Psyllid ID: psy15906
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 352 | ||||||
| 307201523 | 805 | Chloride channel protein 7 [Harpegnathos | 0.903 | 0.395 | 0.515 | 1e-103 | |
| 328785199 | 807 | PREDICTED: H(+)/Cl(-) exchange transport | 0.903 | 0.394 | 0.521 | 1e-102 | |
| 380021098 | 805 | PREDICTED: H(+)/Cl(-) exchange transport | 0.903 | 0.395 | 0.518 | 1e-102 | |
| 340725063 | 803 | PREDICTED: H(+)/Cl(-) exchange transport | 0.903 | 0.396 | 0.498 | 1e-101 | |
| 350398489 | 802 | PREDICTED: H(+)/Cl(-) exchange transport | 0.903 | 0.396 | 0.501 | 1e-101 | |
| 328709438 | 759 | PREDICTED: H(+)/Cl(-) exchange transport | 0.880 | 0.408 | 0.534 | 1e-101 | |
| 383865255 | 806 | PREDICTED: H(+)/Cl(-) exchange transport | 0.903 | 0.394 | 0.507 | 1e-100 | |
| 383865253 | 809 | PREDICTED: H(+)/Cl(-) exchange transport | 0.903 | 0.393 | 0.507 | 1e-100 | |
| 322796366 | 775 | hypothetical protein SINV_06598 [Solenop | 0.903 | 0.410 | 0.512 | 1e-100 | |
| 91089729 | 782 | PREDICTED: similar to chloride channel p | 0.900 | 0.405 | 0.515 | 1e-94 |
| >gi|307201523|gb|EFN81286.1| Chloride channel protein 7 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 380 bits (976), Expect = e-103, Method: Compositional matrix adjust.
Identities = 181/351 (51%), Positives = 243/351 (69%), Gaps = 33/351 (9%)
Query: 1 MIYSIDDCRPLGEDPTEHAVQMYCEDGEYNTLAALWLQVPEKSVRTMLHDPKGAFGVFSL 60
MIY IDDC+PLG+DPT++ VQMYC+ GEYN +A+LW Q PE SVR++ HDPKG+ +L
Sbjct: 425 MIYFIDDCKPLGKDPTKYPVQMYCKSGEYNAVASLWFQTPESSVRSLFHDPKGSHNDMTL 484
Query: 61 SVFVVTYFLLSVWTYGVSVSGGVFIPCLLTGAAWGRLFSLFLQSIFPEATWIDPGKYALI 120
++FVV YF L+ T+G+S+S G+FIP LL G+AWGRL L ++P +DPGKYAL+
Sbjct: 485 AIFVVLYFFLAASTFGLSMSSGLFIPSLLIGSAWGRLIGSGLSKLWPNCVVLDPGKYALL 544
Query: 121 GAAAQLGGVVRMTISLTIILIEATGNISFGLPLMLTLITAKWIGDFFTEGLYDIHIQLSG 180
GAAAQLGGVVRMTISLT ILIEAT ISFGLP+++ LI AKW+GDFF EG+YDIH Q++G
Sbjct: 545 GAAAQLGGVVRMTISLTAILIEATQGISFGLPVIIVLIMAKWVGDFFNEGIYDIHTQMAG 604
Query: 181 IPLLAWDPPPLSSNITARIVKSHPVICLRPLETVGNIIDVLKATSHNGFPIVDVEPMTKH 240
IPL+ W+PPPLSSNI A + SHPV+ LR +E VG+I+++LK + NGFP+VD
Sbjct: 605 IPLIPWEPPPLSSNIYASEIMSHPVVTLRTVENVGHIVELLKCVTFNGFPVVD------- 657
Query: 241 SSDGAEQSSAGSTDSHKGDTSHKRDSSHKGDASRKDSPGRLVGLILRSQLIILIKHKIYK 300
D S ++ GR GLILRSQLI+L+++KI+
Sbjct: 658 --------------------------PPSSDQSEINTYGRFRGLILRSQLIVLLQNKIFN 691
Query: 301 ENQNWPDDQLSSEIFHAEYPRYPSVNDLVVSENDRSFTVKLNLFMNTSPFS 351
E + D L +IF EYPRYP++ +VV+E ++++T+ L FMN +P++
Sbjct: 692 EYAEFWDKSLDIKIFRKEYPRYPTIEQVVVTEEEKTYTIDLRHFMNPAPYT 742
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328785199|ref|XP_396520.3| PREDICTED: H(+)/Cl(-) exchange transporter 7 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380021098|ref|XP_003694411.1| PREDICTED: H(+)/Cl(-) exchange transporter 7-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340725063|ref|XP_003400894.1| PREDICTED: H(+)/Cl(-) exchange transporter 7-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350398489|ref|XP_003485207.1| PREDICTED: H(+)/Cl(-) exchange transporter 7-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|328709438|ref|XP_001952257.2| PREDICTED: H(+)/Cl(-) exchange transporter 7-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|383865255|ref|XP_003708090.1| PREDICTED: H(+)/Cl(-) exchange transporter 7-like isoform 2 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|383865253|ref|XP_003708089.1| PREDICTED: H(+)/Cl(-) exchange transporter 7-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|322796366|gb|EFZ18907.1| hypothetical protein SINV_06598 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|91089729|ref|XP_975072.1| PREDICTED: similar to chloride channel protein 7 [Tribolium castaneum] gi|270011308|gb|EFA07756.1| hypothetical protein TcasGA2_TC005310 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 352 | ||||||
| ZFIN|ZDB-GENE-061103-196 | 795 | clcn7 "chloride channel 7" [Da | 0.659 | 0.291 | 0.576 | 1.5e-87 | |
| FB|FBgn0033755 | 813 | ClC-b "Chloride channel-b" [Dr | 0.661 | 0.286 | 0.538 | 1.9e-83 | |
| WB|WBGene00000533 | 796 | clh-6 [Caenorhabditis elegans | 0.659 | 0.291 | 0.557 | 2.8e-78 | |
| UNIPROTKB|F1NS73 | 802 | CLCN7 "Uncharacterized protein | 0.676 | 0.296 | 0.537 | 1.1e-71 | |
| UNIPROTKB|F1RG09 | 809 | LOC100626534 "Uncharacterized | 0.661 | 0.288 | 0.561 | 3.7e-71 | |
| MGI|MGI:1347048 | 803 | Clcn7 "chloride channel 7" [Mu | 0.661 | 0.290 | 0.553 | 2.1e-70 | |
| UNIPROTKB|E2R0Q0 | 747 | CLCN7 "Uncharacterized protein | 0.664 | 0.313 | 0.546 | 2.1e-70 | |
| UNIPROTKB|H0Y2M6 | 901 | CLCN7 "Chloride channel 7, iso | 0.661 | 0.258 | 0.553 | 2.6e-70 | |
| UNIPROTKB|P51798 | 805 | CLCN7 "H(+)/Cl(-) exchange tra | 0.661 | 0.289 | 0.553 | 2.6e-70 | |
| RGD|61836 | 803 | Clcn7 "chloride channel, volta | 0.661 | 0.290 | 0.548 | 3.3e-70 |
| ZFIN|ZDB-GENE-061103-196 clcn7 "chloride channel 7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 735 (263.8 bits), Expect = 1.5e-87, Sum P(2) = 1.5e-87
Identities = 136/236 (57%), Positives = 175/236 (74%)
Query: 1 MIYSIDDCRPLGEDPTE-HAVQMYCEDGEYNTLAALWLQVPEKSVRTMLHDPKGAFGVFS 59
MIY +C+PLG D TE + +Q++C DGEYN +A + PE+SVR++ H+P G + +
Sbjct: 418 MIYFSTECQPLGPDHTEEYPLQLFCADGEYNAMATAFFNTPERSVRSLFHNPPGTYNPMT 477
Query: 60 LSVFVVTYFLLSVWTYGVSVSGGVFIPCLLTGAAWGRLFSLFLQSIFP-EATWIDPGKYA 118
L VF + YFLL+VWTYG++VS GVFIP LL GAAWGRLF + L I ++ W DPGKYA
Sbjct: 478 LGVFTLAYFLLAVWTYGLTVSAGVFIPSLLIGAAWGRLFGILLSFITTSKSIWADPGKYA 537
Query: 119 LIGAAAQLGGVVRMTISLTIILIEATGNISFGLPLMLTLITAKWIGDFFTEGLYDIHIQL 178
LIGAAAQLGG+VRMT+SLT+IL+EATGN+++G P+ML L+TAK +GD+F EGLYDIHI+L
Sbjct: 538 LIGAAAQLGGIVRMTLSLTVILVEATGNVTYGFPIMLVLMTAKIVGDYFVEGLYDIHIKL 597
Query: 179 SGIPLLAWDPPPLSSNITARIVKSHPVICLRPLETVGNIIDVLKATS--HNGFPIV 232
+P L W+ PP S +TAR V S V C +E VG I+DVL TS HNGFP+V
Sbjct: 598 QSVPFLHWEAPPTSHWLTAREVMSSQVTCFNRIEKVGTIVDVLSNTSTNHNGFPVV 653
|
|
| FB|FBgn0033755 ClC-b "Chloride channel-b" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000533 clh-6 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NS73 CLCN7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RG09 LOC100626534 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1347048 Clcn7 "chloride channel 7" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R0Q0 CLCN7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0Y2M6 CLCN7 "Chloride channel 7, isoform CRA_c" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P51798 CLCN7 "H(+)/Cl(-) exchange transporter 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|61836 Clcn7 "chloride channel, voltage-sensitive 7" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 352 | |||
| cd03685 | 466 | cd03685, ClC_6_like, ClC-6-like chloride channel p | 3e-63 | |
| cd01036 | 416 | cd01036, ClC_euk, Chloride channel, ClC | 5e-38 | |
| cd03684 | 445 | cd03684, ClC_3_like, ClC-3-like chloride channel p | 2e-31 | |
| pfam00654 | 345 | pfam00654, Voltage_CLC, Voltage gated chloride cha | 1e-28 | |
| cd03683 | 426 | cd03683, ClC_1_like, ClC-1-like chloride channel p | 4e-24 | |
| cd00400 | 383 | cd00400, Voltage_gated_ClC, CLC voltage-gated chlo | 1e-16 | |
| COG0038 | 443 | COG0038, EriC, Chloride channel protein EriC [Inor | 4e-16 | |
| cd01031 | 402 | cd01031, EriC, ClC chloride channel EriC | 8e-13 | |
| PRK05277 | 438 | PRK05277, PRK05277, chloride channel protein; Prov | 8e-11 | |
| PRK01862 | 574 | PRK01862, PRK01862, putative voltage-gated ClC-typ | 3e-09 | |
| cd01034 | 390 | cd01034, EriC_like, ClC chloride channel family | 1e-08 | |
| cd04591 | 105 | cd04591, CBS_pair_EriC_assoc_euk_bac, This cd cont | 2e-05 | |
| cd01033 | 388 | cd01033, ClC_like, Putative ClC chloride channel | 0.003 |
| >gnl|CDD|239657 cd03685, ClC_6_like, ClC-6-like chloride channel proteins | Back alignment and domain information |
|---|
Score = 208 bits (531), Expect = 3e-63
Identities = 71/126 (56%), Positives = 96/126 (76%), Gaps = 1/126 (0%)
Query: 59 SLSVFVVTYFLLSVWTYGVSVSGGVFIPCLLTGAAWGRLFSLFLQSIFPEATWIDPGKYA 118
+L +F V Y+ L+ WT+G++V G+FIP +L GAA+GRL + L S F T IDPG YA
Sbjct: 335 TLLIFFVLYYFLACWTFGIAVPSGLFIPMILIGAAYGRLVGILLGSYF-GFTSIDPGLYA 393
Query: 119 LIGAAAQLGGVVRMTISLTIILIEATGNISFGLPLMLTLITAKWIGDFFTEGLYDIHIQL 178
L+GAAA LGGV+RMT+SLT+IL+E T N+++ P+ML L+ AKW+GD+F EG+YDI IQL
Sbjct: 394 LLGAAAFLGGVMRMTVSLTVILLELTNNLTYLPPIMLVLMIAKWVGDYFNEGIYDIIIQL 453
Query: 179 SGIPLL 184
G+P L
Sbjct: 454 KGVPFL 459
|
This CD includes ClC-6, ClC-7 and ClC-B, C, D in plants. Proteins in this family are ubiquitous in eukarotes and their functions are unclear. They are expressed in intracellular organelles membranes. This family belongs to the ClC superfamily of chloride ion channels, which share the unique double-barreled architecture and voltage-dependent gating mechanism. The gating is conferred by the permeating anion itself, acting as the gating charge. ClC chloride ion channel superfamily perform a variety of functions including cellular excitability regulation, cell volume regulation, membrane potential stabilization, acidification of intracellular organelles, signal transduction, and transepithelial transport in animals. Length = 466 |
| >gnl|CDD|238507 cd01036, ClC_euk, Chloride channel, ClC | Back alignment and domain information |
|---|
| >gnl|CDD|239656 cd03684, ClC_3_like, ClC-3-like chloride channel proteins | Back alignment and domain information |
|---|
| >gnl|CDD|216046 pfam00654, Voltage_CLC, Voltage gated chloride channel | Back alignment and domain information |
|---|
| >gnl|CDD|239655 cd03683, ClC_1_like, ClC-1-like chloride channel proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238233 cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel | Back alignment and domain information |
|---|
| >gnl|CDD|223116 COG0038, EriC, Chloride channel protein EriC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238504 cd01031, EriC, ClC chloride channel EriC | Back alignment and domain information |
|---|
| >gnl|CDD|235385 PRK05277, PRK05277, chloride channel protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234987 PRK01862, PRK01862, putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238506 cd01034, EriC_like, ClC chloride channel family | Back alignment and domain information |
|---|
| >gnl|CDD|239964 cd04591, CBS_pair_EriC_assoc_euk_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >gnl|CDD|238505 cd01033, ClC_like, Putative ClC chloride channel | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 352 | |||
| KOG0474|consensus | 762 | 100.0 | ||
| KOG0475|consensus | 696 | 100.0 | ||
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 100.0 | |
| KOG0476|consensus | 931 | 100.0 | ||
| cd03685 | 466 | ClC_6_like ClC-6-like chloride channel proteins. T | 99.95 | |
| cd03684 | 445 | ClC_3_like ClC-3-like chloride channel proteins. T | 99.95 | |
| cd03683 | 426 | ClC_1_like ClC-1-like chloride channel proteins. T | 99.93 | |
| cd01031 | 402 | EriC ClC chloride channel EriC. This domain is fou | 99.93 | |
| PRK01610 | 418 | putative voltage-gated ClC-type chloride channel C | 99.93 | |
| PRK05277 | 438 | chloride channel protein; Provisional | 99.92 | |
| cd01036 | 416 | ClC_euk Chloride channel, ClC. These domains are f | 99.91 | |
| PF00654 | 355 | Voltage_CLC: Voltage gated chloride channel Mutati | 99.91 | |
| COG0038 | 443 | EriC Chloride channel protein EriC [Inorganic ion | 99.9 | |
| cd01033 | 388 | ClC_like Putative ClC chloride channel. Clc protei | 99.89 | |
| cd01034 | 390 | EriC_like ClC chloride channel family. These prote | 99.87 | |
| cd00400 | 383 | Voltage_gated_ClC CLC voltage-gated chloride chann | 99.83 | |
| cd03682 | 378 | ClC_sycA_like ClC sycA-like chloride channel prote | 99.81 | |
| PRK03655 | 414 | putative ion channel protein; Provisional | 99.73 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.44 | |
| cd00400 | 383 | Voltage_gated_ClC CLC voltage-gated chloride chann | 99.34 | |
| cd01031 | 402 | EriC ClC chloride channel EriC. This domain is fou | 99.32 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.19 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.17 | |
| PRK05277 | 438 | chloride channel protein; Provisional | 99.12 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.04 | |
| cd03682 | 378 | ClC_sycA_like ClC sycA-like chloride channel prote | 98.99 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.98 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 98.87 | |
| PF00654 | 355 | Voltage_CLC: Voltage gated chloride channel Mutati | 98.84 | |
| COG0038 | 443 | EriC Chloride channel protein EriC [Inorganic ion | 98.84 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 98.83 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 98.76 | |
| cd03685 | 466 | ClC_6_like ClC-6-like chloride channel proteins. T | 98.68 | |
| PRK01610 | 418 | putative voltage-gated ClC-type chloride channel C | 98.66 | |
| cd03684 | 445 | ClC_3_like ClC-3-like chloride channel proteins. T | 98.64 | |
| cd01036 | 416 | ClC_euk Chloride channel, ClC. These domains are f | 98.63 | |
| cd01033 | 388 | ClC_like Putative ClC chloride channel. Clc protei | 98.62 | |
| cd01034 | 390 | EriC_like ClC chloride channel family. These prote | 98.6 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 98.5 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 98.38 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 98.31 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 98.3 | |
| cd03683 | 426 | ClC_1_like ClC-1-like chloride channel proteins. T | 98.28 | |
| PRK03655 | 414 | putative ion channel protein; Provisional | 98.24 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 98.22 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 98.21 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 98.21 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 98.04 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 98.04 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 98.03 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 98.01 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 98.0 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 97.98 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 97.98 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 97.98 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 97.92 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 97.89 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 97.89 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 97.89 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 97.89 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 97.88 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 97.88 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 97.88 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 97.85 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 97.85 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 97.84 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 97.83 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 97.82 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 97.82 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 97.82 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 97.82 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 97.81 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 97.81 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 97.81 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 97.8 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 97.8 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 97.79 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 97.79 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 97.79 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 97.79 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 97.78 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 97.77 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 97.77 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 97.76 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 97.75 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 97.75 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 97.74 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 97.74 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 97.74 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 97.72 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 97.7 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 97.69 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 97.69 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 97.69 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 97.68 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 97.67 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 97.67 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 97.67 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 97.66 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.65 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 97.65 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 97.63 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 97.62 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 97.61 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 97.61 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 97.6 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 97.6 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 97.59 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 97.58 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 97.58 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 97.56 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 97.55 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 97.55 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 97.53 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 97.52 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 97.52 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 97.51 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 97.49 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 97.45 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 97.43 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 97.43 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 97.43 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 97.41 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 97.4 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 97.4 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 97.37 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 97.36 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 97.34 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 97.33 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 97.31 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 97.31 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 97.3 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 97.28 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 97.26 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 97.23 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 97.23 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 97.2 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 97.17 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 97.17 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 97.16 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 97.16 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 97.16 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 97.14 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 97.14 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 97.14 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 97.13 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 97.12 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 97.1 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 97.1 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 97.09 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 97.07 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 97.06 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 97.04 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 97.04 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 97.03 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 97.01 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 96.98 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 96.96 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 96.96 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 96.95 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 96.94 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 96.92 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 96.9 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 96.8 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 96.78 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 96.77 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 96.76 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 96.73 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 96.73 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 96.7 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 96.69 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 96.65 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 96.6 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 96.59 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 96.58 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 96.57 | |
| KOG2550|consensus | 503 | 96.57 | ||
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 96.57 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 96.56 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 96.55 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 96.53 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 96.52 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 96.5 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 96.41 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 96.34 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 96.34 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 96.31 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 96.3 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 96.18 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 96.16 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 96.14 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 96.0 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 95.98 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 95.8 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 95.54 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 95.46 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 95.28 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 94.67 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 94.55 | |
| KOG0474|consensus | 762 | 94.5 | ||
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 94.03 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 93.58 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 93.57 | |
| KOG1764|consensus | 381 | 92.72 | ||
| KOG1764|consensus | 381 | 92.11 | ||
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 91.92 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 91.66 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 91.55 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 91.28 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 90.64 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 90.64 | |
| KOG2550|consensus | 503 | 90.5 | ||
| PRK11573 | 413 | hypothetical protein; Provisional | 90.22 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 90.19 | |
| KOG0475|consensus | 696 | 86.99 | ||
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 86.32 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 85.92 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 84.53 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 80.63 |
| >KOG0474|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.5e-72 Score=556.23 Aligned_cols=306 Identities=47% Similarity=0.856 Sum_probs=282.6
Q ss_pred ccCCCccCCCCCcc-ccEEEEcCCCchhhHHHHhccCcHHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHHhcCCccc
Q psy15906 4 SIDDCRPLGEDPTE-HAVQMYCEDGEYNTLAALWLQVPEKSVRTMLHDPKGAFGVFSLSVFVVTYFLLSVWTYGVSVSGG 82 (352)
Q Consensus 4 ~~~~c~~~~~~~~~-~~~~~~c~~g~y~~~~~l~~~~~~~~i~~l~~~~~~~~~~~~l~~~~~~k~~~t~~t~g~g~~gG 82 (352)
++++|||||.++++ .-.+|+|++|+||++|+|||+++++++++|||++.++|...+|++|++.+++++++|||+.+|+|
T Consensus 395 ~l~~C~P~~~~~~~~~~p~f~Cp~~~YNdlAtL~fnt~ddaVrnLFh~~~~ef~~~tL~iFfv~yf~L~~~TfGi~vpsG 474 (762)
T KOG0474|consen 395 FLADCQPCPPSITEGQCPTFFCPDGEYNDLATLFFNTNDDAVRNLFHSPTNEFGILTLAIFFVLYFFLACWTFGIAVPSG 474 (762)
T ss_pred HHhcCCCCCCCcccccCccccCCCCchhHHHHHHcCCcHHHHHHHhcCCCCccchhHHHHHHHHHHHHHHHHhccccccc
Confidence 78999999988765 44468999999999999999999999999999988999999999999999999999999999999
Q ss_pred cchhHHHHHHHHHHHHHHHHHHhcCCCCcCChhHHHHHHHHHHHHhhhchhHHHHHHHHHhhCCchhhHHHHHHHHHHHH
Q psy15906 83 VFIPCLLTGAAWGRLFSLFLQSIFPEATWIDPGKYALIGAAAQLGGVVRMTISLTIILIEATGNISFGLPLMLTLITAKW 162 (352)
Q Consensus 83 ~f~P~l~iGa~~G~~~g~~~~~~~p~~~~~~~~~~alvG~aa~l~g~~r~pls~~vi~~ElTg~~~~~lp~m~~~~~a~~ 162 (352)
+|+|++++||++||++|.++..++ +++||.||++||||++||++|||+|.+||++|+| +..+++|+|++.++|||
T Consensus 475 lFiP~iL~GAa~GRlvg~~l~~~~----~id~G~yAllGAAa~LGG~mRMTvSL~VIl~E~T-n~~~~lPiMlvLliaK~ 549 (762)
T KOG0474|consen 475 LFIPVILTGAAYGRLVGMLLGSYT----NIDPGLYALLGAAAFLGGVMRMTVSLCVILLELT-NNLLLLPIMLVLLIAKT 549 (762)
T ss_pred chhHHHHhhHHHHHHHHHHHHHhh----ccCchHHHHHhHHHHhCCeEEEEeeeehHHHHhh-hhhhhhHHHHHHHHHHH
Confidence 999999999999999999998876 3899999999999999999999999999999999 67899999999999999
Q ss_pred HHhhcCCchhHHHHHHcCCCCCCCCCCCCCcccccccccccCeEEecCCCCHHHHHHHHHhCCCCeEEEEeCCCCccccC
Q psy15906 163 IGDFFTEGLYDIHIQLSGIPLLAWDPPPLSSNITARIVKSHPVICLRPLETVGNIIDVLKATSHNGFPIVDVEPMTKHSS 242 (352)
Q Consensus 163 v~~~~~~~iy~~~l~~~g~p~l~~~~~~~l~~i~V~dIM~~~vv~l~~~~tV~e~~~~L~~t~~~~fPVVd~~~~~~~~~ 242 (352)
|+|.||++|||.++++||+|+++|++++.+++++|+|+|++++++++..++++.++++|++++||+|||||+.+.
T Consensus 550 VGD~FNegiYd~~i~LkgvP~Le~~pe~~mr~L~a~ev~~~pvi~l~~~ekV~~Iv~vLk~t~HngFPVvd~~~~----- 624 (762)
T KOG0474|consen 550 VGDSFNEGIYDIIIQLKGVPFLEWEPEPYMRNLTAGEVMSKPVICLNRVEKVAVIVDVLKSTNHNGFPVVDEPPS----- 624 (762)
T ss_pred HHhhhhhhhHHHhhhccCCccccCCCchHhhhhhHhhhccCCeEEEechhhHHHHHHHHHhcCcCCCccccCCCC-----
Confidence 999999999999999999999999999999999999999999999999999999999999999999999998611
Q ss_pred CcccccCCCCCCcccCCCCCcccCCCCCCCCcCCCCCeEEEEEeHHHHHHHHHhhhcccCCC--CCCCCcCHHHHhhhCC
Q psy15906 243 DGAEQSSAGSTDSHKGDTSHKRDSSHKGDASRKDSPGRLVGLILRSQLIILIKHKIYKENQN--WPDDQLSSEIFHAEYP 320 (352)
Q Consensus 243 d~~~~~~~~~~~~~~~m~~~~~~~~~~~~~~~l~~~g~lvGiItRsdLi~~L~~~~~~~~~~--~~~~~~~~~~~~~~~~ 320 (352)
++.++++|+|.|+||++.|+++.|.+++. .+....+...+++.|+
T Consensus 625 ---------------------------------~~~~~l~GlILRshl~vlL~~~~f~~~~~~~~~~~~~~~~~~~d~a~ 671 (762)
T KOG0474|consen 625 ---------------------------------NEAGRLHGLILRSHLLVLLKKRVFVEESRSTFDLPVRRKFTFRDFAK 671 (762)
T ss_pred ---------------------------------ccchhhhHHHHHHHHHHHHHhhhhhccCccccCcchhhcCCHHHhhh
Confidence 12368999999999999999999987654 2221223456778899
Q ss_pred CCCCcccccCCccccCCcccccccccCCCCCC
Q psy15906 321 RYPSVNDLVVSENDRSFTVKLNLFMNTSPFSE 352 (352)
Q Consensus 321 ~~p~i~~~~~~~~~~~~~~dl~p~~n~sp~t~ 352 (352)
|.|+|+|++++++|+++|+||.||||+||||+
T Consensus 672 r~~~i~dv~lt~~e~~~yvDl~p~~n~sPytV 703 (762)
T KOG0474|consen 672 REPSIEDVHLTSEEMEMYVDLHPFMNPSPYTV 703 (762)
T ss_pred cCCchhhhhcchHhHhhccccccccCCCCccc
Confidence 99999999999999999999999999999985
|
|
| >KOG0475|consensus | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >KOG0476|consensus | Back alignment and domain information |
|---|
| >cd03685 ClC_6_like ClC-6-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd03684 ClC_3_like ClC-3-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd03683 ClC_1_like ClC-1-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd01031 EriC ClC chloride channel EriC | Back alignment and domain information |
|---|
| >PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >PRK05277 chloride channel protein; Provisional | Back alignment and domain information |
|---|
| >cd01036 ClC_euk Chloride channel, ClC | Back alignment and domain information |
|---|
| >PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease | Back alignment and domain information |
|---|
| >COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01033 ClC_like Putative ClC chloride channel | Back alignment and domain information |
|---|
| >cd01034 EriC_like ClC chloride channel family | Back alignment and domain information |
|---|
| >cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel | Back alignment and domain information |
|---|
| >cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins | Back alignment and domain information |
|---|
| >PRK03655 putative ion channel protein; Provisional | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel | Back alignment and domain information |
|---|
| >cd01031 EriC ClC chloride channel EriC | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK05277 chloride channel protein; Provisional | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease | Back alignment and domain information |
|---|
| >COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd03685 ClC_6_like ClC-6-like chloride channel proteins | Back alignment and domain information |
|---|
| >PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd03684 ClC_3_like ClC-3-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd01036 ClC_euk Chloride channel, ClC | Back alignment and domain information |
|---|
| >cd01033 ClC_like Putative ClC chloride channel | Back alignment and domain information |
|---|
| >cd01034 EriC_like ClC chloride channel family | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd03683 ClC_1_like ClC-1-like chloride channel proteins | Back alignment and domain information |
|---|
| >PRK03655 putative ion channel protein; Provisional | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >KOG2550|consensus | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0474|consensus | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >KOG1764|consensus | Back alignment and domain information |
|---|
| >KOG1764|consensus | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2550|consensus | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >KOG0475|consensus | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 352 | ||||
| 3org_A | 632 | Crystal Structure Of A Eukaryotic Clc Transporter L | 1e-15 | ||
| 2ht2_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 3e-05 | ||
| 3ejy_A | 473 | Structure Of E203h Mutant Of E.Coli Cl-H+ ANTIPORTE | 3e-05 | ||
| 2htk_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 3e-05 | ||
| 1kpk_A | 473 | Crystal Structure Of The Clc Chloride Channel From | 3e-05 | ||
| 2ht3_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 3e-05 | ||
| 2exy_A | 473 | Crystal Structure Of The E148q Mutant Of Ecclc, Fab | 3e-05 | ||
| 2ez0_A | 473 | Crystal Structure Of The S107aE148QY445A MUTANT OF | 4e-05 | ||
| 2htl_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 4e-05 | ||
| 3det_A | 473 | Structure Of The E418a, Y445a Doubly Ungated Mutant | 4e-05 | ||
| 3ejz_A | 473 | Structure Of E203v Mutant E.Coli Cl-H+ EXCHANGER, C | 4e-05 | ||
| 2ht4_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 4e-05 | ||
| 1ots_A | 465 | Structure Of The Escherichia Coli Clc Chloride Chan | 4e-05 | ||
| 3nmo_A | 465 | Crystal Structure Of An Engineered Monomeric Clc-Ec | 4e-05 | ||
| 2fec_A | 465 | Structure Of The E203q Mutant Of The Cl-H+ EXCHANGE | 4e-05 | ||
| 1otu_A | 465 | Structure Of The Escherichia Coli Clc Chloride Chan | 4e-05 | ||
| 1ott_A | 465 | Structure Of The Escherichia Coli Clc Chloride Chan | 5e-05 | ||
| 4ftp_A | 465 | Structure Of The E202y Mutant Of The Cl-H+ ANTIPORT | 5e-05 | ||
| 1kpl_A | 473 | Crystal Structure Of The Clc Chloride Channel From | 5e-05 | ||
| 2hlf_A | 444 | Structure Of The Escherichis Coli Clc Chloride Chan | 6e-05 | ||
| 4ene_A | 446 | Structure Of The N- And C-Terminal Trimmed Clc-Ec1 | 6e-05 | ||
| 2r9h_A | 444 | Crystal Structure Of Q207c Mutant Of Clc-Ec1 In Com | 6e-05 | ||
| 3nd0_A | 466 | X-Ray Crystal Structure Of A Slow Cyanobacterial Cl | 4e-04 |
| >pdb|3ORG|A Chain A, Crystal Structure Of A Eukaryotic Clc Transporter Length = 632 | Back alignment and structure |
|
| >pdb|2HT2|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445h Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|3EJY|A Chain A, Structure Of E203h Mutant Of E.Coli Cl-H+ ANTIPORTER, CLC- Ec1 Length = 473 | Back alignment and structure |
| >pdb|2HTK|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445a Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|1KPK|A Chain A, Crystal Structure Of The Clc Chloride Channel From E. Coli Length = 473 | Back alignment and structure |
| >pdb|2HT3|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445l Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|2EXY|A Chain A, Crystal Structure Of The E148q Mutant Of Ecclc, Fab Complexed In Absence Of Bound Ions Length = 473 | Back alignment and structure |
| >pdb|2EZ0|A Chain A, Crystal Structure Of The S107aE148QY445A MUTANT OF ECCLC, In Complex With A Fab Fragment Length = 473 | Back alignment and structure |
| >pdb|2HTL|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445f Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|3DET|A Chain A, Structure Of The E418a, Y445a Doubly Ungated Mutant Of E.Coli Clc_ec1, Cl-H+ ANTIPORTER Length = 473 | Back alignment and structure |
| >pdb|3EJZ|A Chain A, Structure Of E203v Mutant E.Coli Cl-H+ EXCHANGER, CLC-Ec1 Length = 473 | Back alignment and structure |
| >pdb|2HT4|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445w Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|1OTS|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel And Fab Complex Length = 465 | Back alignment and structure |
| >pdb|3NMO|A Chain A, Crystal Structure Of An Engineered Monomeric Clc-Ec1 Cl-H+ Transporter Length = 465 | Back alignment and structure |
| >pdb|2FEC|A Chain A, Structure Of The E203q Mutant Of The Cl-H+ EXCHANGER CLC- Ec1 From E.Coli Length = 465 | Back alignment and structure |
| >pdb|1OTU|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel E148q Mutant And Fab Complex Length = 465 | Back alignment and structure |
| >pdb|1OTT|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel E148a Mutant And Fab Complex Length = 465 | Back alignment and structure |
| >pdb|4FTP|A Chain A, Structure Of The E202y Mutant Of The Cl-H+ ANTIPORTER CLC-Ec1 From E.Coli Length = 465 | Back alignment and structure |
| >pdb|1KPL|A Chain A, Crystal Structure Of The Clc Chloride Channel From S. Typhimurium Length = 473 | Back alignment and structure |
| >pdb|2HLF|A Chain A, Structure Of The Escherichis Coli Clc Chloride Channel Y445e Mutant And Fab Complex Length = 444 | Back alignment and structure |
| >pdb|4ENE|A Chain A, Structure Of The N- And C-Terminal Trimmed Clc-Ec1 Cl-H+ ANTIPORTER And Fab Complex Length = 446 | Back alignment and structure |
| >pdb|2R9H|A Chain A, Crystal Structure Of Q207c Mutant Of Clc-Ec1 In Complex With Fab Length = 444 | Back alignment and structure |
| >pdb|3ND0|A Chain A, X-Ray Crystal Structure Of A Slow Cyanobacterial Cl-H+ ANTIPORTER Length = 466 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 352 | |||
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 3e-64 | |
| 1ots_A | 465 | Voltage-gated CLC-type chloride channel ERIC; CLC | 3e-19 | |
| 3nd0_A | 466 | SLL0855 protein; CLC family CL-/H+ antiporter, CLC | 1e-18 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 3e-08 |
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Length = 632 | Back alignment and structure |
|---|
Score = 214 bits (546), Expect = 3e-64
Identities = 68/313 (21%), Positives = 121/313 (38%), Gaps = 60/313 (19%)
Query: 53 GAFGVFSLSVFVVTYFLLSVWTYGVSVSGGVFIPCLLTGAAWGRLFSLFLQSIFPEATWI 112
FG L + + F+L + G+ + GVF+P L GA +GRL+ ++ +F A I
Sbjct: 314 DHFGWTELILMPIIKFILVALSIGLPLPAGVFVPSFLIGAGFGRLYGELMRVVFGNA--I 371
Query: 113 DPGKYALIGAAAQLGGVVRMTISLTIILIEATGNISFGLPLMLTLITAKWIGDFFTEGLY 172
PG YA++GAAA GV R +S +I+ E TG I +P++++++ A +G+ F LY
Sbjct: 372 VPGSYAVVGAAAFTAGVTR-ALSCAVIIFEVTGQIRHLVPVLISVLLAVIVGNAFNRSLY 430
Query: 173 DIHIQLSGIPLLAWDPPPLSSNITARIV--KSHPVICLRPLETVGNIIDVL-KATSHNGF 229
+ + + +P + S +TAR + L P +I +L K + F
Sbjct: 431 ETLVLMKHLPYMPILRRDRSPEMTAREIMHPIEGEPHLFPDSEPQHIKGILEKFPNRLVF 490
Query: 230 PIVDVEPMTKHSSDGAEQSSAGSTDSHKGDTSHKRDSSHKGDASRKDSPGRLVGLILRSQ 289
P++ D+ G L+G I R +
Sbjct: 491 PVI-------------------------------------------DANGYLLGAISRKE 507
Query: 290 LIILIKHKIYKENQNWPDDQ-----------LSSEIFHAEYPRYPSVNDLVVSENDRSFT 338
++ ++H + + + + E E P + + T
Sbjct: 508 IVDRLQHVLEDVPEPIAGHRTLVLLDAADLSENIEGLVDETPSGEHSSKGKRTATVLEPT 567
Query: 339 VKLNLFMNTSPFS 351
L + + SP
Sbjct: 568 SSLVVPCDVSPIV 580
|
| >1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... Length = 465 | Back alignment and structure |
|---|
| >3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A Length = 466 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 352 | |||
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 100.0 | |
| 4ene_A | 446 | CLC-EC1, H(+)/CL(-) exchange transporter CLCA; mem | 99.95 | |
| 1ots_A | 465 | Voltage-gated CLC-type chloride channel ERIC; CLC | 99.95 | |
| 3nd0_A | 466 | SLL0855 protein; CLC family CL-/H+ antiporter, CLC | 99.95 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.54 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.24 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.03 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.02 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 98.96 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 98.95 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 98.94 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 98.93 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 98.92 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 98.91 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 98.88 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 98.88 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 98.87 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 98.87 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 98.86 | |
| 1ots_A | 465 | Voltage-gated CLC-type chloride channel ERIC; CLC | 98.86 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 98.86 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 98.86 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 98.86 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 98.85 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 98.84 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 98.82 | |
| 3nd0_A | 466 | SLL0855 protein; CLC family CL-/H+ antiporter, CLC | 98.81 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 98.8 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 98.8 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 98.79 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 98.78 | |
| 4ene_A | 446 | CLC-EC1, H(+)/CL(-) exchange transporter CLCA; mem | 98.77 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 98.77 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 98.76 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 98.76 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 98.74 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 98.72 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 98.71 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 98.71 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 98.7 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 98.68 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 98.65 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 98.63 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 98.61 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 98.57 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 98.56 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 98.54 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 98.53 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 98.47 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 98.47 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 98.46 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 98.44 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 98.41 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 98.4 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.39 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 98.39 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 98.35 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.34 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 98.34 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 98.33 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 98.33 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 98.32 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 98.26 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 98.24 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 98.22 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.21 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.18 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 98.17 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 98.16 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 98.15 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 98.15 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 98.14 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 98.12 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 98.12 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 98.09 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 98.09 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 98.08 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 98.06 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 98.03 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 97.97 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 97.92 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 97.84 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 97.84 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 97.76 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 97.75 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 97.74 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 96.57 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 95.74 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 95.65 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 95.6 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 95.56 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 95.5 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 95.46 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 95.45 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 95.43 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 95.39 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 95.37 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 95.36 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 95.36 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 95.3 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 95.29 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 95.29 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 95.21 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 95.17 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 95.13 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 95.11 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 94.87 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 94.79 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 94.69 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 94.68 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 94.66 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 94.55 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 94.47 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 94.29 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 94.08 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 94.0 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 93.69 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 93.53 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 93.25 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 93.13 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 93.06 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 90.69 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 90.61 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 90.27 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 89.53 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 88.74 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 87.14 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 87.12 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 85.02 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 84.83 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 84.14 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 83.04 |
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
Probab=100.00 E-value=5e-43 Score=365.21 Aligned_cols=254 Identities=24% Similarity=0.390 Sum_probs=208.8
Q ss_pred cHHHHHHHhcCCC----CchhHHHHHHHHHHHHHHHHHHHhcCCccccchhHHHHHHHHHHHHHHHHHHhcCCCCcCChh
Q psy15906 40 PEKSVRTMLHDPK----GAFGVFSLSVFVVTYFLLSVWTYGVSVSGGVFIPCLLTGAAWGRLFSLFLQSIFPEATWIDPG 115 (352)
Q Consensus 40 ~~~~i~~l~~~~~----~~~~~~~l~~~~~~k~~~t~~t~g~g~~gG~f~P~l~iGa~~G~~~g~~~~~~~p~~~~~~~~ 115 (352)
+++.++.+|++.. +.+.+..+++++++|+++|++|+|+|+|||+|+|+|++||++|+++|.+++.++|.. .+|+
T Consensus 297 ~~~~i~~l~~~~~~~~~~~~~~~~l~~~~~~k~~~t~~s~g~g~pGGif~P~l~iGA~~G~~~g~~~~~~~p~~--~~p~ 374 (632)
T 3org_A 297 PRATINDLFKAVPLYQTDHFGWTELILMPIIKFILVALSIGLPLPAGVFVPSFLIGAGFGRLYGELMRVVFGNA--IVPG 374 (632)
T ss_dssp CHHHHHHHHSCC----------CCSSHHHHHHHHHHHHHTTSSSBCBCHHHHHHHHHHHHHHHHHHHHHHHCTT--SCHH
T ss_pred HHHHHHHHHcCCccccccchhHHHHHHHHHHHHHHHHHHHhCCCcchhhHHHHHHHHHHHHHHHHHHHHhCCcc--cchH
Confidence 5789999997632 123444678889999999999999999999999999999999999999999888864 6899
Q ss_pred HHHHHHHHHHHHhhhchhHHHHHHHHHhhCCchhhHHHHHHHHHHHHHHhhcCCchhHHHHHHcCCCCCCCCCCCCCccc
Q psy15906 116 KYALIGAAAQLGGVVRMTISLTIILIEATGNISFGLPLMLTLITAKWIGDFFTEGLYDIHIQLSGIPLLAWDPPPLSSNI 195 (352)
Q Consensus 116 ~~alvG~aa~l~g~~r~pls~~vi~~ElTg~~~~~lp~m~~~~~a~~v~~~~~~~iy~~~l~~~g~p~l~~~~~~~l~~i 195 (352)
.||++||||++||++|+|++++ |++|+||++++++|+|+++++||++++.+++||||.+++.|++|++++.+....+++
T Consensus 375 ~~a~vGmaa~~~~v~~ap~t~v-i~~E~tg~~~~~lpl~ia~~~a~~v~~~~~~~iY~~~~~~k~lp~l~~~~~~~~~~~ 453 (632)
T 3org_A 375 SYAVVGAAAFTAGVTRALSCAV-IIFEVTGQIRHLVPVLISVLLAVIVGNAFNRSLYETLVLMKHLPYMPILRRDRSPEM 453 (632)
T ss_dssp HHHHHHHHHHHHHHSCCTTHHH-HHHHHTCCCSCSHHHHHHHHHHHHHHHHHCCCHHHHHHHHTTCCEEEEECTTCCTTS
T ss_pred HHHHHHHHHHHHHHHHHHHHHH-HHHHHhCChhHHHHHHHHHHHHHHHHHHhCCCHHHHHHHhcCCCccccccccccccC
Confidence 9999999999999999998875 899999999999999999999999999999999999999999999876555555889
Q ss_pred ccccccc--cCeEEecCCCCHHHHHHHHH-hCCCCeEEEEeCCCCc---cccCCcccc--cC------------------
Q psy15906 196 TARIVKS--HPVICLRPLETVGNIIDVLK-ATSHNGFPIVDVEPMT---KHSSDGAEQ--SS------------------ 249 (352)
Q Consensus 196 ~V~dIM~--~~vv~l~~~~tV~e~~~~L~-~t~~~~fPVVd~~~~~---~~~~d~~~~--~~------------------ 249 (352)
+|+|+|+ +++++++++++++|+.+.++ +++++++||||+++++ ++.+|.... +.
T Consensus 454 ~V~diM~p~~~v~~v~~~~t~~e~~~~~~~~~~~~~~PVvd~~~~lvGiVt~~DL~~~l~~~~~~~~~~~~~~~~~~~~~ 533 (632)
T 3org_A 454 TAREIMHPIEGEPHLFPDSEPQHIKGILEKFPNRLVFPVIDANGYLLGAISRKEIVDRLQHVLEDVPEPIAGHRTLVLLD 533 (632)
T ss_dssp BHHHHCBCTTTSCCBCSSSCHHHHHHHHHHSTTCCEECBBCTTCBBCCEESHHHHTTTTTTC------------------
T ss_pred cHHHHhhcCCCceEecCCCcHHHHHHHHHhcCCcceEEEEecCCeEEEEEEHHHHHHHHHHHhhhcccccccccceeccC
Confidence 9999999 89999999999999999999 8999999999975444 222222110 00
Q ss_pred -------------------------------CCCCCcccCCCCCcccCCCC------------CCCCcCC--CCCeEEEE
Q psy15906 250 -------------------------------AGSTDSHKGDTSHKRDSSHK------------GDASRKD--SPGRLVGL 284 (352)
Q Consensus 250 -------------------------------~~~~~~~~~m~~~~~~~~~~------------~~~~~l~--~~g~lvGi 284 (352)
.+..++.++|++++.+++.. ++..++| ++|+++|+
T Consensus 534 ~~~l~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~v~~iMt~~pitV~~~~~l~ea~~~M~~~~i~~lpVve~G~lvGI 613 (632)
T 3org_A 534 AADLSENIEGLVDETPSGEHSSKGKRTATVLEPTSSLVVPCDVSPIVVTSYSLVRQLHFLFVMLMPSMIYVTERGKLVGI 613 (632)
T ss_dssp -------------------------------------CCSCCCCCCEEETTCBHHHHHHHHHHTCCSEEEEEETTEEEEE
T ss_pred HHHHHhhcccCCCCCcccchhhhcccceEeeccccccchhhcCCCceecCCCcHHHHHHHHHhcCCCEEEEEECCEEEEE
Confidence 00113778999999999855 3344445 58999999
Q ss_pred EeHHHHHHHHHh
Q psy15906 285 ILRSQLIILIKH 296 (352)
Q Consensus 285 ItRsdLi~~L~~ 296 (352)
|||+|+++++.+
T Consensus 614 VT~~Dll~~~~~ 625 (632)
T 3org_A 614 VEREDVAYGYSN 625 (632)
T ss_dssp EEGGGTEECCCC
T ss_pred EehhhHHHHHhh
Confidence 999999877643
|
| >4ene_A CLC-EC1, H(+)/CL(-) exchange transporter CLCA; membrane protein, coupled ION transporter, cell membrane, TR protein; HET: DMU MAL; 2.40A {Escherichia coli k-12} PDB: 1ots_A 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2fed_A 2fec_A 1otu_A 2htl_A 2ht2_A 3ejy_A 1ott_A 2h2s_A 4fg6_A 2ht4_A 4ftp_A 3ejz_A 2ht3_A 2htk_A ... | Back alignment and structure |
|---|
| >1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... | Back alignment and structure |
|---|
| >3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4ene_A CLC-EC1, H(+)/CL(-) exchange transporter CLCA; membrane protein, coupled ION transporter, cell membrane, TR protein; HET: DMU MAL; 2.40A {Escherichia coli k-12} PDB: 1ots_A 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2fed_A 2fec_A 1otu_A 2htl_A 2ht2_A 3ejy_A 1ott_A 2h2s_A 4fg6_A 2ht4_A 4ftp_A 3ejz_A 2ht3_A 2htk_A ... | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 352 | ||||
| d1otsa_ | 444 | f.20.1.1 (A:) Clc chloride channel {Escherichia co | 5e-28 |
| >d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} Length = 444 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Clc chloride channel superfamily: Clc chloride channel family: Clc chloride channel domain: Clc chloride channel species: Escherichia coli [TaxId: 562]
Score = 111 bits (278), Expect = 5e-28
Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 2/126 (1%)
Query: 53 GAFGVFSLSVFVVTYFLLSVWTYGVSVSGGVFIPCLLTGAAWGRLFSLFLQSIFPEATWI 112
G F + L V + ++ + GG+F P L G G F + +FP+ +
Sbjct: 310 GNFSMGMLVFIFVARVITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQ-YHL 368
Query: 113 DPGKYALIGAAAQLGGVVRMTISLTIILIEATGNISFGLPLMLTLITAKWIGDFF-TEGL 171
+ G +A+ G A L +R ++ I+++E T N LP+++T + A + F + L
Sbjct: 369 EAGTFAIAGMGALLAASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQFTGGKPL 428
Query: 172 YDIHIQ 177
Y +
Sbjct: 429 YSAILA 434
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 352 | |||
| d1otsa_ | 444 | Clc chloride channel {Escherichia coli [TaxId: 562 | 99.94 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.19 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.17 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.16 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.16 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.14 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.11 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.11 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.1 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.05 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.04 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.0 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.97 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 98.96 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 98.93 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 98.93 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 98.92 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.91 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 98.88 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 98.73 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 98.61 | |
| d1otsa_ | 444 | Clc chloride channel {Escherichia coli [TaxId: 562 | 98.56 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 98.45 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 98.42 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.4 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 98.38 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 98.26 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.24 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.24 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.21 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.17 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.16 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 98.16 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 98.1 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.06 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.0 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 96.87 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 96.44 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 96.43 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 96.34 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 96.23 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 96.11 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 96.1 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 96.09 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 96.09 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 95.77 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 95.7 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 95.7 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 95.5 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 95.37 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 93.43 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 93.41 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 91.25 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 89.77 |
| >d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Clc chloride channel superfamily: Clc chloride channel family: Clc chloride channel domain: Clc chloride channel species: Escherichia coli [TaxId: 562]
Probab=99.94 E-value=1.4e-26 Score=229.43 Aligned_cols=139 Identities=22% Similarity=0.391 Sum_probs=129.4
Q ss_pred hccCcHHHHHHHhcCCCCchhHHHHHHHHHHHHHHHHHHHhcCCccccchhHHHHHHHHHHHHHHHHHHhcCCCCcCChh
Q psy15906 36 WLQVPEKSVRTMLHDPKGAFGVFSLSVFVVTYFLLSVWTYGVSVSGGVFIPCLLTGAAWGRLFSLFLQSIFPEATWIDPG 115 (352)
Q Consensus 36 ~~~~~~~~i~~l~~~~~~~~~~~~l~~~~~~k~~~t~~t~g~g~~gG~f~P~l~iGa~~G~~~g~~~~~~~p~~~~~~~~ 115 (352)
.+|+|++.++.++++ .+++..++.+++.|+++|++|+|+|.|||+|+|++++||++|+++|.+++.++|... .+|+
T Consensus 296 ~~g~G~~~~~~~~~~---~~~~~~l~~~~~~K~~~t~~t~~~G~~GG~f~P~l~iGa~~G~~~~~~~~~~~~~~~-~~~~ 371 (444)
T d1otsa_ 296 TSGGGFNLIPIATAG---NFSMGMLVFIFVARVITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQYH-LEAG 371 (444)
T ss_dssp GSSCSTTHHHHHHHT---CSCHHHHHHHHHHHHHHHHHHHHTTCSSBSHHHHHHHHHHHHHHHHHHHHHHCGGGT-CCHH
T ss_pred cCCCchHHHHHHhcC---CcchHHHHHHHHHHHHHHHHHhhcCCCCCeehHHHHHHHHHHHHHHHHHHHhCCccc-CCHH
Confidence 348999999999987 356778888999999999999999999999999999999999999999998887653 7899
Q ss_pred HHHHHHHHHHHHhhhchhHHHHHHHHHhhCCchhhHHHHHHHHHHHHHHhhcC-CchhHHHHHH
Q psy15906 116 KYALIGAAAQLGGVVRMTISLTIILIEATGNISFGLPLMLTLITAKWIGDFFT-EGLYDIHIQL 178 (352)
Q Consensus 116 ~~alvG~aa~l~g~~r~pls~~vi~~ElTg~~~~~lp~m~~~~~a~~v~~~~~-~~iy~~~l~~ 178 (352)
.|+++||||+++|++|+|+|++++++|+||++++++|+|+++++|+++++.++ +|+||.++++
T Consensus 372 ~~alvGmaa~~a~~~~~Plta~vl~~Eltg~~~~~~p~~ia~~~a~~v~~~~~~~siY~~~l~~ 435 (444)
T d1otsa_ 372 TFAIAGMGALLAASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQFTGGKPLYSAILAR 435 (444)
T ss_dssp HHHHHHHTHHHHHTSCCHHHHHHHHHHHHCCGGGHHHHHHHHHHHHHHHHTTTCCCHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHhhHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHhCCCChHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999996 8999999875
|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|