId: 9615]
 Score =  114 bits (287), Expect = 1e-33
 Identities = 47/101 (46%), Positives = 70/101 (69%), Gaps = 3/101 (2%)

Query: 24  EKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFPTDHDHG 83
           EK  FQAE   ++ ++  SLY +KE+F+RELISNASDAL+K+R   L++         + 
Sbjct: 1   EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTD---ENALAGNE 57

Query: 84  KLEIRISTDKQNRILTIQDSGIGMTKEELKSNLGTIARSGS 124
           +L ++I  DK+  +L + D+G+GMT+EEL  NLGTIA+SG+
Sbjct: 58  ELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGT 98


>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 213 Back     information, alignment and structure
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Length = 208 Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Length = 219 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query124
d2gqpa1 227 HSP90 {Dog (Canis familiaris) [TaxId: 9615]} 99.93
d1uyla_ 208 HSP90 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2iwxa1 213 HSP90 {Baker's yeast (Saccharomyces cerevisiae) [T 99.92
d1y8oa2125 Pyruvate dehydrogenase kinase {Human (Homo sapiens 99.04
d1ysra1148 Sensor-type histidine kinase PrrB {Mycobacterium t 98.99
d2c2aa2161 Sensor histidine kinase TM0853 {Thermotoga maritim 98.91
d1bxda_161 Histidine kinase domain of the osmosensor EnvZ {Es 98.88
d1gkza2193 Branched-chain alpha-ketoacid dehydrogenase kinase 98.85
d1id0a_146 Histidine kinase PhoQ domain {Escherichia coli [Ta 98.77
d1jm6a2190 Pyruvate dehydrogenase kinase {Rat (Rattus norvegi 98.75
d1ixma_179 Sporulation response regulatory protein Spo0B {Bac 98.75
d2hkja3 219 Topoisomerase VI-B subunit {Archaeon Sulfolobus sh 98.7
d1r62a_156 Nitrogen regulation protein NtrB, C-terminal domai 98.41
d1h7sa2 203 DNA mismatch repair protein PMS2 {Human (Homo sapi 98.33
d1b63a2 218 DNA mismatch repair protein MutL {Escherichia coli 98.22
d1th8a_139 Anti-sigma factor spoIIab {Bacillus stearothermoph 98.13
d1s14a_ 168 Topoisomerase IV subunit B {Escherichia coli [TaxI 96.23
d1pvga2 239 DNA topoisomerase II {Baker's yeast (Saccharomyces 96.2
d1kija2 212 DNA gyrase B {Thermus thermophilus [TaxId: 274]} 95.58
d1ei1a2 219 DNA gyrase B {Escherichia coli [TaxId: 562]} 94.42
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: Heat shock protein 90, HSP90, N-terminal domain
domain: HSP90
species: Dog (Canis familiaris) [TaxId: 9615]
Probab=99.93  E-value=2.9e-26  Score=175.07  Aligned_cols=98  Identities=48%  Similarity=0.784  Sum_probs=82.2

Q ss_pred             ceeEehhhhhhhHHHHhhhhcCcHHHHHHHHHhhHHHHHHHHhhhcccCCCCCCCCCCCCeEEEEEEEcCCceEEEEEEc
Q psy15895         24 EKHEFQAETRMLLDIVAKSLYSDKEVFIRELISNASDALEKLRYNQLSEVMPFPTDHDHGKLEIRISTDKQNRILTIQDS  103 (124)
Q Consensus        24 e~~~f~~ei~~~l~ll~~~~y~~~~v~l~eLl~NA~dA~~~ik~~~ln~~~~~eam~~~g~i~I~i~~~~~~~~I~I~Dn  103 (124)
                      |++.||+++.++++++.+++|+++.||+|||||||.|||.++|+..+.....   +.....+.|.+..+++..+|+|+||
T Consensus         1 e~~~Fq~e~~~ll~ll~~sLYs~~~iflRELiqNA~DA~~k~r~~~~~~~~~---~~~~~~~~i~i~~d~~~~~l~i~Dn   77 (227)
T d2gqpa1           1 EKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISLTDENA---LAGNEELTVKIKCDKEKNLLHVTDT   77 (227)
T ss_dssp             TEECCCHHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHHHHHHHHHHHHCTTT---TTTCCCCCEEEEEETTTTEEEEEEC
T ss_pred             CceeeehhHHHHHHHHHhcccCCCchhHHHHHhhHHHHHHHHHHHhccCccc---ccccchhhhhcccCCCCcEEEEEec
Confidence            5789999999999999999999999999999999999999998876553321   1335567888888999999999999


Q ss_pred             CCCCCHHHHHhhccccccCCC
Q psy15895        104 GIGMTKEELKSNLGTIARSGS  124 (124)
Q Consensus       104 GiGM~~e~l~~~l~~i~~S~~  124 (124)
                      |+||+++++.++||+||+||+
T Consensus        78 GiGMt~~e~~~~lgtIa~Sgt   98 (227)
T d2gqpa1          78 GVGMTREELVKNLGTIAKSGT   98 (227)
T ss_dssp             SCCCCHHHHHHHHHCC-----
T ss_pred             CccccHHHHHHHHHHHhhcch
Confidence            999999999999999999985



>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Back     information, alignment and structure
>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s14a_ d.122.1.2 (A:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure