Psyllid ID: psy15946


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MFLRPFQNPFMFYIPMTWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGTWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGDADAIERLNESGELRRILKPYKSPDACTICQVCGGYRLLPCSLCNGSKKSVHRNHFTTELVALKCMNCDEVGLVKCYAC
cccccccccccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHccccEEEEcccccHHcHHHHHHHHccccccccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHccccccccEEEEccEEEccHHHHHHHHHccccHHHccccccccccccccccccccEEEcccccccccEEEEccccccccEEEccccccccccccccc
cccccccccEEEEEEccHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHcccccccccHHcccccccccccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHHccccccccEEEEcccEcccHHHHHHHHHccHHHHHHcccccccccccccccccEEEEEcccccccEEEEEEcccccccEEEEcccccccccEEcccc
mflrpfqnpfmfyipmtwqekeAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHlvkfddkdvfmSRETQQEFKERlgtdvinvpqIFVEGVhigtwqekeaGKIVMYSTTMGIVRDTYHRCLKVKQILRTHlvkfddkdvfmSRETQQEFKERlgtdvinvpqIFVEGVHIGDADAIERLNESGELRrilkpykspdacticqvcggyrllpcslcngskksvhrnhFTTELVALKcmncdevglvkcyac
mflrpfqnpFMFYIPMTWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRthlvkfddkdvfMSRETQQEFkerlgtdvinvPQIFVEGVhigtwqekeaGKIVMYSTTMGIVRDTYHRCLKVKQILRthlvkfddkdvfMSRETQQEFkerlgtdvinVPQIFVEGVHIGDADAIERLNESGELRRilkpykspdaCTICQVCGGYRLLPCSLCNGSKKSVHRNHFTTELvalkcmncdevglvkcyac
MFLRPFQNPFMFYIPMTWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGTWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGDADAIERLNESGELRRILKPYKSPDACTICQVCGGYRLLPCSLCNGSKKSVHRNHFTTELVALKCMNCDEVGLVKCYAC
*****FQNPFMFYIPMTWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGTWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGDADAIERLNESGELRRILKPYKSPDACTICQVCGGYRLLPCSLCNGSKKSVHRNHFTTELVALKCMNCDEVGLVKCYA*
**L**********************IVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDK***********************************WQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRET**************VPQIFVEGVHIGDADAIERLNESGELRRILKPYKSPDACTICQVCGGYRLLPCSLCNGSKKSVHRNHFTTELVALKCMNCDEVGLVKCYAC
MFLRPFQNPFMFYIPMTWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGTWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGDADAIERLNESGELRRILKPYKSPDACTICQVCGGYRLLPCSLCNGSKKSVHRNHFTTELVALKCMNCDEVGLVKCYAC
*FLRPFQNPFMFYIPMTWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGTWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGDADAIERLNESGELRRILKPYKSPDACTICQVCGGYRLLPCSLCNGSKKSVHRNHFTTELVALKCMNCDEVGLVKCYAC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFLRPFQNPFMFYIPMTWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGTWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGDADAIERLNESGELRRILKPYKSPDACTICQVCGGYRLLPCSLCNGSKKSVHRNHFTTELVALKCMNCDEVGLVKCYAC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
Q9VNL4454 Glutaredoxin domain-conta yes N/A 0.609 0.337 0.656 4e-61
Q9W4S1582 Glutaredoxin domain-conta no N/A 0.637 0.274 0.631 3e-60
A8MXD5290 Glutaredoxin domain-conta yes N/A 0.605 0.524 0.396 4e-27
Q50H32290 Glutaredoxin domain-conta yes N/A 0.605 0.524 0.389 1e-26
Q9FLE8390 Uncharacterized protein A no N/A 0.705 0.453 0.286 5e-18
Q9LH89428 Uncharacterized protein A no N/A 0.593 0.348 0.274 1e-12
Q3TYR5254 Glutaredoxin domain-conta no N/A 0.509 0.503 0.264 6e-06
A6NFK2248 Glutaredoxin domain-conta no N/A 0.505 0.512 0.24 0.0001
>sp|Q9VNL4|GRCR1_DROME Glutaredoxin domain-containing cysteine-rich protein CG31559 OS=Drosophila melanogaster GN=CG31559 PE=1 SV=2 Back     alignment and function desciption
 Score =  234 bits (597), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 103/157 (65%), Positives = 130/157 (82%)

Query: 95  TWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERL 154
            ++EK+ GK+V+Y+T+MGI+R+TY +C  VKQILRT LVKF+++DVFMS E Q E ++R+
Sbjct: 298 NFKEKDLGKVVLYTTSMGIIRETYTKCANVKQILRTLLVKFEERDVFMSVEYQAEMRQRM 357

Query: 155 GTDVINVPQIFVEGVHIGDADAIERLNESGELRRILKPYKSPDACTICQVCGGYRLLPCS 214
            +  + VPQ++VEG HIGDA+ +ER+NESGELR++LKPYKS  +   CQ CGGYRLLPC 
Sbjct: 358 QSGQVRVPQLYVEGQHIGDAETVERMNESGELRQLLKPYKSMASTYTCQTCGGYRLLPCP 417

Query: 215 LCNGSKKSVHRNHFTTELVALKCMNCDEVGLVKCYAC 251
            CNGSKKSVHRNHFT E VALKCMNCDEVGLVKC+ C
Sbjct: 418 SCNGSKKSVHRNHFTAEFVALKCMNCDEVGLVKCHNC 454





Drosophila melanogaster (taxid: 7227)
>sp|Q9W4S1|GRCR2_DROME Glutaredoxin domain-containing cysteine-rich protein CG12206 OS=Drosophila melanogaster GN=CG12206 PE=2 SV=2 Back     alignment and function description
>sp|A8MXD5|GRCR1_HUMAN Glutaredoxin domain-containing cysteine-rich protein 1 OS=Homo sapiens GN=GRXCR1 PE=1 SV=1 Back     alignment and function description
>sp|Q50H32|GRCR1_MOUSE Glutaredoxin domain-containing cysteine-rich protein 1 OS=Mus musculus GN=Grxcr1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLE8|Y5986_ARATH Uncharacterized protein At5g39865 OS=Arabidopsis thaliana GN=At5g39865 PE=1 SV=1 Back     alignment and function description
>sp|Q9LH89|Y3885_ARATH Uncharacterized protein At3g28850 OS=Arabidopsis thaliana GN=At3g28850 PE=1 SV=1 Back     alignment and function description
>sp|Q3TYR5|GRCR2_MOUSE Glutaredoxin domain-containing cysteine-rich protein 2 OS=Mus musculus GN=Grxcr2 PE=2 SV=1 Back     alignment and function description
>sp|A6NFK2|GRCR2_HUMAN Glutaredoxin domain-containing cysteine-rich protein 2 OS=Homo sapiens GN=GRXCR2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
328708637 485 PREDICTED: glutaredoxin domain-containin 0.597 0.309 0.808 2e-74
270005423 392 hypothetical protein TcasGA2_TC007476 [T 0.621 0.397 0.743 5e-66
91080817192 PREDICTED: similar to CG31559 CG31559-PA 0.749 0.979 0.637 7e-66
347963496 929 AGAP000262-PA [Anopheles gambiae str. PE 0.621 0.167 0.692 5e-64
389613654232 similar to CG31559, partial [Papilio xut 0.625 0.676 0.681 7e-63
345491981 635 PREDICTED: hypothetical protein LOC10011 0.657 0.259 0.630 5e-62
195144598 495 GL23481 [Drosophila persimilis] gi|19410 0.621 0.315 0.679 4e-61
198452758 490 GA16323 [Drosophila pseudoobscura pseudo 0.621 0.318 0.679 4e-61
194769720 571 GF21786 [Drosophila ananassae] gi|190622 0.637 0.280 0.675 4e-61
195393668 714 GJ19392 [Drosophila virilis] gi|19414998 0.737 0.259 0.604 5e-61
>gi|328708637|ref|XP_001946886.2| PREDICTED: glutaredoxin domain-containing cysteine-rich protein CG12206-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  285 bits (728), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 127/157 (80%), Positives = 146/157 (92%)

Query: 95  TWQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERL 154
           TWQEKEAGK+V+Y+TTMGIVRDTY RCL+V+QILRTHLVK+ ++DVFMSRE Q+E +ERL
Sbjct: 329 TWQEKEAGKVVLYTTTMGIVRDTYQRCLQVRQILRTHLVKYVERDVFMSREVQKEIRERL 388

Query: 155 GTDVINVPQIFVEGVHIGDADAIERLNESGELRRILKPYKSPDACTICQVCGGYRLLPCS 214
           G D I+VPQ+FVEG  IGDA+A+ERLNESGELR ILKP+KSPDACT CQVCGGYRLLPC 
Sbjct: 389 GGDSISVPQLFVEGNLIGDAEAVERLNESGELRSILKPFKSPDACTTCQVCGGYRLLPCP 448

Query: 215 LCNGSKKSVHRNHFTTELVALKCMNCDEVGLVKCYAC 251
           +CNGSKKSVHRNHFTTE++ALKCMNCDEVGLV+CYAC
Sbjct: 449 MCNGSKKSVHRNHFTTEMIALKCMNCDEVGLVQCYAC 485




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270005423|gb|EFA01871.1| hypothetical protein TcasGA2_TC007476 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91080817|ref|XP_970308.1| PREDICTED: similar to CG31559 CG31559-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|347963496|ref|XP_310856.5| AGAP000262-PA [Anopheles gambiae str. PEST] gi|333467171|gb|EAA06446.5| AGAP000262-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|389613654|dbj|BAM20154.1| similar to CG31559, partial [Papilio xuthus] Back     alignment and taxonomy information
>gi|345491981|ref|XP_001602602.2| PREDICTED: hypothetical protein LOC100118696 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|195144598|ref|XP_002013283.1| GL23481 [Drosophila persimilis] gi|194102226|gb|EDW24269.1| GL23481 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|198452758|ref|XP_001358930.2| GA16323 [Drosophila pseudoobscura pseudoobscura] gi|198132063|gb|EAL28073.2| GA16323 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|194769720|ref|XP_001966949.1| GF21786 [Drosophila ananassae] gi|190622744|gb|EDV38268.1| GF21786 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195393668|ref|XP_002055475.1| GJ19392 [Drosophila virilis] gi|194149985|gb|EDW65676.1| GJ19392 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
FB|FBgn0051559454 CG31559 [Drosophila melanogast 0.621 0.343 0.660 9.6e-57
FB|FBgn0029662582 CG12206 [Drosophila melanogast 0.737 0.317 0.566 3.3e-56
UNIPROTKB|E1C085294 GRXCR1 "Uncharacterized protei 0.605 0.517 0.402 4.4e-29
UNIPROTKB|E1BCE8290 GRXCR1 "Uncharacterized protei 0.613 0.531 0.391 1.9e-28
UNIPROTKB|F1S3T4290 GRXCR1 "Uncharacterized protei 0.605 0.524 0.389 3.1e-28
UNIPROTKB|A8MXD5290 GRXCR1 "Glutaredoxin domain-co 0.605 0.524 0.396 5e-28
UNIPROTKB|E2RF60290 GRXCR1 "Uncharacterized protei 0.605 0.524 0.389 6.4e-28
MGI|MGI:3577767290 Grxcr1 "glutaredoxin, cysteine 0.605 0.524 0.389 1e-27
RGD|1564635290 Grxcr1 "glutaredoxin, cysteine 0.605 0.524 0.389 1e-27
TAIR|locus:2171223273 AT5G58530 [Arabidopsis thalian 0.733 0.673 0.301 1.6e-23
FB|FBgn0051559 CG31559 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 584 (210.6 bits), Expect = 9.6e-57, P = 9.6e-57
 Identities = 103/156 (66%), Positives = 130/156 (83%)

Query:    96 WQEKEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLG 155
             ++EK+ GK+V+Y+T+MGI+R+TY +C  VKQILRT LVKF+++DVFMS E Q E ++R+ 
Sbjct:   299 FKEKDLGKVVLYTTSMGIIRETYTKCANVKQILRTLLVKFEERDVFMSVEYQAEMRQRMQ 358

Query:   156 TDVINVPQIFVEGVHIGDADAIERLNESGELRRILKPYKSPDACTICQVCGGYRLLPCSL 215
             +  + VPQ++VEG HIGDA+ +ER+NESGELR++LKPYKS  +   CQ CGGYRLLPC  
Sbjct:   359 SGQVRVPQLYVEGQHIGDAETVERMNESGELRQLLKPYKSMASTYTCQTCGGYRLLPCPS 418

Query:   216 CNGSKKSVHRNHFTTELVALKCMNCDEVGLVKCYAC 251
             CNGSKKSVHRNHFT E VALKCMNCDEVGLVKC+ C
Sbjct:   419 CNGSKKSVHRNHFTAEFVALKCMNCDEVGLVKCHNC 454


GO:0005575 "cellular_component" evidence=ND
GO:0009055 "electron carrier activity" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA
FB|FBgn0029662 CG12206 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1C085 GRXCR1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BCE8 GRXCR1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1S3T4 GRXCR1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|A8MXD5 GRXCR1 "Glutaredoxin domain-containing cysteine-rich protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RF60 GRXCR1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:3577767 Grxcr1 "glutaredoxin, cysteine rich 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1564635 Grxcr1 "glutaredoxin, cysteine rich 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2171223 AT5G58530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VNL4GRCR1_DROMENo assigned EC number0.65600.60950.3370yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
cd03031147 cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, 4e-57
cd03031147 cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, 2e-19
cd0206672 cd02066, GRX_family, Glutaredoxin (GRX) family; co 3e-15
cd0206672 cd02066, GRX_family, Glutaredoxin (GRX) family; co 9e-12
pfam0046260 pfam00462, Glutaredoxin, Glutaredoxin 1e-09
pfam0046260 pfam00462, Glutaredoxin, Glutaredoxin 1e-09
COG069580 COG0695, GrxC, Glutaredoxin and related proteins [ 7e-08
TIGR0218179 TIGR02181, GRX_bact, Glutaredoxin, GrxC family 6e-07
TIGR0218084 TIGR02180, GRX_euk, Glutaredoxin 1e-06
cd0341875 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) fam 1e-06
cd0302773 cd03027, GRX_DEP, Glutaredoxin (GRX) family, Dishe 5e-06
cd0341875 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) fam 7e-06
COG069580 COG0695, GrxC, Glutaredoxin and related proteins [ 2e-05
cd0341982 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) fam 6e-05
cd0302773 cd03027, GRX_DEP, Glutaredoxin (GRX) family, Dishe 7e-05
COG0278105 COG0278, COG0278, Glutaredoxin-related protein [Po 1e-04
cd0302890 cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family 1e-04
PRK1063883 PRK10638, PRK10638, glutaredoxin 3; Provisional 3e-04
TIGR0218179 TIGR02181, GRX_bact, Glutaredoxin, GrxC family 6e-04
pfam0490892 pfam04908, SH3BGR, SH3-binding, glutamic acid-rich 0.001
PRK1120085 PRK11200, grxA, glutaredoxin 1; Provisional 0.001
>gnl|CDD|239329 cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
 Score =  178 bits (454), Expect = 4e-57
 Identities = 61/148 (41%), Positives = 94/148 (63%), Gaps = 3/148 (2%)

Query: 103 KIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINV- 161
           ++V+Y+T++  VR T+  C  V+ IL +  VKFD++DV M    ++E +E LG ++  V 
Sbjct: 1   RVVLYTTSLRGVRKTFEDCNNVRAILESFRVKFDERDVSMDSGFREELRELLGAELKAVS 60

Query: 162 -PQIFVEGVHIGDADAIERLNESGELRRILKPYKSPDACTICQVCGGYRLLPCSLCNGSK 220
            P++FV+G ++G A+ + RLNESGELR++LK  ++     +C+ CGG R +PCS CNGS 
Sbjct: 61  LPRVFVDGRYLGGAEEVLRLNESGELRKLLKGIRARAGGGVCEGCGGARFVPCSECNGSC 120

Query: 221 KSVHRNHFTTELVALKCMNCDEVGLVKC 248
           K    N        L+C  C+E GLV+C
Sbjct: 121 KVFAENAT-AAGGFLRCPECNENGLVRC 147


This subfamily is predominantly composed of plant proteins. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins via a redox active CXXC motif using a similar dithiol mechanism employed by TRXs. GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. Proteins containing only the C-terminal cysteine are generally redox inactive. Length = 147

>gnl|CDD|239329 cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin Back     alignment and domain information
>gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin Back     alignment and domain information
>gnl|CDD|223767 COG0695, GrxC, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233766 TIGR02181, GRX_bact, Glutaredoxin, GrxC family Back     alignment and domain information
>gnl|CDD|233765 TIGR02180, GRX_euk, Glutaredoxin Back     alignment and domain information
>gnl|CDD|239510 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|239325 cd03027, GRX_DEP, Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>gnl|CDD|239510 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|223767 COG0695, GrxC, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239511 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|239325 cd03027, GRX_DEP, Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>gnl|CDD|223355 COG0278, COG0278, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239326 cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>gnl|CDD|182607 PRK10638, PRK10638, glutaredoxin 3; Provisional Back     alignment and domain information
>gnl|CDD|233766 TIGR02181, GRX_bact, Glutaredoxin, GrxC family Back     alignment and domain information
>gnl|CDD|218321 pfam04908, SH3BGR, SH3-binding, glutamic acid-rich protein Back     alignment and domain information
>gnl|CDD|183036 PRK11200, grxA, glutaredoxin 1; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 100.0
KOG2824|consensus281 100.0
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 99.9
PTZ00062204 glutaredoxin; Provisional 99.88
PRK10824115 glutaredoxin-4; Provisional 99.87
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 99.86
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 99.85
PHA03050108 glutaredoxin; Provisional 99.84
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 99.83
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 99.82
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 99.8
PRK1063883 glutaredoxin 3; Provisional 99.8
KOG1752|consensus104 99.76
COG0278105 Glutaredoxin-related protein [Posttranslational mo 99.76
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 99.74
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 99.74
KOG2824|consensus281 99.73
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 99.69
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 99.69
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 99.67
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 99.64
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 99.63
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 99.62
PRK1120085 grxA glutaredoxin 1; Provisional 99.61
PF0490899 SH3BGR: SH3-binding, glutamic acid-rich protein; I 99.61
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 99.61
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 99.61
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 99.6
PHA03050108 glutaredoxin; Provisional 99.6
PRK10824115 glutaredoxin-4; Provisional 99.6
KOG0911|consensus227 99.59
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 99.59
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 99.59
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 99.58
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 99.57
PRK1063883 glutaredoxin 3; Provisional 99.57
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 99.54
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 99.54
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 99.54
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 99.54
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 99.53
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 99.52
PRK1120085 grxA glutaredoxin 1; Provisional 99.49
PRK1032981 glutaredoxin-like protein; Provisional 99.49
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 99.48
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 99.46
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 99.45
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 99.42
PTZ00062204 glutaredoxin; Provisional 99.38
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 99.36
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 99.34
KOG1752|consensus104 99.32
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 99.31
PRK1032981 glutaredoxin-like protein; Provisional 99.31
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 99.26
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 99.21
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 99.06
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 99.03
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 98.96
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 98.95
COG0278105 Glutaredoxin-related protein [Posttranslational mo 98.92
PF0490899 SH3BGR: SH3-binding, glutamic acid-rich protein; I 98.89
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 98.78
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 98.71
KOG0911|consensus227 98.61
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 98.58
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 98.57
KOG4023|consensus108 98.56
PRK01655131 spxA transcriptional regulator Spx; Reviewed 98.54
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 98.5
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 98.37
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 98.35
PRK12559131 transcriptional regulator Spx; Provisional 98.35
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 98.35
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 98.29
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 98.28
PRK13344132 spxA transcriptional regulator Spx; Reviewed 98.26
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 98.19
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 98.17
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 98.17
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 98.14
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 98.13
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 98.08
COG1393117 ArsC Arsenate reductase and related proteins, glut 98.06
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 97.97
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 97.96
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 97.91
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 97.91
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 97.9
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 97.89
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 97.89
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 97.88
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 97.87
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 97.83
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 97.83
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 97.8
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 97.8
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 97.8
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 97.79
PRK01655131 spxA transcriptional regulator Spx; Reviewed 97.79
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 97.77
COG454585 Glutaredoxin-related protein [Posttranslational mo 97.73
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 97.68
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 97.67
PRK10026141 arsenate reductase; Provisional 97.67
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 97.63
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 97.62
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 97.6
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 97.59
PLN03165111 chaperone protein dnaJ-related; Provisional 97.58
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 97.58
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 97.55
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 97.54
PHA0212575 thioredoxin-like protein 97.53
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 97.49
PRK12559131 transcriptional regulator Spx; Provisional 97.49
PRK13344132 spxA transcriptional regulator Spx; Reviewed 97.49
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 97.45
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 97.42
PRK10853118 putative reductase; Provisional 97.41
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 97.36
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 97.36
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 97.35
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.35
KOG3029|consensus370 97.28
PHA0212575 thioredoxin-like protein 97.24
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 97.19
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 97.15
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 97.09
KOG4023|consensus108 97.08
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 97.06
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 97.05
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 96.98
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 96.93
KOG3029|consensus 370 96.87
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 96.84
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 96.81
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 96.81
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 96.8
COG454585 Glutaredoxin-related protein [Posttranslational mo 96.79
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 96.79
COG1393117 ArsC Arsenate reductase and related proteins, glut 96.78
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 96.78
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 96.78
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 96.75
PRK10026141 arsenate reductase; Provisional 96.73
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 96.67
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 96.67
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 96.65
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 96.64
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 96.63
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 96.63
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 96.63
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 96.62
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 96.61
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 96.59
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 96.59
PRK10853118 putative reductase; Provisional 96.54
PF03960110 ArsC: ArsC family; InterPro: IPR006660 Several bac 96.53
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 96.53
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 96.42
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 96.42
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 96.36
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 96.36
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 96.35
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 96.34
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 96.29
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 96.26
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 96.24
cd0294793 TRX_family TRX family; composed of two groups: Gro 96.19
PRK10387210 glutaredoxin 2; Provisional 96.14
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 96.13
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 96.13
PRK09481211 sspA stringent starvation protein A; Provisional 96.09
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 95.75
PRK10877232 protein disulfide isomerase II DsbC; Provisional 95.64
PRK10387210 glutaredoxin 2; Provisional 95.63
PHA02278103 thioredoxin-like protein 95.63
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 95.56
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 95.55
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 95.55
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 95.53
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 95.51
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 95.51
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 95.47
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 95.43
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 95.4
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 95.39
PF03960110 ArsC: ArsC family; InterPro: IPR006660 Several bac 95.36
PRK14300 372 chaperone protein DnaJ; Provisional 95.34
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 95.28
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 95.27
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 95.26
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 95.22
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 95.2
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 95.19
cd0294793 TRX_family TRX family; composed of two groups: Gro 95.11
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 95.11
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 95.08
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 95.05
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 95.02
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 95.01
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 95.0
PRK10767 371 chaperone protein DnaJ; Provisional 94.99
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 94.94
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 94.94
PRK15113214 glutathione S-transferase; Provisional 94.92
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 94.89
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 94.79
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 94.74
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 94.69
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 94.63
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 94.62
PHA02278103 thioredoxin-like protein 94.58
PRK09481211 sspA stringent starvation protein A; Provisional 94.56
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.5
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 94.5
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 94.49
PRK14285 365 chaperone protein DnaJ; Provisional 94.47
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 94.38
PTZ0005198 thioredoxin; Provisional 94.35
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 94.31
PRK14298 377 chaperone protein DnaJ; Provisional 94.15
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 94.07
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 94.03
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 94.02
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 94.01
PRK14284 391 chaperone protein DnaJ; Provisional 93.96
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 93.91
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 93.91
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 93.81
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 93.79
PF0068466 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR0 93.78
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 93.77
PRK14282 369 chaperone protein DnaJ; Provisional 93.76
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 93.74
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 93.65
PRK14287 371 chaperone protein DnaJ; Provisional 93.64
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 93.6
PRK14294 366 chaperone protein DnaJ; Provisional 93.59
PRK14289 386 chaperone protein DnaJ; Provisional 93.55
PRK14301 373 chaperone protein DnaJ; Provisional 93.55
PRK14286 372 chaperone protein DnaJ; Provisional 93.43
PRK14288 369 chaperone protein DnaJ; Provisional 93.29
PRK14290 365 chaperone protein DnaJ; Provisional 93.15
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 93.15
PRK14293 374 chaperone protein DnaJ; Provisional 93.11
PRK13728181 conjugal transfer protein TrbB; Provisional 93.03
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 93.01
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 92.99
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 92.97
KOG0406|consensus231 92.96
cd02962152 TMX2 TMX2 family; composed of proteins similar to 92.96
PRK14283 378 chaperone protein DnaJ; Provisional 92.94
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 92.92
PF06764202 DUF1223: Protein of unknown function (DUF1223); In 92.92
PRK10996139 thioredoxin 2; Provisional 92.86
PF0731593 DUF1462: Protein of unknown function (DUF1462); In 92.85
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 92.82
PRK14279 392 chaperone protein DnaJ; Provisional 92.74
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 92.73
PRK14297 380 chaperone protein DnaJ; Provisional 92.73
PRK14295 389 chaperone protein DnaJ; Provisional 92.72
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 92.72
PRK14280 376 chaperone protein DnaJ; Provisional 92.69
PRK09381109 trxA thioredoxin; Provisional 92.68
KOG0910|consensus150 92.59
PF1371937 zinc_ribbon_5: zinc-ribbon domain 92.58
PRK14291 382 chaperone protein DnaJ; Provisional 92.53
PRK14278 378 chaperone protein DnaJ; Provisional 92.49
PRK14296 372 chaperone protein DnaJ; Provisional 92.43
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 92.37
PRK14276 380 chaperone protein DnaJ; Provisional 92.36
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 92.31
PRK14296 372 chaperone protein DnaJ; Provisional 92.19
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 92.16
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 92.06
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 92.02
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 91.99
PRK14292 371 chaperone protein DnaJ; Provisional 91.95
PRK14285 365 chaperone protein DnaJ; Provisional 91.9
KOG0406|consensus231 91.89
PLN02817265 glutathione dehydrogenase (ascorbate) 91.77
PRK14282 369 chaperone protein DnaJ; Provisional 91.72
PRK14284 391 chaperone protein DnaJ; Provisional 91.68
PRK14279 392 chaperone protein DnaJ; Provisional 91.62
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 91.61
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 91.59
KOG2813|consensus 406 91.57
PRK14280 376 chaperone protein DnaJ; Provisional 91.57
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 91.56
PRK14277 386 chaperone protein DnaJ; Provisional 91.52
PRK14276 380 chaperone protein DnaJ; Provisional 91.42
PRK15113214 glutathione S-transferase; Provisional 91.4
PLN02378213 glutathione S-transferase DHAR1 91.39
PRK14300 372 chaperone protein DnaJ; Provisional 91.34
PF01323193 DSBA: DSBA-like thioredoxin domain; InterPro: IPR0 91.31
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 91.18
PRK14298 377 chaperone protein DnaJ; Provisional 91.14
cd02955124 SSP411 TRX domain, SSP411 protein family; members 91.14
PTZ00037 421 DnaJ_C chaperone protein; Provisional 91.14
PRK14281 397 chaperone protein DnaJ; Provisional 91.11
KOG0712|consensus 337 91.06
PRK14278 378 chaperone protein DnaJ; Provisional 91.03
PRK14286 372 chaperone protein DnaJ; Provisional 91.01
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 91.0
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 90.99
PRK14301 373 chaperone protein DnaJ; Provisional 90.95
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 90.91
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 90.91
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 90.89
PLN02473214 glutathione S-transferase 90.79
KOG0907|consensus106 90.71
PRK14277 386 chaperone protein DnaJ; Provisional 90.65
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 90.58
PRK14289 386 chaperone protein DnaJ; Provisional 90.57
PRK10767 371 chaperone protein DnaJ; Provisional 90.54
PTZ0005198 thioredoxin; Provisional 90.42
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 90.39
PRK14297 380 chaperone protein DnaJ; Provisional 90.38
PLN02817265 glutathione dehydrogenase (ascorbate) 90.37
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 90.37
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 90.33
PLN02378213 glutathione S-transferase DHAR1 90.28
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 90.22
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 90.18
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m 90.15
PRK14295 389 chaperone protein DnaJ; Provisional 90.12
PRK14294 366 chaperone protein DnaJ; Provisional 89.95
PTZ00037 421 DnaJ_C chaperone protein; Provisional 89.74
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 89.71
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 89.57
PLN02473214 glutathione S-transferase 89.55
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 89.52
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 89.45
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 89.42
PRK14288 369 chaperone protein DnaJ; Provisional 89.31
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 89.09
PRK09381109 trxA thioredoxin; Provisional 88.95
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 88.82
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 88.61
PRK14290 365 chaperone protein DnaJ; Provisional 88.55
PRK14287 371 chaperone protein DnaJ; Provisional 88.39
PRK14281 397 chaperone protein DnaJ; Provisional 88.37
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 88.18
PRK11752264 putative S-transferase; Provisional 88.06
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 88.01
PTZ00443224 Thioredoxin domain-containing protein; Provisional 87.88
cd02962152 TMX2 TMX2 family; composed of proteins similar to 87.8
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 87.74
PRK10996139 thioredoxin 2; Provisional 87.57
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 87.43
PRK14293 374 chaperone protein DnaJ; Provisional 87.36
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 87.29
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 87.21
PF1420555 Cys_rich_KTR: Cysteine-rich KTR 87.17
PRK14283 378 chaperone protein DnaJ; Provisional 87.12
PF1371736 zinc_ribbon_4: zinc-ribbon domain 87.12
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 87.09
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 87.06
COG3019149 Predicted metal-binding protein [General function 86.98
COG0625211 Gst Glutathione S-transferase [Posttranslational m 86.96
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 86.85
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 86.71
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 86.51
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 86.34
PRK14291 382 chaperone protein DnaJ; Provisional 86.27
PF1133146 DUF3133: Protein of unknown function (DUF3133); In 86.23
PF06953123 ArsD: Arsenical resistance operon trans-acting rep 85.98
KOG1422|consensus221 85.78
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 85.64
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 85.62
TIGR02740271 TraF-like TraF-like protein. This protein is relat 85.48
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 85.41
PF10865120 DUF2703: Domain of unknown function (DUF2703); Int 85.22
PLN02395215 glutathione S-transferase 85.15
PRK14292 371 chaperone protein DnaJ; Provisional 85.11
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 84.89
PF13901202 DUF4206: Domain of unknown function (DUF4206) 84.81
PF1435461 Lar_restr_allev: Restriction alleviation protein L 84.77
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 84.76
PRK00293571 dipZ thiol:disulfide interchange protein precursor 84.72
PLN03165111 chaperone protein dnaJ-related; Provisional 84.71
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 84.67
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 84.59
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 84.54
PF0731593 DUF1462: Protein of unknown function (DUF1462); In 84.36
PLN02395215 glutathione S-transferase 84.23
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 84.04
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 83.89
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 83.69
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 83.42
TIGR02642186 phage_xxxx uncharacterized phage protein. This unc 83.4
PRK10357202 putative glutathione S-transferase; Provisional 83.16
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 83.0
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 82.94
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 82.91
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 82.87
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 82.83
PTZ00057205 glutathione s-transferase; Provisional 82.8
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 82.8
KOG0910|consensus150 82.42
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 82.38
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 82.36
COG0625211 Gst Glutathione S-transferase [Posttranslational m 82.34
PRK14873 665 primosome assembly protein PriA; Provisional 82.23
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 81.89
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 81.66
KOG1422|consensus221 81.65
COG5494265 Predicted thioredoxin/glutaredoxin [Posttranslatio 81.52
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 81.45
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 81.39
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 81.26
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 81.08
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 80.78
PTZ00057205 glutathione s-transferase; Provisional 80.56
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 80.09
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
Probab=100.00  E-value=3.6e-51  Score=329.53  Aligned_cols=145  Identities=41%  Similarity=0.805  Sum_probs=136.7

Q ss_pred             heeeeeeecccccCCCcchHHHHHHHHhcCCceeEEEcCCCHHHHHHHHHHhCC--CCCCCceEEECCeeeCChHHHHHH
Q psy15946        103 KIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGT--DVINVPQIFVEGVHIGDADAIERL  180 (251)
Q Consensus       103 ~Vviyt~sl~~ir~tc~~C~~~k~lL~~~~v~~~e~dv~~~~~~~~el~~~~g~--~~~~vP~vfi~g~~iGG~d~l~~l  180 (251)
                      +|+||||||++||+|||+|.++|++|++++|+|+++||++|+++++||+++++.  .+.++|||||+|+||||+|+|++|
T Consensus         1 ~VvlYttsl~giR~t~~~C~~ak~iL~~~~V~~~e~DVs~~~~~~~EL~~~~g~~~~~~tvPqVFI~G~~IGG~del~~L   80 (147)
T cd03031           1 RVVLYTTSLRGVRKTFEDCNNVRAILESFRVKFDERDVSMDSGFREELRELLGAELKAVSLPRVFVDGRYLGGAEEVLRL   80 (147)
T ss_pred             CEEEEEcCCcCCCCcChhHHHHHHHHHHCCCcEEEEECCCCHHHHHHHHHHhCCCCCCCCCCEEEECCEEEecHHHHHHH
Confidence            589999999999999999999999999999999999999999999999999872  358999999999999999999999


Q ss_pred             HHcCChhhhhccCCCCCCCccccccCCcceeeCCCCCCCceeeecccccccccceeCCCCCccccccc
Q psy15946        181 NESGELRRILKPYKSPDACTICQVCGGYRLLPCSLCNGSKKSVHRNHFTTELVALKCMNCDEVGLVKC  248 (251)
Q Consensus       181 ~e~G~L~~~L~~~~~~~~~~~C~~Cgg~~~~~C~~C~gs~k~~~~~~~~~~~~~~~C~~Cnengl~~C  248 (251)
                      |++|+|+++|++++...+...|++|||.|||||+.||||+|++.++.+ .++.++||++|||||||||
T Consensus        81 ~e~G~L~~lL~~~~~~~~~~~C~~Cgg~rfv~C~~C~Gs~k~~~~~~~-~~~~~~rC~~Cnengl~~c  147 (147)
T cd03031          81 NESGELRKLLKGIRARAGGGVCEGCGGARFVPCSECNGSCKVFAENAT-AAGGFLRCPECNENGLVRC  147 (147)
T ss_pred             HHcCCHHHHHhhcccccCCCCCCCCCCcCeEECCCCCCcceEEeccCc-ccccEEECCCCCccccccC
Confidence            999999999999988888889999999999999999999999877654 4577999999999999999



This subfamily is predominantly composed of plant proteins. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins via a redox active CXXC motif using a similar dithiol mechanism employed by TRXs. GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. Proteins containing only the C-terminal cysteine are generally redox inactive.

>KOG2824|consensus Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>KOG1752|consensus Back     alignment and domain information
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>KOG2824|consensus Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>KOG0911|consensus Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>KOG1752|consensus Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>KOG0911|consensus Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>KOG4023|consensus Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>KOG3029|consensus Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>KOG4023|consensus Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>KOG3029|consensus Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>PF00684 DnaJ_CXXCXGXG: DnaJ central domain; InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>KOG0406|consensus Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>PF06764 DUF1223: Protein of unknown function (DUF1223); InterPro: IPR010634 This family consists of several hypothetical proteins of around 250 residues in length, which are found in both plants and bacteria Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>PF07315 DUF1462: Protein of unknown function (DUF1462); InterPro: IPR009190 There are currently no experimental data for members of this group of bacterial proteins or their homologues Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>KOG0910|consensus Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0406|consensus Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>KOG2813|consensus Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF01323 DSBA: DSBA-like thioredoxin domain; InterPro: IPR001853 DSBA is a sub-family of the Thioredoxin family [] Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>KOG0907|consensus Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>PF14205 Cys_rich_KTR: Cysteine-rich KTR Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>COG3019 Predicted metal-binding protein [General function prediction only] Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF11331 DUF3133: Protein of unknown function (DUF3133); InterPro: IPR021480 This eukaryotic family of proteins has no known function Back     alignment and domain information
>PF06953 ArsD: Arsenical resistance operon trans-acting repressor ArsD; InterPro: IPR010712 This family consists of several bacterial arsenical resistance operon trans-acting repressor ArsD proteins Back     alignment and domain information
>KOG1422|consensus Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10865 DUF2703: Domain of unknown function (DUF2703); InterPro: IPR021219 This family of protein has no known function Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>PLN03165 chaperone protein dnaJ-related; Provisional Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>PF07315 DUF1462: Protein of unknown function (DUF1462); InterPro: IPR009190 There are currently no experimental data for members of this group of bacterial proteins or their homologues Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information
>TIGR02642 phage_xxxx uncharacterized phage protein Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>KOG0910|consensus Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>KOG1422|consensus Back     alignment and domain information
>COG5494 Predicted thioredoxin/glutaredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
2khp_A92 Solution Structure Of Glutaredoxin From Brucella Me 2e-05
>pdb|2KHP|A Chain A, Solution Structure Of Glutaredoxin From Brucella Melitensis Length = 92 Back     alignment and structure

Iteration: 1

Score = 45.8 bits (107), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 2/74 (2%) Query: 121 CLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGDADAIERL 180 C + K +L +F++ D + E + E +ER G + PQIF+ VH+G D + L Sbjct: 19 CARAKALLARKGAEFNEIDASATPELRAEMQERSGRNTF--PQIFIGSVHVGGCDDLYAL 76 Query: 181 NESGELRRILKPYK 194 + G+L +LK K Sbjct: 77 EDEGKLDSLLKTGK 90

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 6e-25
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 2e-17
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 1e-22
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 1e-14
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 5e-22
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 2e-14
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 4e-12
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 1e-07
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 4e-12
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 2e-07
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 5e-12
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 5e-07
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 2e-09
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 7e-05
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 4e-09
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 2e-04
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 6e-09
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 1e-04
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 7e-09
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 6e-04
1kte_A105 Thioltransferase; redox-active center, electron tr 8e-09
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 8e-09
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 3e-04
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 1e-08
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 3e-08
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 4e-08
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 4e-08
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 7e-08
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 1e-07
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 4e-07
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 4e-06
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 5e-06
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 6e-06
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 9e-06
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 1e-05
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 1e-05
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 4e-04
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 2e-05
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 1e-04
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 5e-05
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 5e-05
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 7e-05
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 7e-05
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 1e-04
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 1e-04
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 2e-04
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 3e-04
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 6e-04
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Length = 93 Back     alignment and structure
 Score = 93.7 bits (233), Expect = 6e-25
 Identities = 19/89 (21%), Positives = 36/89 (40%)

Query: 103 KIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVP 162
            + +YST++   R+   +  +V +IL    +++   D+      + E +   G      P
Sbjct: 3   GLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNPKATPP 62

Query: 163 QIFVEGVHIGDADAIERLNESGELRRILK 191
           QI     + GD +      E   L+  LK
Sbjct: 63  QIVNGNHYCGDYELFVEAVEQDTLQEFLK 91


>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Length = 93 Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Length = 121 Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Length = 121 Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Length = 92 Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Length = 92 Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Length = 82 Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Length = 82 Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} Length = 99 Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} Length = 99 Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Length = 89 Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Length = 89 Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Length = 114 Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Length = 114 Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} Length = 114 Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} Length = 114 Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Length = 105 Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Length = 113 Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Length = 113 Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Length = 129 Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 130 Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Length = 127 Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Length = 118 Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Length = 146 Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Length = 85 Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Length = 85 Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Length = 362 Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Length = 109 Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} Length = 109 Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Length = 111 Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Length = 81 Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Length = 81 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Length = 92 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Length = 92 Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Length = 135 Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Length = 89 Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Length = 89 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Length = 75 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Length = 103 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Length = 103 Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Length = 87 Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Length = 87 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 99.88
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 99.86
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 99.85
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 99.85
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 99.85
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 99.84
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 99.84
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 99.83
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 99.82
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 99.81
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 99.81
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 99.81
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 99.78
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 99.78
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 99.77
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 99.73
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 99.7
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 99.69
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 99.67
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 99.67
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.66
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.65
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 99.65
1kte_A105 Thioltransferase; redox-active center, electron tr 99.64
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 99.63
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 99.63
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 99.63
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 99.61
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 99.6
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 99.6
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 99.59
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 99.59
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 99.59
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 99.59
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 99.59
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 99.57
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 99.56
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 99.52
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 99.52
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 99.52
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 99.52
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 99.51
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 99.49
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 99.47
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 99.46
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.43
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 99.38
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 99.38
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 99.36
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.36
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 99.36
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 99.35
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 99.33
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 99.33
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 99.33
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 99.32
1kte_A105 Thioltransferase; redox-active center, electron tr 99.32
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 99.32
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.28
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 99.27
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 99.25
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 99.22
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 99.22
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 99.22
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 99.21
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 99.21
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 99.19
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 99.16
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.13
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 99.09
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 98.96
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 98.9
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 98.89
1ttz_A87 Conserved hypothetical protein; structural genomic 98.88
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 98.85
1z3e_A132 Regulatory protein SPX; bacterial transcription re 98.85
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 98.84
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 98.79
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 98.78
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 98.72
1ttz_A87 Conserved hypothetical protein; structural genomic 98.72
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 98.71
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 98.55
2axo_A270 Hypothetical protein ATU2684; alpha beta protein., 98.5
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 98.46
3rdw_A121 Putative arsenate reductase; structural genomics, 98.46
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 98.37
2axo_A270 Hypothetical protein ATU2684; alpha beta protein., 98.37
3l78_A120 Regulatory protein SPX; transcription, transcripti 98.35
1z3e_A132 Regulatory protein SPX; bacterial transcription re 98.35
3gkx_A120 Putative ARSC family related protein; ARSC family 98.32
3fz4_A120 Putative arsenate reductase; APC61768, structural 98.29
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 98.29
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 98.22
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 98.16
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 98.15
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 97.95
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 97.91
3rdw_A121 Putative arsenate reductase; structural genomics, 97.89
3l78_A120 Regulatory protein SPX; transcription, transcripti 97.82
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 97.8
3gkx_A120 Putative ARSC family related protein; ARSC family 97.8
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 97.8
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 97.77
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 97.76
3fz4_A120 Putative arsenate reductase; APC61768, structural 97.73
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 97.7
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 97.67
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 97.6
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 97.53
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 97.47
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 97.45
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 97.38
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.31
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 97.22
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 97.18
2ahe_A267 Chloride intracellular channel protein 4; glutathi 97.12
2r4v_A247 XAP121, chloride intracellular channel protein 2; 97.09
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 97.07
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 97.02
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 96.94
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 96.94
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 96.89
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 96.87
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 96.85
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 96.82
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 96.81
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 96.81
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 96.78
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 96.77
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 96.75
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 96.74
2ahe_A 267 Chloride intracellular channel protein 4; glutathi 96.73
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 96.73
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 96.7
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 96.68
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 96.66
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 96.64
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 96.64
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 96.64
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 96.64
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 96.63
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 96.62
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 96.62
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 96.61
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 96.6
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 96.59
2yzu_A109 Thioredoxin; redox protein, electron transport, st 96.58
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 96.58
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 96.58
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 96.56
2r4v_A247 XAP121, chloride intracellular channel protein 2; 96.56
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 96.54
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 96.54
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 96.52
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 96.51
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 96.51
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 96.5
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 96.49
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 96.49
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 96.49
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 96.48
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 96.47
1zma_A118 Bacterocin transport accessory protein; alpha-beta 96.47
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 96.47
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 96.46
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 96.46
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 96.44
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 96.44
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 96.42
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 96.42
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 96.41
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 96.41
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 96.41
3lyk_A216 Stringent starvation protein A homolog; structural 96.4
3lyp_A215 Stringent starvation protein A; structural genomic 96.39
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 96.39
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 96.39
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 96.39
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 96.37
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 96.37
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 96.36
4dej_A231 Glutathione S-transferase related protein; transfe 96.34
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 96.33
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 96.32
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 96.3
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 96.27
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 96.27
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 96.27
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 96.27
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 96.26
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 96.26
2l57_A126 Uncharacterized protein; structural genomics, unkn 96.25
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 96.25
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 96.25
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 96.25
1axd_A209 Glutathione S-transferase I; transferase, herbicid 96.24
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 96.22
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 96.22
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 96.21
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 96.21
1axd_A209 Glutathione S-transferase I; transferase, herbicid 96.2
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 96.2
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 96.18
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 96.18
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 96.18
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 96.18
4g10_A 265 Glutathione S-transferase homolog; thioredoxin fol 96.18
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 96.17
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 96.16
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 96.15
3lyp_A215 Stringent starvation protein A; structural genomic 96.15
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 96.13
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 96.13
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 96.13
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 96.12
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 96.11
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 96.1
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 96.09
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 96.09
2yzu_A109 Thioredoxin; redox protein, electron transport, st 96.07
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 96.07
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 96.07
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 96.05
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 96.04
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 96.04
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 96.03
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 96.03
3n5o_A235 Glutathione transferase; seattle structural genomi 96.03
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 96.03
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 96.02
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 96.01
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 96.01
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 96.01
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 96.0
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 95.99
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 95.98
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 95.98
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 95.98
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 95.97
1z6m_A175 Conserved hypothetical protein; structural genomic 95.97
2l5l_A136 Thioredoxin; structural genomics, electron transpo 95.97
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 95.97
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 95.96
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 95.96
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 95.95
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 95.94
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 95.94
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 95.93
1exk_A79 DNAJ protein; extended beta-hairpin, CXXCXGXG, zin 95.92
3lyk_A216 Stringent starvation protein A homolog; structural 95.91
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 95.91
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 95.91
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 95.9
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 95.88
1mek_A120 Protein disulfide isomerase; electron transport, r 95.88
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 95.88
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 95.87
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 95.85
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 95.84
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 95.83
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 95.82
3lxz_A229 Glutathione S-transferase family protein; structur 95.82
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 95.82
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 95.82
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 95.81
4euy_A105 Uncharacterized protein; structural genomics, PSI- 95.81
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 95.8
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 95.8
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein 95.8
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 95.77
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 95.76
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 95.76
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 95.75
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 95.75
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 95.75
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 95.73
3ic8_A 310 Uncharacterized GST-like proteinprotein; glutathio 95.73
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 95.72
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 95.72
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 95.72
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 95.71
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 95.71
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 95.7
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 95.68
2ctt_A104 DNAJ homolog subfamily A member 3; ZING finger, be 95.66
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 95.66
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 95.64
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 95.63
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 95.62
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 95.61
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 95.59
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 95.58
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 95.58
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 95.57
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 95.55
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 95.54
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 95.52
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 95.52
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 95.5
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 95.5
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 95.47
3lxz_A229 Glutathione S-transferase family protein; structur 95.46
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 95.46
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 95.46
3n5o_A235 Glutathione transferase; seattle structural genomi 95.45
4dej_A231 Glutathione S-transferase related protein; transfe 95.45
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 95.45
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 95.45
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 95.44
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 95.44
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 95.44
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 95.44
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 95.43
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 95.43
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 95.42
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 95.41
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 95.4
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 95.39
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 95.38
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 95.38
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 95.36
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 95.34
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 95.34
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 95.34
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 95.33
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 95.33
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 95.32
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 95.31
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 95.3
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 95.3
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 95.29
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 95.28
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 95.28
3feu_A185 Putative lipoprotein; alpha-beta structure, struct 95.28
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 95.27
3ubk_A 242 Glutathione transferase; GSH binding; 1.95A {Lepto 95.26
1r5a_A218 Glutathione transferase; glutathione S-transferase 95.25
1wmj_A130 Thioredoxin H-type; structural genomics, program f 95.25
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 95.23
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 95.2
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 95.2
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 95.18
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 95.16
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 95.15
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 95.15
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 95.14
3niv_A222 Glutathione S-transferase; structural genomics, PS 95.13
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 95.12
1mek_A120 Protein disulfide isomerase; electron transport, r 95.11
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 95.11
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 95.09
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 95.05
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfid 95.05
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 95.04
1r5a_A218 Glutathione transferase; glutathione S-transferase 95.04
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 95.0
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 94.99
3niv_A222 Glutathione S-transferase; structural genomics, PS 94.99
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 94.98
1z9h_A 290 Membrane-associated prostaglandin E synthase-2; me 94.97
4ecj_A244 Glutathione S-transferase; transferase-like protei 94.97
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 94.94
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 94.94
4euy_A105 Uncharacterized protein; structural genomics, PSI- 94.93
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 94.93
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 94.92
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 94.92
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 94.91
1zma_A118 Bacterocin transport accessory protein; alpha-beta 94.88
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 94.88
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 94.87
2l57_A126 Uncharacterized protein; structural genomics, unkn 94.87
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 94.86
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 94.85
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 94.84
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 94.81
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 94.79
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 94.78
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 94.77
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 94.75
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 94.74
4exj_A238 Uncharacterized protein; transferase-like protein, 94.73
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 94.71
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-ox 94.68
4glt_A225 Glutathione S-transferase-like protein; structural 94.67
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 94.65
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 94.64
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 94.64
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 94.62
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 94.61
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 94.6
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 94.58
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 94.57
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 94.57
2yv9_A 291 Chloride intracellular channel EXC-4; chloride ION 94.57
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 94.56
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 94.55
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 94.55
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 94.52
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 94.45
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 94.43
4dvc_A184 Thiol:disulfide interchange protein DSBA; pilus as 94.36
4glt_A225 Glutathione S-transferase-like protein; structural 94.36
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 94.26
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 94.25
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 94.24
4exj_A238 Uncharacterized protein; transferase-like protein, 94.17
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 94.17
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 94.16
2kuc_A130 Putative disulphide-isomerase; structural genomics 94.14
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 94.13
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 94.1
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 94.09
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 94.05
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 94.05
3tou_A226 Glutathione S-transferase protein; GSH binding sit 94.0
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 93.99
4ikh_A244 Glutathione S-transferase; enzyme function initiat 93.98
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 93.98
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 93.95
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 93.94
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 93.89
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 93.85
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 93.84
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 93.82
3bci_A186 Disulfide bond protein A; thiol-disulfide oxidored 93.8
3gha_A202 Disulfide bond formation protein D; BDBD, DSBA-lik 93.74
1xg8_A111 Hypothetical protein SA0798; structural genomics, 93.69
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 93.68
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 93.67
3tou_A226 Glutathione S-transferase protein; GSH binding sit 93.66
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 93.66
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 93.48
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 93.44
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 93.43
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 93.42
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 93.41
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 93.41
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 93.4
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 93.39
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 93.3
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 93.2
4ikh_A244 Glutathione S-transferase; enzyme function initiat 93.12
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 93.12
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 93.11
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 92.24
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 93.1
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 92.99
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 92.97
1nlt_A 248 Protein YDJ1, mitochondrial protein import protein 92.93
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 92.08
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 92.85
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 92.84
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 92.83
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 92.77
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 92.72
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 92.68
3ktb_A106 Arsenical resistance operon trans-acting represso; 92.68
2l5l_A136 Thioredoxin; structural genomics, electron transpo 92.68
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 92.65
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 92.62
2imf_A203 HCCA isomerase, 2-hydroxychromene-2-carboxylate is 92.59
4ecj_A244 Glutathione S-transferase; transferase-like protei 92.59
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 92.52
3l9v_A189 Putative thiol-disulfide isomerase or thioredoxin; 92.52
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 92.52
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 92.51
1wmj_A130 Thioredoxin H-type; structural genomics, program f 92.49
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 92.49
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 92.47
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 92.41
2lrn_A152 Thiol:disulfide interchange protein; structural ge 92.38
1xg8_A111 Hypothetical protein SA0798; structural genomics, 92.38
2bx9_A53 Anti-trap, AT, tryptophan RNA-binding attenuator p 92.33
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 92.33
2fhe_A216 GST, glutathione S-transferase; transferase-substr 92.3
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 92.28
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 92.24
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 92.22
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 92.13
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 91.34
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 92.1
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 92.09
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 92.04
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 92.01
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 91.98
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 91.95
2lrn_A152 Thiol:disulfide interchange protein; structural ge 91.86
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 91.8
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 91.8
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 91.77
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 91.73
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 91.72
3lcz_A53 YCZA, inhibitor of trap, regulated by T-box (Trp) 91.68
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 91.65
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 90.9
2kuc_A130 Putative disulphide-isomerase; structural genomics 91.59
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 91.5
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 91.4
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
Probab=99.88  E-value=4.2e-23  Score=159.66  Aligned_cols=95  Identities=23%  Similarity=0.338  Sum_probs=85.2

Q ss_pred             ccchheeeeeeecccccCCCcchHHHHHHHHhcCC-ceeEEEcCCCHHHHHHHHHHhCCCCCCCceEEECCeeeCChHHH
Q psy15946         99 KEAGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLV-KFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGDADAI  177 (251)
Q Consensus        99 ~~~~~Vviyt~sl~~ir~tc~~C~~~k~lL~~~~v-~~~e~dv~~~~~~~~el~~~~g~~~~~vP~vfi~g~~iGG~d~l  177 (251)
                      +..++||||+++.. -.+.|++|.+++++|+++++ +|.++|+..+++.+++|.+++|  ++|+|||||+|++|||+|+|
T Consensus        17 i~~~~VvvF~Kgt~-~~P~C~fc~~ak~lL~~~gv~~~~~~~v~~~~~~r~~l~~~sg--~~TvPqIFI~g~~IGG~Ddl   93 (118)
T 2wul_A           17 VKKDKVVVFLKGTP-EQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSN--WPTIPQVYLNGEFVGGCDIL   93 (118)
T ss_dssp             HHHSSEEEEESBCS-SSBSSHHHHHHHHHHHHTTCCSCEEEETTSCHHHHHHHHHHHT--CCSSCEEEETTEEEECHHHH
T ss_pred             HhcCCEEEEEcCCC-CCCCCHHHHHHHHHHHHhCCcCeEeecccCCHHHHHHHHHhcc--CCCCCeEeECCEEECCHHHH
Confidence            45789999999731 22349999999999999999 6999999999999999999998  89999999999999999999


Q ss_pred             HHHHHcCChhhhhccCCCC
Q psy15946        178 ERLNESGELRRILKPYKSP  196 (251)
Q Consensus       178 ~~l~e~G~L~~~L~~~~~~  196 (251)
                      .+|+++|+|.++|+.+...
T Consensus        94 ~~l~~~GeL~~lL~~~Gi~  112 (118)
T 2wul_A           94 LQMHQNGDLVEELKKLGIH  112 (118)
T ss_dssp             HHHHHHTHHHHHHHHTTCC
T ss_pred             HHHHHCCCHHHHHHHcCCc
Confidence            9999999999999986643



>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>1exk_A DNAJ protein; extended beta-hairpin, CXXCXGXG, zinc-binding motif, chaperone; NMR {Escherichia coli} SCOP: g.54.1.1 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>2ctt_A DNAJ homolog subfamily A member 3; ZING finger, beta-hairpin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Back     alignment and structure
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Back     alignment and structure
>1xg8_A Hypothetical protein SA0798; structural genomics, protein structure initative, MCSG, PSI, protein structure initiative; 2.10A {Staphylococcus aureus subsp} SCOP: c.47.1.17 Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>1nlt_A Protein YDJ1, mitochondrial protein import protein MAS5; beta-strands, chaperone, heat shock, mitochondrion; 2.70A {Saccharomyces cerevisiae} SCOP: b.4.1.1 b.4.1.1 g.54.1.1 Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>3ktb_A Arsenical resistance operon trans-acting represso; alpha-beta-alpha sandwich, helix-turn-helix, structural GENO PSI-2; 2.10A {Bacteroides vulgatus} Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>2imf_A HCCA isomerase, 2-hydroxychromene-2-carboxylate isomerase; glutathione, KGST, kappa GST, transferase; HET: GSH TOM CXS; 1.30A {Pseudomonas putida} PDB: 2ime_A* 2imd_A* Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>1xg8_A Hypothetical protein SA0798; structural genomics, protein structure initative, MCSG, PSI, protein structure initiative; 2.10A {Staphylococcus aureus subsp} SCOP: c.47.1.17 Back     alignment and structure
>2bx9_A Anti-trap, AT, tryptophan RNA-binding attenuator protein-inhibit protein; transcription regulation; 2.80A {Bacillus subtilis} PDB: 2ko8_A* 2zp8_E* 2zp9_C* Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>3lcz_A YCZA, inhibitor of trap, regulated by T-box (Trp) seque; anti-trap, tryptophan RNA-binding attenuation PROT transcription attenuation; 2.06A {Bacillus licheniformis} PDB: 3ld0_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 251
d1t1va_93 c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [Tax 2e-21
d1t1va_93 c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [Tax 1e-14
d1wika_109 c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (M 9e-13
d1wika_109 c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (M 9e-06
d1fova_82 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 2e-11
d1fova_82 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 1e-05
d1egoa_85 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 2e-07
d1egoa_85 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 2e-06
d1ktea_105 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 5e-07
d1nm3a174 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hyb 2e-06
d1nm3a174 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hyb 2e-05
d1r7ha_74 c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Cory 4e-05
d1r7ha_74 c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Cory 7e-04
d1h75a_76 c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Esch 6e-05
d1abaa_87 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 3e-04
d1abaa_87 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 7e-04
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 93 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: SH3BGR (SH3-binding, glutamic acid-rich protein-like)
domain: SH3BGRL3
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 83.8 bits (207), Expect = 2e-21
 Identities = 19/90 (21%), Positives = 36/90 (40%)

Query: 102 GKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINV 161
             + +YST++   R+   +  +V +IL    +++   D+      + E +   G      
Sbjct: 2   SGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNPKATP 61

Query: 162 PQIFVEGVHIGDADAIERLNESGELRRILK 191
           PQI     + GD +      E   L+  LK
Sbjct: 62  PQIVNGNHYCGDYELFVEAVEQDTLQEFLK 91


>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 93 Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Length = 82 Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Length = 82 Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Length = 85 Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Length = 85 Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 105 Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 74 Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 74 Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Length = 74 Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Length = 74 Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Length = 87 Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 99.89
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 99.87
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 99.87
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 99.82
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 99.7
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 99.69
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 99.67
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 99.64
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 99.64
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 99.63
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 99.63
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 99.63
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 99.62
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 99.58
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 99.58
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 99.56
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 99.55
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 99.37
d1wjka_100 Thioredoxin-like structure containing protein C330 98.96
d1wjka_100 Thioredoxin-like structure containing protein C330 98.72
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 98.68
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 98.37
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 98.11
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 98.09
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 97.99
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 97.94
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 97.76
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 97.72
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 97.72
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 97.62
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 97.61
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 97.6
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 97.59
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 97.58
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 97.52
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 97.51
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 97.49
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 97.47
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 97.45
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 97.43
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 97.42
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 97.4
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 97.35
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 97.23
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 97.19
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 97.16
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 97.1
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 97.0
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 96.99
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 96.97
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 96.97
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 96.95
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 96.93
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 96.88
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 96.87
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 96.85
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 96.83
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 96.81
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 96.81
d1j9ba_138 Arsenate reductase ArsC {Escherichia coli [TaxId: 96.72
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 96.62
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 96.6
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 96.59
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 96.55
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 96.55
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 96.46
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 96.42
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 96.35
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 96.33
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 96.22
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 96.16
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 96.14
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 96.09
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 96.09
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 96.03
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 95.85
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 95.8
d1j9ba_138 Arsenate reductase ArsC {Escherichia coli [TaxId: 95.76
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 95.69
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 95.64
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 95.63
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 95.59
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 95.5
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 95.47
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 95.47
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 95.37
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 95.16
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 95.13
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 95.02
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 95.02
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 95.02
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 95.01
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 94.62
d1exka_79 Cysteine-rich domain of the chaperone protein DnaJ 94.6
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 94.59
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 94.59
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 94.56
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 94.52
d1xg8a_111 Hypothetical protein SA0798 {Staphylococcus aureus 94.25
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 94.2
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 94.18
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 94.15
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 94.09
d1nlta374 Mitochondrial protein import protein mas5 (Hsp40, 94.08
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 94.01
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 93.9
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 93.81
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 93.72
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 93.72
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 93.61
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 93.6
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 93.6
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 93.58
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 93.58
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 93.55
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 93.27
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 92.83
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 92.78
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 92.78
d1xg8a_111 Hypothetical protein SA0798 {Staphylococcus aureus 92.52
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 92.48
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 92.12
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 92.1
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 92.03
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 91.93
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 91.85
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 91.18
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 91.15
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 90.76
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 90.73
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 90.6
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 90.47
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 90.32
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 90.18
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 89.91
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 89.71
d2axoa1225 Hypothetical protein Atu2684 {Agrobacterium tumefa 89.68
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 89.6
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 89.53
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 89.05
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 88.7
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 88.64
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 88.28
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 88.25
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 88.01
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 87.79
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 87.41
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 87.25
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 87.18
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 87.03
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 86.22
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 85.86
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 85.71
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 85.67
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 85.19
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 84.89
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 84.34
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 83.93
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 82.91
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 82.88
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 82.18
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 82.11
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 82.03
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 81.7
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 81.67
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 81.05
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 81.04
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 80.76
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 80.41
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: SH3BGR (SH3-binding, glutamic acid-rich protein-like)
domain: SH3BGRL3
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.89  E-value=8.1e-24  Score=155.54  Aligned_cols=92  Identities=21%  Similarity=0.253  Sum_probs=86.9

Q ss_pred             chheeeeeeecccccCCCcchHHHHHHHHhcCCceeEEEcCCCHHHHHHHHHHhCCCCCCCceEEECCeeeCChHHHHHH
Q psy15946        101 AGKIVMYSTTMGIVRDTYHRCLKVKQILRTHLVKFDDKDVFMSRETQQEFKERLGTDVINVPQIFVEGVHIGDADAIERL  180 (251)
Q Consensus       101 ~~~Vviyt~sl~~ir~tc~~C~~~k~lL~~~~v~~~e~dv~~~~~~~~el~~~~g~~~~~vP~vfi~g~~iGG~d~l~~l  180 (251)
                      |..|+||+||+.++|.+.++|.+++++|++++|+|+++||+.|++.++++.+++|.+..++|||||||+||||+|++.+|
T Consensus         1 m~~i~vy~ts~~~~~~~~~~~~r~~~lL~~~~I~y~~iDi~~d~~~~~~~~~~~g~~~~t~Pqifv~~~~iGg~del~~~   80 (93)
T d1t1va_           1 MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNPKATPPQIVNGNHYCGDYELFVEA   80 (93)
T ss_dssp             CCCEEEEECSSCSCHHHHHHHHHHHHHHHHTTCCCEEEETTSCHHHHHHHHHHTTCTTCCSCEEEETTEEEEEHHHHHHH
T ss_pred             CCCEEEEEccCcCChhhHHHHHHHHHHHHHCCCceEEEEecCchhHHHHHHHhccCCCceeEEEEECCEEEecHHHHHHH
Confidence            35699999999999999999999999999999999999999999999999999875567999999999999999999999


Q ss_pred             HHcCChhhhhcc
Q psy15946        181 NESGELRRILKP  192 (251)
Q Consensus       181 ~e~G~L~~~L~~  192 (251)
                      +++|+|.++|+.
T Consensus        81 ~e~g~L~~~lk~   92 (93)
T d1t1va_          81 VEQDTLQEFLKL   92 (93)
T ss_dssp             HHTTCHHHHTTC
T ss_pred             HHCCCHHHHhcc
Confidence            999999999975



>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1exka_ g.54.1.1 (A:) Cysteine-rich domain of the chaperone protein DnaJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1xg8a_ c.47.1.17 (A:) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1xg8a_ c.47.1.17 (A:) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure