Psyllid ID: psy15967

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280
MSFPAYYSYTALNFVFSPGDYICRKGDVGKEMYIVKRGKLNVVADDEETVLATLSAGSVFGEVRHVLGVDLGRITSFCSKGYEIPNTKWLNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLADYPEARHSLMERGCQLLRKDGLLDEEAFRNSQVEHEALKDTVRRLDTTLEHLQTRFARLMAEYLSQQAKMKQRLALLEQGASVNQATSSKRNSQAEPTHPEDVRNSKCLLSPGFLSDGLVEDTTTSPVAPRR
ccccccccccEEEEEEccccEEEEccccccEEEEEEEcEEEEEEccccEEEEEEccccEEccccccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccEEEEEcccEEEEEEEEHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccEEEEEEEEEEEEccccEEEEccccccEEEEEEccEEEEEEcccEEEEEEEcccccEEEEEEEEcccccEEEEEccccccccccHHHHHHEEcccccccccccccccEEEEccccccccccEEEEEcccccEEEEcHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHcccccccccccccccccc
msfpayysYTALnfvfspgdyicrkgdvgkemyivkrgklnvvaddEETVLATLSAGSVFGEVRHVLGVDLGRITSfcskgyeipntkWLNLIVKAQPMKLRKTVLNKVSVLEIagnrtgnrrtanvrslgysdlfCLAKRDLWETLADYPEARHSLMERGCQLlrkdglldeeafRNSQVEHEALKDTVRRLDTTLEHLQTRFARLMAEYLSQQAKMKQRLALLEQgasvnqatsskrnsqaepthpedvrnskcllspgflsdglvedtttspvaprr
MSFPAYYSYTALNFVFSPGDYICRKGDVGKEMYIVKRGklnvvaddEETVLATlsagsvfgevRHVLGVDLGRITSFCSKgyeipntkwLNLIVKAQPMKLRKTVLNKVSvleiagnrtgnrrtanvrslgysDLFCLAKRDLWETLADYPEARHSLMERGCQLLRKDGLLDEEAFRNSQVEHEALKDTVRRLDTTLEHLQTRFARLMAEYLSQQAKMKQRLALLEQGASvnqatsskrnsqaepthpedvrnskcllspgflsdglvedtttspvaprr
MSFPAYYSYTALNFVFSPGDYICRKGDVGKEMYIVKRGKLNVVADDEETVLATLSAGSVFGEVRHVLGVDLGRITSFCSKGYEIPNTKWLNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLADYPEARHSLMERGCQLLRKDGLLDEEAFRNSQVEHEALKDTVRRLDTTLEHLQTRFARLMAEYLSQQAKMKQRLALLEQGASVNQATSSKRNSQAEPTHPEDVRNSKCLLSPGFLSDGLVEDTTTSPVAPRR
***PAYYSYTALNFVFSPGDYICRKGDVGKEMYIVKRGKLNVVADDEETVLATLSAGSVFGEVRHVLGVDLGRITSFCSKGYEIPNTKWLNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLADYPEARHSLMERGCQLLRKDGLLDEEAF********ALKDTVRRLDTTLEHLQTRFARLMAEYL********************************************************************
*SFPAYYSYTALNFVFSPGDYICRKGDVGKEMYIVKRGKLNVVADDEETVLATLSAGSVFGEVRHVLGVDLGRITSFCSKGYEIPNTKWL*********KLRKTVLNKVSVLEIAG**TGNRRTANVRSLGYSDLFCLAKRDLWETLADYPEARHSLMERG***********************************************************************************************************************
MSFPAYYSYTALNFVFSPGDYICRKGDVGKEMYIVKRGKLNVVADDEETVLATLSAGSVFGEVRHVLGVDLGRITSFCSKGYEIPNTKWLNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLADYPEARHSLMERGCQLLRKDGLLDEEAFRNSQVEHEALKDTVRRLDTTLEHLQTRFARLMAEYLSQQAKMKQRLALLEQG***********************RNSKCLLSPGFLSDGLVE***********
*SFPAYYSYTALNFVFSPGDYICRKGDVGKEMYIVKRGKLNVVADDEETVLATLSAGSVFGEVRHVLGVDLGRITSFCSKGYEIPNTKWLNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLADYPEARHSLMERGCQLLRKDGLLDEEAFRNSQVEHEALKDTVRRLDTTLEHLQTRFARLMAEYLSQQAKMKQRLALLEQGA****************************L*********V************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFPAYYSYTALNFVFSPGDYICRKGDVGKEMYIVKRGKLNVVADDEETVLATLSAGSVFGEVRHVLGVDLGRITSFCSKGYEIPNTKWLNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLADYPEARHSLMERGCQLLRKDGLLDEEAFRNSQVExxxxxxxxxxxxxxxxxxxxxxxxxxxxYLSQQAKMKQRLALLEQGASVNQATSSKRNSQAEPTHPEDVRNSKCLLSPGFLSDGLVEDTTTSPVAPRR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query280 2.2.26 [Sep-21-2011]
Q24278665 Cyclic nucleotide-gated c no N/A 0.592 0.249 0.599 9e-64
Q90805735 Cyclic nucleotide-gated c yes N/A 0.589 0.224 0.476 1e-46
Q16281694 Cyclic nucleotide-gated c yes N/A 0.589 0.237 0.471 6e-46
Q03041663 Cyclic nucleotide-gated o yes N/A 0.660 0.279 0.438 3e-45
Q62398664 Cyclic nucleotide-gated o yes N/A 0.607 0.256 0.459 1e-44
Q00195664 Cyclic nucleotide-gated o no N/A 0.664 0.280 0.441 2e-44
Q28718664 Cyclic nucleotide-gated o no N/A 0.582 0.245 0.464 2e-44
Q29441706 Cyclic nucleotide-gated c no N/A 0.589 0.233 0.452 3e-44
Q9JJZ8631 Cyclic nucleotide-gated c no N/A 0.589 0.261 0.452 3e-44
Q16280664 Cyclic nucleotide-gated o no N/A 0.610 0.257 0.452 8e-44
>sp|Q24278|CNG_DROME Cyclic nucleotide-gated cation channel OS=Drosophila melanogaster GN=Cng PE=2 SV=2 Back     alignment and function desciption
 Score =  243 bits (621), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 127/212 (59%), Positives = 146/212 (68%), Gaps = 46/212 (21%)

Query: 15  VFSPGDYICRKGDVGKEMYIVKRGKLNVVADDEETVLATLSAGSVFGEVRHVLGVDLGRI 74
           VFSPGDYICRKGDVGKEMYIVKRGKL+VV DD  TVLATL AGSVFGE            
Sbjct: 449 VFSPGDYICRKGDVGKEMYIVKRGKLSVVGDDGITVLATLGAGSVFGE------------ 496

Query: 75  TSFCSKGYEIPNTKWLNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVRSLGYSD 134
                                             VSVLEIAGNRTGNRRTANVRSLGYSD
Sbjct: 497 ----------------------------------VSVLEIAGNRTGNRRTANVRSLGYSD 522

Query: 135 LFCLAKRDLWETLADYPEARHSLMERGCQLLRKDGLLDEEAFRNSQVEHEALKDTVRRLD 194
           LFCLAKRDLWETL+DYPEAR +L +RGCQLLRKDGLLDE+ F +SQ  H++++  + +L+
Sbjct: 523 LFCLAKRDLWETLSDYPEARSTLTQRGCQLLRKDGLLDEQIFADSQRVHDSIEGGIEKLE 582

Query: 195 TTLEHLQTRFARLMAEYLSQQAKMKQRLALLE 226
            ++E+L  R ARL+AEY + QAK+KQRLA LE
Sbjct: 583 LSVENLNMRLARLLAEYTASQAKIKQRLAKLE 614
Approximately 50-fold more sensitive to cGMP than to cAMP. May be involved in transduction cascades of both invertebrate photoreceptors and olfactory sensillae.
Drosophila melanogaster (taxid: 7227)
>sp|Q90805|CNG1_CHICK Cyclic nucleotide-gated channel cone photoreceptor subunit alpha OS=Gallus gallus PE=2 SV=1 Back     alignment and function description
>sp|Q16281|CNGA3_HUMAN Cyclic nucleotide-gated cation channel alpha-3 OS=Homo sapiens GN=CNGA3 PE=1 SV=2 Back     alignment and function description
>sp|Q03041|CNGA2_BOVIN Cyclic nucleotide-gated olfactory channel OS=Bos taurus GN=CNGA2 PE=1 SV=1 Back     alignment and function description
>sp|Q62398|CNGA2_MOUSE Cyclic nucleotide-gated olfactory channel OS=Mus musculus GN=Cnga2 PE=2 SV=2 Back     alignment and function description
>sp|Q00195|CNGA2_RAT Cyclic nucleotide-gated olfactory channel OS=Rattus norvegicus GN=Cnga2 PE=2 SV=1 Back     alignment and function description
>sp|Q28718|CNGA2_RABIT Cyclic nucleotide-gated olfactory channel OS=Oryctolagus cuniculus GN=CNGA2 PE=2 SV=1 Back     alignment and function description
>sp|Q29441|CNGA3_BOVIN Cyclic nucleotide-gated cation channel alpha-3 OS=Bos taurus GN=CNGA3 PE=2 SV=1 Back     alignment and function description
>sp|Q9JJZ8|CNGA3_MOUSE Cyclic nucleotide-gated cation channel alpha-3 OS=Mus musculus GN=Cnga3 PE=1 SV=2 Back     alignment and function description
>sp|Q16280|CNGA2_HUMAN Cyclic nucleotide-gated olfactory channel OS=Homo sapiens GN=CNGA2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
242007306 513 voltage-activated ion channel, putative 0.596 0.325 0.596 5e-63
195383010 663 GJ22023 [Drosophila virilis] gi|19414501 0.65 0.274 0.567 1e-62
195430604 661 GK21437 [Drosophila willistoni] gi|19415 0.607 0.257 0.592 1e-62
195121214 671 GI20296 [Drosophila mojavensis] gi|19391 0.660 0.275 0.567 2e-62
194757253 665 GF11279 [Drosophila ananassae] gi|190622 0.592 0.249 0.603 2e-62
320544039 840 Cyclic-nucleotide-gated ion channel prot 0.592 0.197 0.599 4e-62
195488278 665 GE14082 [Drosophila yakuba] gi|194178348 0.592 0.249 0.599 5e-62
195334859 665 GM20074 [Drosophila sechellia] gi|194126 0.592 0.249 0.599 5e-62
1079165 665 DmCNGC protein - fruit fly (Drosophila s 0.592 0.249 0.599 5e-62
17137122 665 Cyclic-nucleotide-gated ion channel prot 0.592 0.249 0.599 5e-62
>gi|242007306|ref|XP_002424482.1| voltage-activated ion channel, putative [Pediculus humanus corporis] gi|212507900|gb|EEB11744.1| voltage-activated ion channel, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  247 bits (630), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 127/213 (59%), Positives = 146/213 (68%), Gaps = 46/213 (21%)

Query: 15  VFSPGDYICRKGDVGKEMYIVKRGKLNVVADDEETVLATLSAGSVFGEVRHVLGVDLGRI 74
           VFSPGDYICRKGDVGKEMYIVKRG+L+VVADD +TVLATL AGSVFGE            
Sbjct: 337 VFSPGDYICRKGDVGKEMYIVKRGRLSVVADDGDTVLATLGAGSVFGE------------ 384

Query: 75  TSFCSKGYEIPNTKWLNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVRSLGYSD 134
                                             VSVLEIAGNRTGNRRTANVRSLGYSD
Sbjct: 385 ----------------------------------VSVLEIAGNRTGNRRTANVRSLGYSD 410

Query: 135 LFCLAKRDLWETLADYPEARHSLMERGCQLLRKDGLLDEEAFRNSQVEHEALKDTVRRLD 194
           LFCLAKRDLWE L DYP+ARHSLMERGCQLLRKDGLLDE AF+ SQVEHE LKD V RL+
Sbjct: 411 LFCLAKRDLWEALVDYPDARHSLMERGCQLLRKDGLLDENAFKKSQVEHETLKDKVDRLE 470

Query: 195 TTLEHLQTRFARLMAEYLSQQAKMKQRLALLEQ 227
           +++E+L+ +  +L+ +      +MK+R + +EQ
Sbjct: 471 SSIENLEDKLTQLIGDVTVFHNRMKRRASKIEQ 503

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195383010|ref|XP_002050219.1| GJ22023 [Drosophila virilis] gi|194145016|gb|EDW61412.1| GJ22023 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195430604|ref|XP_002063344.1| GK21437 [Drosophila willistoni] gi|194159429|gb|EDW74330.1| GK21437 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195121214|ref|XP_002005115.1| GI20296 [Drosophila mojavensis] gi|193910183|gb|EDW09050.1| GI20296 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|194757253|ref|XP_001960879.1| GF11279 [Drosophila ananassae] gi|190622177|gb|EDV37701.1| GF11279 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|320544039|ref|NP_001188960.1| Cyclic-nucleotide-gated ion channel protein, isoform B [Drosophila melanogaster] gi|318068630|gb|ADV37206.1| Cyclic-nucleotide-gated ion channel protein, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195488278|ref|XP_002092247.1| GE14082 [Drosophila yakuba] gi|194178348|gb|EDW91959.1| GE14082 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195334859|ref|XP_002034094.1| GM20074 [Drosophila sechellia] gi|194126064|gb|EDW48107.1| GM20074 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|1079165|pir||S52072 DmCNGC protein - fruit fly (Drosophila sp.) gi|908846|emb|CAA61760.1| CNG channel [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|17137122|ref|NP_477116.1| Cyclic-nucleotide-gated ion channel protein, isoform A [Drosophila melanogaster] gi|19863708|sp|Q24278.2|CNG_DROME RecName: Full=Cyclic nucleotide-gated cation channel; Short=CNG channel gi|7302962|gb|AAF58033.1| Cyclic-nucleotide-gated ion channel protein, isoform A [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query280
ZFIN|ZDB-GENE-090312-121718 cnga3b "cyclic nucleotide gate 0.421 0.164 0.487 2.5e-42
FB|FBgn0261612665 Cng "Cyclic-nucleotide-gated i 0.439 0.184 0.691 1.2e-41
ZFIN|ZDB-GENE-090611-2706 cnga3a "cyclic nucleotide gate 0.421 0.167 0.487 1.7e-41
UNIPROTKB|J9PBJ1535 CNGA4 "Uncharacterized protein 0.425 0.222 0.470 1.7e-37
UNIPROTKB|Q8IV77575 CNGA4 "Cyclic nucleotide-gated 0.425 0.206 0.470 2.5e-37
UNIPROTKB|E2QZW5575 CNGA4 "Uncharacterized protein 0.425 0.206 0.470 2.6e-37
UNIPROTKB|F1RMM3575 CNGA4 "Uncharacterized protein 0.425 0.206 0.470 3.3e-37
MGI|MGI:2664099575 Cnga4 "cyclic nucleotide gated 0.425 0.206 0.462 3.3e-37
RGD|619844575 Cnga4 "cyclic nucleotide gated 0.425 0.206 0.462 3.3e-37
UNIPROTKB|F1MM42575 CNGA4 "Uncharacterized protein 0.425 0.206 0.470 4.3e-37
ZFIN|ZDB-GENE-090312-121 cnga3b "cyclic nucleotide gated channel alpha 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 297 (109.6 bits), Expect = 2.5e-42, Sum P(2) = 2.5e-42
 Identities = 58/119 (48%), Positives = 89/119 (74%)

Query:   108 KVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLADYPEARHSLMERGCQLLRK 167
             ++S+L I G++ GNRRTAN+RS+GYSDLF L+K DL + L++YPEA+ +L E+G  +L K
Sbjct:   580 EISILGIKGSKAGNRRTANIRSVGYSDLFALSKDDLMDALSEYPEAKKALEEKGRAILMK 639

Query:   168 DGLLDEEAFRNSQVEHEALKDTVRRLDTTLEHLQTRFARLMAEYLSQQAKMKQRLALLE 226
             D L+DE A  N+  + + L++ V  L T L+ +QT+FARLMA++ + Q+++KQRL  +E
Sbjct:   640 DNLIDEAA-ANAGADAKDLEEKVNLLGTNLDVMQTKFARLMADWTASQSRIKQRLTNME 697
GO:0006811 "ion transport" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0005216 "ion channel activity" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
FB|FBgn0261612 Cng "Cyclic-nucleotide-gated ion channel protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090611-2 cnga3a "cyclic nucleotide gated channel alpha 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9PBJ1 CNGA4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IV77 CNGA4 "Cyclic nucleotide-gated cation channel alpha-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZW5 CNGA4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMM3 CNGA4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2664099 Cnga4 "cyclic nucleotide gated channel alpha 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619844 Cnga4 "cyclic nucleotide gated channel alpha 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MM42 CNGA4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 6e-12
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 1e-11
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 1e-09
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information 
 Score = 60.8 bits (148), Expect = 6e-12
 Identities = 32/147 (21%), Positives = 46/147 (31%), Gaps = 55/147 (37%)

Query: 15  VFSPGDYICRKGDVGKEMYIVKRGKLNVVADDE---ETVLATLSAGSVFGEVRHVLGVDL 71
            F  G+ I R+GD    +YIV  G + V   DE   E ++  L  G +F           
Sbjct: 21  RFPAGEVIIRQGDPADSLYIVLSGSVEVYKLDEDGREQIVGFLGPGDLF----------- 69

Query: 72  GRITSFCSKGYEIPNTKWLNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVRSLG 131
           G +                                                R+A VR+L 
Sbjct: 70  GELALLG-----------------------------------------NGPRSATVRALT 88

Query: 132 YSDLFCLAKRDLWETLADYPEARHSLM 158
            S+L  L + D    L +YPE    L+
Sbjct: 89  DSELLVLPRSDFRRLLQEYPELARRLL 115

In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 280
KOG0500|consensus536 99.85
PRK09391230 fixK transcriptional regulator FixK; Provisional 99.71
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 99.71
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.7
PRK11161235 fumarate/nitrate reduction transcriptional regulat 99.68
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.67
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.65
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.62
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.6
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.48
cd00038115 CAP_ED effector domain of the CAP family of transc 99.31
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.24
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.22
KOG0498|consensus727 99.18
COG2905 610 Predicted signal-transduction protein containing c 99.15
KOG0499|consensus815 99.09
PLN02868 413 acyl-CoA thioesterase family protein 98.92
KOG0501|consensus 971 98.48
KOG0614|consensus 732 98.44
KOG1113|consensus368 98.38
KOG2968|consensus 1158 98.22
KOG0614|consensus 732 98.13
KOG1113|consensus368 97.93
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 97.71
KOG2968|consensus 1158 97.67
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 97.46
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 97.36
PRK11832207 putative DNA-binding transcriptional regulator; Pr 97.1
PRK09392236 ftrB transcriptional activator FtrB; Provisional 97.1
PF04831153 Popeye: Popeye protein conserved region; InterPro: 97.08
PRK09391230 fixK transcriptional regulator FixK; Provisional 97.03
PRK11161235 fumarate/nitrate reduction transcriptional regulat 96.85
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 95.58
KOG3542|consensus 1283 95.25
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 95.11
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 95.04
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 93.76
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 86.28
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 82.07
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 80.05
>KOG0500|consensus Back     alignment and domain information 
Probab=99.85  E-value=2.3e-20  Score=179.94  Aligned_cols=177  Identities=59%  Similarity=0.905  Sum_probs=162.7

Q ss_pred             CCEEEEeCCCCEEEcCCCcCCeEEEEeeeEEEEEEcCCcEEEEEecCCCEecchhhhhccccccccccccCCCCchhhhH
Q psy15967         10 TALNFVFSPGDYICRKGDVGKEMYIVKRGKLNVVADDEETVLATLSAGSVFGEVRHVLGVDLGRITSFCSKGYEIPNTKW   89 (280)
Q Consensus        10 ~~~~~~f~kGeiI~~qGd~~~~iyiIlsG~Vkv~~~dGe~il~~l~~GD~fGe~~~v~~i~~~~l~~~~~~~~~~~~~~~   89 (280)
                      ..+...|+|||+|++.||.+..+|||.+|++.|..+||..++..+.+|++|||.                          
T Consensus       329 klk~qvfSPgDyICrKGdvgkEMyIVk~G~L~Vv~dDg~t~~~~L~~G~~FGEi--------------------------  382 (536)
T KOG0500|consen  329 KLKPQVFSPGDYICRKGDVGKEMYIVKEGKLAVVADDGVTVFVTLKAGSVFGEI--------------------------  382 (536)
T ss_pred             HhcceeeCCCCeEEecCcccceEEEEEccEEEEEecCCcEEEEEecCCceeeee--------------------------
Confidence            678899999999999999999999999999999999998889999999999999                          


Q ss_pred             HhHHHhhccchhhhhhhcchhhhhhcccccCCcccceEEEccccceeeechHHHHHHHhhCHHHHHHHHHHHHHHHHHcc
Q psy15967         90 LNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLADYPEARHSLMERGCQLLRKDG  169 (280)
Q Consensus        90 ~~l~~k~~~~~~~~rl~~~~~lL~~~~~~~~~~~~~~v~alt~s~l~~l~~~~~~~lLa~~~~~~r~~lsr~~~rL~~~g  169 (280)
                                          ++++..+.++|++++++++.+.+|++++++|+|+.+.|.+||.....++...-+-|.++|
T Consensus       383 --------------------sIlni~g~~~gNRRtanvrSvGYSDlfvLskdDl~~aL~eYP~a~~~L~~kgr~iL~kd~  442 (536)
T KOG0500|consen  383 --------------------SILNIKGNKNGNRRTANVRSVGYSDLFVLSKDDLWEALSEYPDARKRLEEKGRQILHKDG  442 (536)
T ss_pred             --------------------EEEEEcCcccCCcceeeeeeeccceeeEeeHHHHHHHHHhCCHHHHHHHHHHHHHhhhcc
Confidence                                999999999999999999999999999999999999999999999999988888999999


Q ss_pred             cchHHHhhchhhhhhhhccHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHhhcccch
Q psy15967        170 LLDEEAFRNSQVEHEALKDTVRRLDTTLEHLQTRFARLMAEYLSQQAKMKQRLALLEQGASVN  232 (280)
Q Consensus       170 li~~~~~~~~~~~~~~l~~~~~rl~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~  232 (280)
                      +++.+......-..+..++..+-|...+..+++|++++.+|+-+.+.+|+||+..+|......
T Consensus       443 lld~~~~~~~~~~~d~~E~~~~~Le~~~~~l~~Rl~~i~~e~~~~~~km~qr~~~le~~~~~~  505 (536)
T KOG0500|consen  443 LLDENELGAMQDPSDDEEKRDESLENEVVLLQLRLARILDEYHSSQQKMKQRLSVLEKQLKPG  505 (536)
T ss_pred             ccchhhhhhccCcccchhHHHHHHHHHHHHHHHHHHHHHhhhhhhhHHHHHHHHHHHHHhhhh
Confidence            999877755555556566666668999999999999999999999999999999999877665

>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
3etq_A204 X-Ray Structure Of Cysteine-Free Fragment Of Mhcn2 4e-08
3u11_A210 Tetramerization Dynamics Of The C-Terminus Underlie 7e-07
3u10_A210 Tetramerization Dynamics Of The C-Terminus Underlie 8e-07
1q3e_A207 Hcn2j 443-645 In The Presence Of Cgmp Length = 207 8e-07
4hbn_A205 Crystal Structure Of The Human Hcn4 Channel C-termi 8e-07
3otf_A220 Structural Basis For The Camp-Dependent Gating In H 8e-07
3bpz_A202 Hcn2-I 443-460 E502k In The Presence Of Camp Length 9e-07
3ffq_A202 Hcn2i 443-640 Apo-State Length = 202 9e-07
2q0a_A200 Structure And Rearrangements In The Carboxy-Termina 9e-07
3swy_A46 Cnga3 626-672 Containing Clz Domain Length = 46 2e-06
3u0z_A210 Tetramerization Dynamics Of The C-Terminus Underlie 2e-06
1q43_A207 Hcn2i 443-640 In The Presence Of Camp, Selenomethio 9e-06
3swf_A74 Cnga1 621-690 Containing Clz Domain Length = 74 1e-05
2ptm_A198 Structure And Rearrangements In The Carboxy-Termina 3e-05
>pdb|3ETQ|A Chain A, X-Ray Structure Of Cysteine-Free Fragment Of Mhcn2 C- Terminal Region From Amino Acids 443-630 Including C508n, C584s, And C601s Mutations Length = 204 Back     alignment and structure 
Iteration: 1

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 62/149 (41%), Gaps = 55/149 (36%)
Query: 10  TALNF-VFSPGDYICRKGDVGKEMYIVKRGKLNVVADDEETVLATLSAGSVFGEVRHVLG 68
           T L F VF PGDYI R+G +GK+MY ++ G ++V+    + +   LS GS FGE+     
Sbjct: 95  TKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEM--KLSDGSYFGEI----- 147
Query: 69  VDLGRITSFCSKGYEIPNTKWLNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVR 128
                  S  ++G                                        RRTA+VR
Sbjct: 148 -------SLLTRG----------------------------------------RRTASVR 160
Query: 129 SLGYSDLFCLAKRDLWETLADYPEARHSL 157
           +  YS L+ L+  +  E L +YP  R + 
Sbjct: 161 ADTYSRLYSLSVDNFNEVLEEYPMMRRAF 189
>pdb|3U11|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|3U10|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|1Q3E|A Chain A, Hcn2j 443-645 In The Presence Of Cgmp Length = 207 Back     alignment and structure
>pdb|4HBN|A Chain A, Crystal Structure Of The Human Hcn4 Channel C-terminus Carrying The S672r Mutation Length = 205 Back     alignment and structure
>pdb|3OTF|A Chain A, Structural Basis For The Camp-Dependent Gating In Human Hcn4 Channel Length = 220 Back     alignment and structure
>pdb|3BPZ|A Chain A, Hcn2-I 443-460 E502k In The Presence Of Camp Length = 202 Back     alignment and structure
>pdb|3FFQ|A Chain A, Hcn2i 443-640 Apo-State Length = 202 Back     alignment and structure
>pdb|2Q0A|A Chain A, Structure And Rearrangements In The Carboxy-Terminal Region Of Spih Channels Length = 200 Back     alignment and structure
>pdb|3SWY|A Chain A, Cnga3 626-672 Containing Clz Domain Length = 46 Back     alignment and structure
>pdb|3U0Z|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|1Q43|A Chain A, Hcn2i 443-640 In The Presence Of Camp, Selenomethionine Derivative Length = 207 Back     alignment and structure
>pdb|3SWF|A Chain A, Cnga1 621-690 Containing Clz Domain Length = 74 Back     alignment and structure
>pdb|2PTM|A Chain A, Structure And Rearrangements In The Carboxy-Terminal Region Of Spih Channels Length = 198 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query280
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 2e-29
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 4e-29
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 7e-28
3ukn_A212 Novel protein similar to vertebrate potassium VOL 5e-26
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 7e-24
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 4e-17
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 1e-12
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 2e-12
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 3e-12
2pqq_A149 Putative transcriptional regulator; APC7345, strep 7e-12
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 2e-11
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 4e-11
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 1e-10
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 2e-10
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 1e-09
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 1e-08
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 2e-09
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 3e-09
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 4e-09
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 7e-08
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 7e-09
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 2e-07
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 1e-08
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 1e-08
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 2e-08
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 2e-08
4din_B381 CAMP-dependent protein kinase type I-beta regulat 3e-08
4din_B381 CAMP-dependent protein kinase type I-beta regulat 4e-06
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 3e-08
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 3e-08
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 1e-07
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 1e-05
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 2e-07
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 3e-07
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 4e-07
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 5e-07
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 1e-06
1ft9_A222 Carbon monoxide oxidation system transcription reg 1e-06
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 4e-06
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 6e-06
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 7e-06
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 8e-06
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 1e-05
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 2e-05
3b02_A195 Transcriptional regulator, CRP family; structural 3e-05
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 5e-05
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 2e-04
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 4e-04
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
 Score =  108 bits (272), Expect = 2e-29
 Identities = 37/162 (22%), Positives = 49/162 (30%), Gaps = 55/162 (33%)

Query: 15  VFSPGDYICRKGDVGKEMYIVKRGKLNVVADDEETVLATLSAGSVFGEVRHVLGVDLGRI 74
             +PGD I   G+    +  V  G L V+ DDE  V+A L  G VFG+            
Sbjct: 54  HCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDE--VVAILGKGDVFGD------------ 99

Query: 75  TSFCSKGYEIPNTKWLNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVRSLGYSD 134
                                             V         T  +  ANVR+L Y D
Sbjct: 100 ----------------------------------VFWK----EATLAQSCANVRALTYCD 121

Query: 135 LFCLAKRDLWETLADYPEARHSLMERGCQLLRKDGLLDEEAF 176
           L  + +  L + L  Y    HS       L+    L     F
Sbjct: 122 LHVIKRDALQKVLEFYTAFSHSFSR---NLILTYNLRKRIVF 160
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Length = 46 Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Length = 74 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.75
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.74
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 99.74
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 99.73
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.73
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 99.73
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 99.72
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.72
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 99.72
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 99.72
1ft9_A222 Carbon monoxide oxidation system transcription reg 99.71
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.71
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.71
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.71
3b02_A195 Transcriptional regulator, CRP family; structural 99.7
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.68
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 99.68
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.68
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.68
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.67
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.64
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.64
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.64
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.63
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 99.62
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.62
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.6
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.58
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.57
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.57
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.56
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 99.53
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.5
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.48
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.48
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.41
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.41
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.39
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.37
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.36
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.36
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.36
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.36
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.33
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.3
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.29
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.26
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.24
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.12
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.07
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 98.99
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 98.91
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 98.32
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 98.11
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 97.76
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 97.71
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 97.69
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 97.68
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 97.67
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 97.63
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 97.59
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 97.59
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 97.55
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 97.55
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 97.49
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 97.37
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 97.35
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 97.1
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 97.07
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 97.0
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 96.8
1ft9_A222 Carbon monoxide oxidation system transcription reg 96.53
3b02_A195 Transcriptional regulator, CRP family; structural 95.75
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 95.08
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 93.53
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
Probab=99.75  E-value=1.8e-17  Score=140.05  Aligned_cols=157  Identities=8%  Similarity=0.056  Sum_probs=99.1

Q ss_pred             CCEEEEeCCCCEEEcCCCcCCeEEEEeeeEEEEEE--cCC-cEEEEEecCCCEecchhhhhccccccccccccCCCCchh
Q psy15967         10 TALNFVFSPGDYICRKGDVGKEMYIVKRGKLNVVA--DDE-ETVLATLSAGSVFGEVRHVLGVDLGRITSFCSKGYEIPN   86 (280)
Q Consensus        10 ~~~~~~f~kGeiI~~qGd~~~~iyiIlsG~Vkv~~--~dG-e~il~~l~~GD~fGe~~~v~~i~~~~l~~~~~~~~~~~~   86 (280)
                      .++.+.|+||++|+.+||+++++|+|++|.|+++.  +|| +.++.++.|||+||+..                      
T Consensus        29 ~~~~~~~~~g~~l~~~G~~~~~~y~i~~G~v~~~~~~~~G~e~~~~~~~~g~~~ge~~----------------------   86 (194)
T 3dn7_A           29 FFQLKKVRKKETLLKTGEICRINYFVVKGCLRLFFIDEKGIEQTTQFAIENWWLSDYM----------------------   86 (194)
T ss_dssp             TCEEEEECTTCEEECTTSBCCEEEEEEESEEEEEEECTTSCEEEEEEEETTCEECCHH----------------------
T ss_pred             hCEEEEEcCCCEEECCCCeeeEEEEeecCeEEEEEECCCCCEEEEEEccCCcEEeehH----------------------
Confidence            67999999999999999999999999999999994  567 45699999999999873                      


Q ss_pred             hhHHhHHHhhccchhhhhhhcchhhhhhcccccCCcccceEEEccccceeeechHHHHHHHhhCHHHHHHHHHHHHHHHH
Q psy15967         87 TKWLNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLADYPEARHSLMERGCQLLR  166 (280)
Q Consensus        87 ~~~~~l~~k~~~~~~~~rl~~~~~lL~~~~~~~~~~~~~~v~alt~s~l~~l~~~~~~~lLa~~~~~~r~~lsr~~~rL~  166 (280)
                                             +++.      +.++..+++|+++|.++.+++++|.+++.++|.+...++..+..++.
T Consensus        87 -----------------------~~~~------~~~~~~~~~a~~~~~v~~i~~~~~~~l~~~~p~~~~~~~~~~~~~l~  137 (194)
T 3dn7_A           87 -----------------------AFQK------QQPADFYIQSVENCELLSITYTEQENLFERIPALERYFRLVYQKSFA  137 (194)
T ss_dssp             -----------------------HHHH------TCBCSSEEEESSCEEEEEEEHHHHHHHHHHCTTHHHHHHHHHHHHHH
T ss_pred             -----------------------HHhc------CCCCceEEEEECCEEEEEEeHHHHHHHHHhCHHHHHHHHHHHHHHHH
Confidence                                   5564      67888999999999999999999999999999999998888887776


Q ss_pred             HcccchHHHhhchhhhhhhhccHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHhhcccchhccccccccCC
Q psy15967        167 KDGLLDEEAFRNSQVEHEALKDTVRRLDTTLEHLQTRFARLMAEYLSQQAKMKQRLALLEQGASVNQATSSKRNSQA  243 (280)
Q Consensus       167 ~~gli~~~~~~~~~~~~~~l~~~~~rl~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~t~~~~~~~~  243 (280)
                      ....         .+......++.+|++..|..+.               .+..+++.-|  .+..-|+++++.|..
T Consensus       138 ~~~~---------~~~~l~~~~~~~Rl~~~L~~~~---------------~~~~~~t~~~--iA~~lG~sretlsR~  188 (194)
T 3dn7_A          138 AAQL---------RSKFQHMYSKEEQYHNFSSRFP---------------EFIQRVPQYL--LASYLGFTPEYLSEI  188 (194)
T ss_dssp             HHHH---------HHHHHHHC--------------------------------------------------------
T ss_pred             HHHH---------HHHHHhcCCHHHHHHHHHHHCh---------------HHHHHCCHHH--HHHHhCCCHHHHHHH
Confidence            5211         1122233567777777776531               3556677666  667778888888754
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 280
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 0.001
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 0.002
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 0.002
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Catabolite gene activator protein, N-terminal domain
species: Escherichia coli [TaxId: 562]

 Score = 36.4 bits (83), Expect = 0.001
 Identities = 12/51 (23%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 16 FSPGDYICRKGDVGKEMYIVKRGKLNVVADDE---ETVLATLSAGSVFGEV 63
          +     +  +G+  + +Y + +G + V+  DE   E +L+ L+ G   GE+
Sbjct: 18 YPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGEL 68
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query280
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.68
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.68
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.65
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.65
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.64
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.63
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.62
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.62
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.61
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.6
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.59
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.56
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.55
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.55
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.42
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.41
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.39
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 97.1
d2zcwa182 Transcriptional regulator TTHA1359, C-terminal dom 96.71
d1zyba173 Probable transcription regulator BT4300, C-termina 96.49
d2bgca1100 Listeriolysin regulatory protein PrfA, C-terminal 96.13
d2bgca2131 Listeriolysin regulatory protein PrfA, N-terminal 96.05
d1i5za169 Catabolite gene activator protein (CAP), C-termina 95.95
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 95.93
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 95.55
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 85.2
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 85.18
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 84.42
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 84.18
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 81.54
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 81.22
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 80.54
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Catabolite gene activator protein, N-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=99.68  E-value=4.3e-16  Score=122.79  Aligned_cols=108  Identities=18%  Similarity=0.345  Sum_probs=96.7

Q ss_pred             cCCEEEEeCCCCEEEcCCCcCCeEEEEeeeEEEEEE--cCC-cEEEEEecCCCEecchhhhhccccccccccccCCCCch
Q psy15967          9 YTALNFVFSPGDYICRKGDVGKEMYIVKRGKLNVVA--DDE-ETVLATLSAGSVFGEVRHVLGVDLGRITSFCSKGYEIP   85 (280)
Q Consensus         9 ~~~~~~~f~kGeiI~~qGd~~~~iyiIlsG~Vkv~~--~dG-e~il~~l~~GD~fGe~~~v~~i~~~~l~~~~~~~~~~~   85 (280)
                      .+++.+.|+||++|+++||+++.+|+|++|.++++.  ++| +.++.++.+||+||+.                      
T Consensus        11 ~~~~~~~~~~g~~i~~~g~~~~~iy~i~~G~v~~~~~~~~g~e~~l~~~~~G~~~G~~----------------------   68 (132)
T d1i5za2          11 SHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGEL----------------------   68 (132)
T ss_dssp             TTSEEEEECTTCEEECTTSBCCEEEEEEECCEEEEEECTTCCEEEEEEECTTCEESCT----------------------
T ss_pred             HhCEEEEECcCCEEEcCCCCCCEEEEEEEccceeeeccccchhhhhhhhCcccccchH----------------------
Confidence            378999999999999999999999999999999994  456 4569999999999998                      


Q ss_pred             hhhHHhHHHhhccchhhhhhhcchhhhhhcccccCCcccceEEEccccceeeechHHHHHHHhhCHHHHHHHHHHHHHHH
Q psy15967         86 NTKWLNLIVKAQPMKLRKTVLNKVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLWETLADYPEARHSLMERGCQLL  165 (280)
Q Consensus        86 ~~~~~~l~~k~~~~~~~~rl~~~~~lL~~~~~~~~~~~~~~v~alt~s~l~~l~~~~~~~lLa~~~~~~r~~lsr~~~rL  165 (280)
                                              +++.     .+.++.++++|.++|.++.++.++|.+++.++|.+...+++.+.+++
T Consensus        69 ------------------------~~~~-----~~~~~~~~~~a~~~~~v~~i~~~~~~~~~~~~~~~~~~~~~~l~~rl  119 (132)
T d1i5za2          69 ------------------------GLFE-----EGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRL  119 (132)
T ss_dssp             ------------------------TTTS-----SSCBCCSEEEESSCEEEEEEEHHHHHHHHHHCTHHHHHHHHHHHHHH
T ss_pred             ------------------------HHhc-----CCccceEEEEEccceEEEEEcHHHHHHHHhhCHHHHHHHHHHHHHHH
Confidence                                    6664     25678899999999999999999999999999999999998888887


Q ss_pred             HH
Q psy15967        166 RK  167 (280)
Q Consensus       166 ~~  167 (280)
                      +.
T Consensus       120 ~~  121 (132)
T d1i5za2         120 QV  121 (132)
T ss_dssp             HH
T ss_pred             HH
Confidence            65
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2bgca1 a.4.5.4 (A:138-237) Listeriolysin regulatory protein PrfA, C-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure