Psyllid ID: psy1604

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690---
MGSTSEVSPPVDQVVEAEVIEVEVTEVKTGHVHVVRVEEAVVAMATEVTAEVVALAMGMEVEMEVVEAVTEEKIGHVRVVRAILRPDSRFSSGGGGGGDRGNSKPGDWMCSCGASNFAKRDACFKCSEPKPEGAGGGAPGGADGAPFDPAKPPLYIPKDVDQSEDNLFSSGIQTGINFSGWENVEVKVSGDNPPRPIESFESAGLREILVKNLKKSNYTKPTPIQKYAIPAGLEGRDLMGCAQTGSGKTAAFLIPIMHHLLESPGELVTGYCAQPEVIICAPTRELVMQIHEVACKYAYSSVLKICLHYGGASSMHFNRQLEKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKNYIFIAVGIIGGASTDVVQTILEVPKQQKKKKLLELLREKDEDGVIVFVSTIRNADFIACYLCETEIATTSIHGSRLQSQREQAIHDFKTKKMKVLVATAVASRGLDIKGIRHVINYDLPQEIDEYVHRIGRTGRVGNKGRATSFYDPDQDGAIAKDLVRILEQAGQPVPEFLKFGGGGGGYGRGGDAFGARDIRHDPDAAPVWGGSGATEPEESWD
cccccccccccccEEEEEEEEEEEEEEEEcEEEEEEEHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccEEEEEcccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHccccEEEEccccHHHHHHHcccccccccHHHHHHHHHHHHcccccccccEEEEccccccccEEEEEcccccHHHHHHHHHHHccccccHHHHHHHcccEEEcEEEEEEEccHHHHHHcccHHHHHHHHHcccccccccccEEEEEEcccHHHHHccEEEEcccccccccccEEEEEEEccHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHccccccEEEEEEccccccccccccEEEEccccccccccccccccccccccEEEEEEEccccccHHHHHHHHHHHHHccccccHHHHccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccEEEEEEEEEEEEEEEccccEEEEEEEHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccEcccccccccEEEcccccccccccccccccHHHHHHHHHHcccccccHHHHccHHHHHccccHHHEHcccccHHHHHHHHHHHHHHHcccccccccccccEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHHcccccHHHEEEEEEHHHHHHHHccccHHHHHHHcccccccccccEEEEEEcccHHHHHHHHHHHHHHcccEEHHHccccEEEEEEEEEEEEEccHHHccccccHHHHHHHHHHHccccHHHHHHHHHHcccHHHcHHHHHHHHHHHccccccccEEEEEEEccccHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHcccccEEEEEHHHHccccccccEEEEEEcccccHHHHHHEcccccccccccEEEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccccccccccccccccccccccHHccc
mgstsevsppvdqVVEAEVIEVEVTEVKTGHVHVVRVEEAVVAMATEVTAEVVALAMGMEVEMEVVEAVTEEKIGHVRVVRAIlrpdsrfssggggggdrgnskpgdwmcscgasnfakrdacfkcsepkpegagggapggadgapfdpakpplyipkdvdqsednlfssgiqtginfsgwenvevkvsgdnpprpiesfeSAGLREILVKNLkksnytkptpiqkyaipaglegrdlmgcaqtgsgktaAFLIPIMHHLlespgelvtgycaqpeviicaptRELVMQIHEVACKYAYSSVLKICLHyggassmhfNRQLEKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMqhstmpdvanrqtlmfsatfpetiQKKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMqhstmpdvanrqtlmfsatfpetiQKNYIFIAVGIIGGASTDVVQTILEVPKQQKKKKLLELLREKDEDGVIVFVSTIRNADFIACYLCETEIATTSIHGSRLQSQREQAIHDFKTKKMKVLVATAVAsrgldikgiRHVINYDLPQEIDEYVHRIgrtgrvgnkgratsfydpdqdgaIAKDLVRILEQagqpvpeflkfggggggygrggdafgardirhdpdaapvwggsgatepeeswd
mgstsevsppvdqvVEAEVIEVEvtevktghvhVVRVEEAVVAMATEVTAEVVALAMGMEVEMEVVEAvteekighvrvvrailrpdsrfssggggggdrgnskpGDWMCSCGASNFAKRDACFKCSEPKPEGAGGGAPGGADGAPFDPAKPPLYIPKDVDQSEDNLFSSGIQTGINFSGWENVEVKVSGDNPPRPIESFESAGLREILVKnlkksnytkptpiQKYAIPAGLEGRDLMGCAQTGSGKTAAFLIPIMHHLLESPGELVTGYCAQPEVIICAPTRELVMQIHEVACKYAYSSVLKICLHYGGASSMHFNRQLEKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKNYIFIAVGIIGGASTDVVQTILEVPKQQKKKKLLEllrekdedgvIVFVSTIRNADFIACYLCETEIATTSIHGSRLQSQREQAIHDFKTKKMKVLVATAVasrgldikgirHVINYDLPQEIDEYVHRIgrtgrvgnkgratsfydpdqdGAIAKDLVRILEQAGQPVPEFLKFGGGGGGYGRGGDAFGARDIRHDpdaapvwggsgatepeeswd
MGSTSEVSPPvdqvveaevievevtevKTGhvhvvrveeavvamatevtaevvalamgmevemevveavteeKIGHVRVVRAILrpdsrfssggggggdrgnskpgdWMCSCGASNFAKRDACFKCSepkpegagggapggadgapfdpakppLYIPKDVDQSEDNLFSSGIQTGINFSGWENVEVKVSGDNPPRPIESFESAGLREILVKNLKKSNYTKPTPIQKYAIPAGLEGRDLMGCAQTGSGKTAAFLIPIMHHLLESPGELVTGYCAQPEVIICAPTRELVMQIHEVACKYAYSSVLKICLHYGGASSMHFNRQLEKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKNYIFIAVGIIGGASTDVVQTILEVPkqqkkkkllellrekDEDGVIVFVSTIRNADFIACYLCETEIATTSIHGSRLQSQREQAIHDFKTKKMKVLVATAVASRGLDIKGIRHVINYDLPQEIDEYVHRIGRTGRVGNKGRATSFYDPDQDGAIAKDLVRILEQAGQPVPEFLKfggggggygrggdafgardIRHDPDAAPVWGGSGATEPEESWD
*************VVEAEVIEVEVTEVKTGHVHVVRVEEAVVAMATEVTAEVVALAMGMEVEMEVVEAVTEEKIGHVRVVRAIL***********************WMCSCGASNFAKRDACFK******************************************FSSGIQTGINFSGWENVEVK****************GLREILVKNLKKSNYTKPTPIQKYAIPAGLEGRDLMGCAQTGSGKTAAFLIPIMHHLLESPGELVTGYCAQPEVIICAPTRELVMQIHEVACKYAYSSVLKICLHYGGASSMHFNRQLEKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKNYIFIAVGIIGGASTDVVQTILEVPKQQKKKKLLELLREKDEDGVIVFVSTIRNADFIACYLCETEIATTSIHGSR******QAIHDFKTKKMKVLVATAVASRGLDIKGIRHVINYDLPQEIDEYVHRIGRTGRVGNKGRATSFYDPDQDGAIAKDLVRIL*******************************************************
***********DQVVEAEVIEVEVTEVKTGHVHVVRVEEAVVAMATEVTAEVVALAMGME********************************************************************************************PLYIPKDVDQSEDNLFSSGIQTGINFSGWENVEVKVSGDNPPRPIESFESAGLREILVKNLKKSNYTKPTPIQKYAIPAGLEGRDLMGCAQTGSGKTAAFLIPIMHHLLESPG*****YCAQPEVIICAPTRELVMQIHEVACKYAYSSVLKICLHYGGASS*****QLEKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKNYIFIAVGIIGGASTDVVQTILEVPKQQKKKKLLELLREKDEDGVIVFVSTIRNADFIACYLCETEIATTSIHGSRLQSQREQAIHDFKTKKMKVLVATAVASRGLDIKGIRHVINYDLPQEIDEYVHRIGRTGRVGNKGRATSFYDPDQDGAIAKDLVRILEQAGQPVPE**********************************************
***********DQVVEAEVIEVEVTEVKTGHVHVVRVEEAVVAMATEVTAEVVALAMGMEVEMEVVEAVTEEKIGHVRVVRAILRPDSRF***********NSKPGDWMCSCGASNFAKRDACFKCSEP***********GADGAPFDPAKPPLYIPKDVDQSEDNLFSSGIQTGINFSGWENVEVKVSGDNPPRPIESFESAGLREILVKNLKKSNYTKPTPIQKYAIPAGLEGRDLMGCAQTGSGKTAAFLIPIMHHLLESPGELVTGYCAQPEVIICAPTRELVMQIHEVACKYAYSSVLKICLHYGGASSMHFNRQLEKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKNYIFIAVGIIGGASTDVVQTILEVPKQQKKKKLLELLREKDEDGVIVFVSTIRNADFIACYLCETEIATTS**********EQAIHDFKTKKMKVLVATAVASRGLDIKGIRHVINYDLPQEIDEYVHRIGRTGRVGNKGRATSFYDPDQDGAIAKDLVRILEQAGQPVPEFLKFGGGGGGYGRGGDAFGARDIRHDPDAAPVW*************
********PPVDQVVEAEVIEVEVTEVKTGHVHVVRVEEAVVAMATEVTAEV***************************************************************************************************PPLYIPKDVDQSEDNLFSSGIQTGINFSGWENVEVKVSGDNPPRPIESFESAGLREILVKNLKKSNYTKPTPIQKYAIPAGLEGRDLMGCAQTGSGKTAAFLIPIMHHLLESPGELVTGYCAQPEVIICAPTRELVMQIHEVACKYAYSSVLKICLHYGGASSMHFNRQLEKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKNYIFIAVGIIGGASTDVVQTILEVPKQQKKKKLLELLREKDEDGVIVFVSTIRNADFIACYLCETEIATTSIHGSRLQSQREQAIHDFKTKKMKVLVATAVASRGLDIKGIRHVINYDLPQEIDEYVHRIGRTGRVGNKGRATSFYDPDQDGAIAKDLVRILEQAGQPVPEFLKFGGG***************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSTSEVSPPVDQVVEAEVIEVEVTEVKTGHVHVVRVEEAVVAMATEVTAEVVALAMGMEVEMEVVEAVTEEKIGHVRVVRAILRPDSRFSSGGGGGGDRGNSKPGDWMCSCGASNFAKRDACFKCSEPKPEGAGGGAPGGADGAPFDPAKPPLYIPKDVDQSEDNLFSSGIQTGINFSGWENVEVKVSGDNPPRPIESFESAGLREILVKNLKKSNYTKPTPIQKYAIPAGLEGRDLMGCAQTGSGKTAAFLIPIMHHLLESPGELVTGYCAQPEVIICAPTRELVMQIHEVACKYAYSSVLKICLHYGGASSMHFNRQLEKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKNYIFIAVGIIGGASTDVVQTILEVPKQQKKKKLLELLREKDEDGVIVFVSTIRNADFIACYLCETEIATTSIHGSRLQSQREQAIHDFKTKKMKVLVATAVASRGLDIKGIRHVINYDLPQEIDEYVHRIGRTGRVGNKGRATSFYDPDQDGAIAKDLVRILEQAGQPVPEFLKFGGGGGGYGRGGDAFGARDIRHDPDAAPVWGGSGATEPEESWD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query693 2.2.26 [Sep-21-2011]
P09052661 ATP-dependent RNA helicas yes N/A 0.415 0.435 0.591 7e-94
Q6GVM6660 ATP-dependent RNA helicas yes N/A 0.632 0.663 0.402 1e-92
Q6FP38604 ATP-dependent RNA helicas yes N/A 0.632 0.725 0.389 2e-92
Q8LA13612 DEAD-box ATP-dependent RN yes N/A 0.639 0.723 0.380 9e-91
Q9VHP0798 ATP-dependent RNA helicas no N/A 0.604 0.525 0.391 2e-90
O15523660 ATP-dependent RNA helicas yes N/A 0.632 0.663 0.395 6e-89
Q6Z4K6638 DEAD-box ATP-dependent RN yes N/A 0.594 0.645 0.386 3e-86
Q966L9974 ATP-dependent RNA helicas yes N/A 0.668 0.475 0.378 4e-85
P34689763 ATP-dependent RNA helicas no N/A 0.705 0.640 0.372 1e-84
Q0DB53602 DEAD-box ATP-dependent RN no N/A 0.578 0.666 0.363 2e-82
>sp|P09052|VASA1_DROME ATP-dependent RNA helicase vasa, isoform A OS=Drosophila melanogaster GN=vas PE=1 SV=3 Back     alignment and function desciption
 Score =  345 bits (885), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 178/301 (59%), Positives = 216/301 (71%), Gaps = 13/301 (4%)

Query: 400 KGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVA 459
           +GC++++AT GRL D +DR  I+    RFVVLDEADRMLDMGF  D++ +M H TM    
Sbjct: 367 RGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMR--P 424

Query: 460 NRQTLMFSATFPETIQ-------KNYIFIAVGIIGGASTDVVQTILEVPKQQKKKKLLEL 512
             QTLMFSATFPE IQ       KNY+F+A+GI+GGA +DV QTI EV K  K+ KL+E+
Sbjct: 425 EHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEI 484

Query: 513 LREKDEDGVIVFVSTIRNADFIACYLCETEIATTSIHGSRLQSQREQAIHDFKTKKMKVL 572
           L E+  DG IVFV T R ADF+A +L E E  TTSIHG RLQSQREQA+ DFK   MKVL
Sbjct: 485 LSEQ-ADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVL 543

Query: 573 VATAVASRGLDIKGIRHVINYDLPQEIDEYVHRIGRTGRVGNKGRATSFYDPDQDGAIAK 632
           +AT+VASRGLDIK I+HVINYD+P +ID+YVHRIGRTGRVGN GRATSF+DP++D AIA 
Sbjct: 544 IATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAA 603

Query: 633 DLVRILEQAGQPVPEFLKFGGGGGGYGRGGDAFGARDIRHDPDAAPVWGGSGATEPEESW 692
           DLV+ILE +GQ VP+FL+  G GG  G     FG  D+R   +     G +   E EE W
Sbjct: 604 DLVKILEGSGQTVPDFLRTCGAGGDGGYSNQNFGGVDVRGRGNYV---GDATNVEEEEQW 660

Query: 693 D 693
           D
Sbjct: 661 D 661
Involved in translational control mechanisms operating in early stages of oogenesis. Required maternally in many stages of oogenesis, including cystocyte differentiation, oocyte differentiation, and specification of anterior-posterior polarity in the developing cysts. Essential for the formation and/or structural integrity of perinuclear nuage particles.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 Back     alignment and function description
>sp|Q6FP38|DBP1_CANGA ATP-dependent RNA helicase DBP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP1 PE=3 SV=1 Back     alignment and function description
>sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=2 SV=1 Back     alignment and function description
>sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 Back     alignment and function description
>sp|O15523|DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 Back     alignment and function description
>sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 Back     alignment and function description
>sp|Q966L9|GLH2_CAEEL ATP-dependent RNA helicase glh-2 OS=Caenorhabditis elegans GN=glh-2 PE=1 SV=1 Back     alignment and function description
>sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 Back     alignment and function description
>sp|Q0DB53|RH52A_ORYSJ DEAD-box ATP-dependent RNA helicase 52A OS=Oryza sativa subsp. japonica GN=Os06g0602400 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
427788709 856 Putative protein self-association [Rhipi 0.643 0.521 0.438 1e-110
327554931698 vasa-like protein [Marsupenaeus japonicu 0.724 0.719 0.399 1e-109
67423403775 VASA RNA helicase [Daphnia magna] 0.733 0.655 0.403 1e-106
67968237779 VASA RNA helicase [Daphnia magna] 0.709 0.631 0.416 1e-106
327262891 1021 PREDICTED: probable ATP-dependent RNA he 0.695 0.472 0.406 1e-103
291244816679 PREDICTED: Vasa-like, partial [Saccoglos 0.642 0.655 0.420 1e-102
168828898662 vasa [Salvelinus leucomaenis] 0.636 0.666 0.410 1e-100
185134419647 Vasa [Oncorhynchus mykiss] gi|6521014|db 0.636 0.681 0.407 1e-100
381217965773 vasa [Urechis unicinctus] 0.656 0.588 0.386 3e-99
386436506653 vasa [Salmo salar] 0.630 0.669 0.402 7e-99
>gi|427788709|gb|JAA59806.1| Putative protein self-association [Rhipicephalus pulchellus] Back     alignment and taxonomy information
 Score =  405 bits (1041), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 237/541 (43%), Positives = 317/541 (58%), Gaps = 95/541 (17%)

Query: 123 CFKC-----------SEPKPEGAGGGAPGGADGAPFDPAKPPLYIPKDVDQSEDNLFSSG 171
           CFKC           +EP P         G DG P +      Y+P  +   ED LFS+ 
Sbjct: 352 CFKCQQEGHMAKDCTNEPVPRM-------GPDGKPMEAP----YVPPSLPTDEDTLFST- 399

Query: 172 IQTGINFSGWENVEVKVSGDNPPRPIESFESAGLREILVKNLKKSNYTKPTPIQKYAIPA 231
           I TGINF  ++++ V+VS      P  SFE  GL ++L++NL+++ Y KPTP+QKYA+  
Sbjct: 400 ISTGINFDKYDSIPVEVSDPQFRTPFTSFEEMGLCDLLLQNLRRAKYVKPTPVQKYAVKI 459

Query: 232 GLEGRDLMGCAQTGSGKTAAFLIPIMHHLLESPGELVTGYCA--QPEVIICAPTRELVMQ 289
            L GRDLM CAQTGSGKTAAF++PI+H LL   G     Y +   P  +I +PTREL +Q
Sbjct: 460 ALAGRDLMACAQTGSGKTAAFMLPILHSLLSDTGLENPSYQSVQTPMAVILSPTRELAIQ 519

Query: 290 IHEVACKYAYSSVLKICLHYGGASSMHFNRQLEKGCNILVATMGRLKDILDRGRISLASV 349
           I + A KYAY S+LK  L YGG S  H    L +GC+ILVAT GRLKD +++G+IS   +
Sbjct: 520 IAQDAHKYAYDSILKTVLVYGGTSVQHQLSVLSRGCHILVATTGRLKDFVEKGKISFEKL 579

Query: 350 RFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKKGCNILVATM 409
           RF+VLDEADRMLDMGF  D++ ++ HS+MP    R+TLMFSATFPE+IQ      ++A  
Sbjct: 580 RFLVLDEADRMLDMGFEPDVRALVGHSSMPQRGQRRTLMFSATFPESIQ------MLA-- 631

Query: 410 GRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSAT 469
              ++ LD       SV          ML +G LG     +Q             ++  T
Sbjct: 632 ---REFLDN------SV----------MLSVGILGGANSDVQQQ-----------IYQVT 661

Query: 470 FPETIQKNYIFIAVGIIGGASTDVVQTILEVPKQQKKKKLLELLREKDEDGVIVFVSTIR 529
             E  QK                    +L++  ++   +++            VFV   +
Sbjct: 662 QFEKRQK--------------------LLDILAEEGSDRVM------------VFVEKKK 689

Query: 530 NADFIACYLCETEIATTSIHGSRLQSQREQAIHDFKTKKMKVLVATAVASRGLDIKGIRH 589
            ADF+A +L +  + TTSIHG R Q QRE+A+ DF+     V+VATAVA+RGLDIK +RH
Sbjct: 690 TADFLAAFLSQKGVKTTSIHGDRYQRQREEALLDFRRGTCPVIVATAVAARGLDIKDVRH 749

Query: 590 VINYDLPQEIDEYVHRIGRTGRVGNKGRATSFYDPDQDGAIAKDLVRILEQAGQPVPEFL 649
           VINYDLPQ IDEYVHR+GRTGRVGN G+ATSFYD D +GA+A  LV+IL ++ Q VP++L
Sbjct: 750 VINYDLPQSIDEYVHRVGRTGRVGNLGKATSFYDGDANGALASALVKILSESQQEVPDWL 809

Query: 650 K 650
           +
Sbjct: 810 Q 810

Source: Rhipicephalus pulchellus

Species: Rhipicephalus pulchellus

Genus: Rhipicephalus

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|327554931|gb|AEB00819.1| vasa-like protein [Marsupenaeus japonicus] Back     alignment and taxonomy information
>gi|67423403|dbj|BAD99522.1| VASA RNA helicase [Daphnia magna] Back     alignment and taxonomy information
>gi|67968237|dbj|BAE00180.1| VASA RNA helicase [Daphnia magna] Back     alignment and taxonomy information
>gi|327262891|ref|XP_003216257.1| PREDICTED: probable ATP-dependent RNA helicase DDX4-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|291244816|ref|XP_002742290.1| PREDICTED: Vasa-like, partial [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|168828898|gb|ACA33927.1| vasa [Salvelinus leucomaenis] Back     alignment and taxonomy information
>gi|185134419|ref|NP_001117665.1| Vasa [Oncorhynchus mykiss] gi|6521014|dbj|BAA88059.1| Vasa [Oncorhynchus mykiss] Back     alignment and taxonomy information
>gi|381217965|gb|AFG17059.1| vasa [Urechis unicinctus] Back     alignment and taxonomy information
>gi|386436506|gb|AFH41530.1| vasa [Salmo salar] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
WB|WBGene00001599974 glh-2 [Caenorhabditis elegans 0.357 0.254 0.441 8e-82
UNIPROTKB|Q966L9974 glh-2 "ATP-dependent RNA helic 0.357 0.254 0.441 8e-82
WB|WBGene00001598763 glh-1 [Caenorhabditis elegans 0.349 0.317 0.444 9.3e-82
UNIPROTKB|P34689763 glh-1 "ATP-dependent RNA helic 0.349 0.317 0.444 9.3e-82
WB|WBGene00001600720 glh-3 [Caenorhabditis elegans 0.359 0.345 0.404 1.5e-76
UNIPROTKB|O01836720 glh-3 "ATP-dependent RNA helic 0.359 0.345 0.404 1.5e-76
UNIPROTKB|Q90ZF6617 olvas "VASA" [Oryzias latipes 0.363 0.408 0.534 2.1e-68
UNIPROTKB|Q91372700 ddx4 "Probable ATP-dependent R 0.424 0.42 0.471 5.1e-67
ZFIN|ZDB-GENE-990415-272716 vasa "vasa homolog" [Danio rer 0.362 0.350 0.513 6.5e-67
UNIPROTKB|E2RMU5728 DDX4 "Uncharacterized protein" 0.362 0.344 0.532 1.3e-66
WB|WBGene00001599 glh-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 514 (186.0 bits), Expect = 8.0e-82, Sum P(2) = 8.0e-82
 Identities = 114/258 (44%), Positives = 159/258 (61%)

Query:   155 YIPKDVDQSEDNLFSSGIQTGINFSGWENVEVKVSGDNPP---RPIESFESAGLREILVK 211
             Y+P + D  E+      I  G+ F+ + + EVK++ D  P   +  ++F  A L E + K
Sbjct:   507 YVPVE-DNMEEVFNMQKISEGLMFNKFFDAEVKITSDKKPVGVKTCKTFSEANLGETMKK 565

Query:   212 NLKKSNYTKPTPIQKYAIPAGLEGRDLMGCAQTGSGKTAAFLIPIMHHLLESPGELVT-- 269
             N+  + YTK TPIQ+Y +P   +G D+M CAQTGSGKTAAFL+PIM  L++   +L T  
Sbjct:   566 NVAHAGYTKTTPIQQYTLPLIHQGHDIMACAQTGSGKTAAFLLPIMARLIDE-NDLNTAG 624

Query:   270 -GYCAQPEVIICAPTRELVMQIHEVACKYAYSSVLKICLHYGGASSMHFNRQLEKGCNIL 328
              G C  P  II  PTREL  QI+    K+AY ++++I   YGG +  +   Q+EKG  I+
Sbjct:   625 EGGC-YPRCIILTPTRELTDQIYNEGRKFAYQTMMEIRPVYGGLAVGYNKGQIEKGATII 683

Query:   329 VATMGRLKDILDRGRISLASVRFVVLDEADRMLD-MGFLGDIQHVMQHSTMPDVANRQTL 387
             V T+GR+K   + G I L   RF VLDEADRM+D MGF  DI  ++ + +MP   NRQTL
Sbjct:   684 VGTVGRIKHFCEEGTIKLDKCRFFVLDEADRMIDAMGFGTDIDTIVNYESMPKKENRQTL 743

Query:   388 MFSATFPETIQKKGCNIL 405
             MFSATFP+++Q+   N L
Sbjct:   744 MFSATFPDSVQEAARNHL 761
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0006915 "apoptotic process" evidence=IMP
GO:0009791 "post-embryonic development" evidence=IMP
GO:0007281 "germ cell development" evidence=IMP
GO:0016070 "RNA metabolic process" evidence=ISS
GO:0043186 "P granule" evidence=IDA
GO:0003724 "RNA helicase activity" evidence=IDA
GO:0008432 "JUN kinase binding" evidence=IPI
GO:0043621 "protein self-association" evidence=IPI
UNIPROTKB|Q966L9 glh-2 "ATP-dependent RNA helicase glh-2" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00001598 glh-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P34689 glh-1 "ATP-dependent RNA helicase glh-1" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00001600 glh-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O01836 glh-3 "ATP-dependent RNA helicase glh-3" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q90ZF6 olvas "VASA" [Oryzias latipes (taxid:8090)] Back     alignment and assigned GO terms
UNIPROTKB|Q91372 ddx4 "Probable ATP-dependent RNA helicase DDX4" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-272 vasa "vasa homolog" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RMU5 DDX4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6GVM6DDX3Y_PANTR3, ., 6, ., 4, ., 1, 30.40260.63200.6636yesN/A
Q75B50DED1_ASHGO3, ., 6, ., 4, ., 1, 30.52710.36070.4012yesN/A
Q8LA13RH11_ARATH3, ., 6, ., 4, ., 1, 30.38040.63920.7238yesN/A
O15523DDX3Y_HUMAN3, ., 6, ., 4, ., 1, 30.39500.63200.6636yesN/A
Q6FP38DBP1_CANGA3, ., 6, ., 4, ., 1, 30.38960.63200.7251yesN/A
P09052VASA1_DROME3, ., 6, ., 4, ., 1, 30.59130.41550.4357yesN/A
P24784DBP1_YEAST3, ., 6, ., 4, ., 1, 30.52140.35930.4035yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.824
3rd Layer3.6.40.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-83
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 7e-79
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 7e-71
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 2e-66
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 3e-60
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 1e-54
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 3e-54
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 1e-51
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 3e-51
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-47
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 7e-47
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 1e-46
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 4e-46
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-45
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 1e-45
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 3e-44
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 3e-43
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 2e-40
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 2e-39
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 5e-39
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 9e-39
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 4e-36
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 1e-33
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-32
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-31
cd00268203 cd00268, DEADc, DEAD-box helicases 3e-30
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-27
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 6e-27
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-26
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 1e-19
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-15
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 2e-15
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 7e-14
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 4e-13
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 1e-12
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 3e-11
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 2e-10
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 5e-10
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 7e-10
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 1e-06
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 1e-06
COG1205 851 COG1205, COG1205, Distinct helicase family with a 1e-06
PRK13767 876 PRK13767, PRK13767, ATP-dependent helicase; Provis 3e-06
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 9e-06
pfam0064129 pfam00641, zf-RanBP, Zn-finger in Ran binding prot 4e-05
pfam06862436 pfam06862, DUF1253, Protein of unknown function (D 5e-05
smart0054725 smart00547, ZnF_RBZ, Zinc finger domain 6e-05
COG0553866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 7e-05
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 2e-04
COG1203 733 COG1203, COG1203, CRISPR-associated helicase Cas3 2e-04
TIGR01587358 TIGR01587, cas3_core, CRISPR-associated helicase C 0.003
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information 
 Score =  262 bits (671), Expect = 1e-83
 Identities = 97/200 (48%), Positives = 134/200 (67%), Gaps = 10/200 (5%)

Query: 200 FESAGLREILVKNLKKSNYTKPTPIQKYAIPAGLEGRDLMGCAQTGSGKTAAFLIPIMHH 259
           FE  GL   L++ +    + KPTPIQ  AIP  L GRD++G AQTGSGKTAAFLIPI+  
Sbjct: 1   FEELGLSPELLRGIYALGFEKPTPIQARAIPPLLSGRDVIGQAQTGSGKTAAFLIPILEK 60

Query: 260 LLESPGELVTGYCAQPEVIICAPTRELVMQIHEVACKYAYSSVLKICLHYGGASSMHFNR 319
           L  SP +        P+ +I APTREL +QI EVA K    + LK+ + YGG S     R
Sbjct: 61  LDPSPKK------DGPQALILAPTRELALQIAEVARKLGKHTNLKVVVIYGGTSIDKQIR 114

Query: 320 QLEKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMP 379
           +L++G +I+VAT GRL D+L+RG++ L+ V+++VLDEADRMLDMGF   I+ +++   +P
Sbjct: 115 KLKRGPHIVVATPGRLLDLLERGKLDLSKVKYLVLDEADRMLDMGFEDQIREILKL--LP 172

Query: 380 DVANRQTLMFSATFPETIQK 399
              +RQTL+FSAT P+ ++ 
Sbjct: 173 K--DRQTLLFSATMPKEVRD 190

A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region. Length = 203
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|237496 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|201366 pfam00641, zf-RanBP, Zn-finger in Ran binding protein and others Back     alignment and domain information
>gnl|CDD|219205 pfam06862, DUF1253, Protein of unknown function (DUF1253) Back     alignment and domain information
>gnl|CDD|197784 smart00547, ZnF_RBZ, Zinc finger domain Back     alignment and domain information
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224124 COG1203, COG1203, CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|233483 TIGR01587, cas3_core, CRISPR-associated helicase Cas3 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 693
KOG0335|consensus482 100.0
KOG0331|consensus519 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0330|consensus476 100.0
KOG0333|consensus673 100.0
KOG0341|consensus610 100.0
KOG0336|consensus629 100.0
KOG0339|consensus731 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0328|consensus400 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0338|consensus691 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0342|consensus543 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0340|consensus442 100.0
KOG0334|consensus 997 100.0
KOG0345|consensus 567 100.0
KOG0343|consensus 758 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0326|consensus459 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0348|consensus708 100.0
KOG0347|consensus731 100.0
KOG0332|consensus477 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0346|consensus569 100.0
KOG0327|consensus397 100.0
KOG0344|consensus593 100.0
KOG0350|consensus620 100.0
KOG0337|consensus529 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG4284|consensus 980 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0329|consensus387 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
PRK10689 1147 transcription-repair coupling factor; Provisional 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
KOG0354|consensus 746 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
KOG0349|consensus725 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
PRK09200 790 preprotein translocase subunit SecA; Reviewed 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
PRK04914 956 ATP-dependent helicase HepA; Validated 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
KOG0351|consensus 941 99.97
KOG0352|consensus 641 99.97
KOG0952|consensus 1230 99.97
PRK05580679 primosome assembly protein PriA; Validated 99.97
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.97
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.97
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.97
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.96
KOG0353|consensus 695 99.96
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.96
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.96
PRK09694 878 helicase Cas3; Provisional 99.96
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.96
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.96
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.95
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.95
KOG0951|consensus 1674 99.95
KOG0947|consensus 1248 99.95
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.95
KOG0948|consensus 1041 99.94
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.94
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.94
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.93
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.93
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.92
KOG0385|consensus 971 99.92
KOG0950|consensus 1008 99.92
KOG0920|consensus 924 99.92
KOG0922|consensus 674 99.91
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.91
KOG0387|consensus 923 99.9
KOG0384|consensus 1373 99.89
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.89
KOG0923|consensus 902 99.88
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.87
KOG0390|consensus776 99.87
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.87
COG4096 875 HsdR Type I site-specific restriction-modification 99.86
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.86
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.85
KOG0389|consensus941 99.85
KOG0392|consensus1549 99.84
KOG0924|consensus 1042 99.84
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.84
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.83
KOG0926|consensus 1172 99.83
PRK05298652 excinuclease ABC subunit B; Provisional 99.82
KOG0949|consensus 1330 99.82
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.82
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.81
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.8
KOG1000|consensus689 99.8
KOG0925|consensus 699 99.79
smart00487201 DEXDc DEAD-like helicases superfamily. 99.78
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.78
KOG1123|consensus776 99.76
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.75
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.74
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.7
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.7
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.7
COG4889 1518 Predicted helicase [General function prediction on 99.68
KOG4150|consensus 1034 99.68
KOG0391|consensus 1958 99.68
KOG0388|consensus1185 99.68
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.66
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.65
KOG0953|consensus 700 99.65
KOG0386|consensus 1157 99.64
KOG1002|consensus791 99.64
KOG4439|consensus901 99.64
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.63
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.61
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.6
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.56
smart0049082 HELICc helicase superfamily c-terminal domain. 99.55
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.55
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.48
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.47
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 99.46
KOG1015|consensus 1567 99.45
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.4
KOG0951|consensus 1674 99.38
KOG0921|consensus 1282 99.36
PRK14873665 primosome assembly protein PriA; Provisional 99.31
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.28
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.21
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.15
KOG2340|consensus698 99.15
smart00489289 DEXDc3 DEAD-like helicases superfamily. 99.08
smart00488289 DEXDc2 DEAD-like helicases superfamily. 99.08
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 99.05
COG0610 962 Type I site-specific restriction-modification syst 98.93
KOG1016|consensus 1387 98.78
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.76
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.54
KOG1001|consensus674 98.52
KOG1133|consensus821 98.47
PRK15483 986 type III restriction-modification system StyLTI en 98.43
KOG0952|consensus1230 98.31
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.29
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 98.25
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.06
KOG1802|consensus935 98.04
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.02
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.0
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.99
KOG1132|consensus 945 97.91
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.91
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.86
KOG1803|consensus649 97.75
TIGR00376637 DNA helicase, putative. The gene product may repre 97.67
PF1324576 AAA_19: Part of AAA domain 97.61
PRK10536262 hypothetical protein; Provisional 97.6
KOG0383|consensus696 97.58
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.57
PF0064130 zf-RanBP: Zn-finger in Ran binding protein and oth 97.5
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.5
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.26
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.23
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.18
smart00492141 HELICc3 helicase superfamily c-terminal domain. 97.16
smart00491142 HELICc2 helicase superfamily c-terminal domain. 97.14
KOG4198|consensus280 97.11
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.0
smart0054726 ZnF_RBZ Zinc finger domain. Zinc finger domain in 96.99
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.85
KOG1805|consensus1100 96.84
KOG1995|consensus351 96.8
PRK08181269 transposase; Validated 96.72
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.71
KOG1131|consensus755 96.66
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 96.63
PF13871278 Helicase_C_4: Helicase_C-like 96.62
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.61
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.53
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 96.5
KOG0298|consensus 1394 96.49
PRK04296190 thymidine kinase; Provisional 96.35
KOG0701|consensus 1606 96.31
PRK06526254 transposase; Provisional 96.3
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.3
PRK07952244 DNA replication protein DnaC; Validated 96.17
PRK06921266 hypothetical protein; Provisional 96.17
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.93
PRK08116268 hypothetical protein; Validated 95.9
PRK12377248 putative replication protein; Provisional 95.87
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.8
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 95.76
PRK06835329 DNA replication protein DnaC; Validated 95.73
smart00382148 AAA ATPases associated with a variety of cellular 95.67
PRK08727233 hypothetical protein; Validated 95.65
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 95.61
PRK14087450 dnaA chromosomal replication initiation protein; P 95.59
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 95.58
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 95.51
PHA02533534 17 large terminase protein; Provisional 95.47
PRK14974336 cell division protein FtsY; Provisional 95.43
PRK11054684 helD DNA helicase IV; Provisional 95.42
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 95.39
PRK00149450 dnaA chromosomal replication initiation protein; R 95.38
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.28
KOG0335|consensus482 95.27
PRK06893229 DNA replication initiation factor; Validated 95.23
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.07
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.03
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 94.99
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 94.99
PRK12422445 chromosomal replication initiation protein; Provis 94.94
PRK13894319 conjugal transfer ATPase TrbB; Provisional 94.94
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 94.86
PRK08084235 DNA replication initiation factor; Provisional 94.85
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.78
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 94.75
PRK05707328 DNA polymerase III subunit delta'; Validated 94.74
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 94.73
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 94.67
PRK05642234 DNA replication initiation factor; Validated 94.65
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.59
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 94.57
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 94.56
PRK14086617 dnaA chromosomal replication initiation protein; P 94.49
PRK08769319 DNA polymerase III subunit delta'; Validated 94.49
KOG0989|consensus346 94.46
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 94.45
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 94.36
PRK14088440 dnaA chromosomal replication initiation protein; P 94.29
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 94.22
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.21
COG2256436 MGS1 ATPase related to the helicase subunit of the 94.17
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 94.15
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.07
PRK13833323 conjugal transfer protein TrbB; Provisional 94.06
KOG4198|consensus280 94.04
PRK05580 679 primosome assembly protein PriA; Validated 93.99
PTZ001121164 origin recognition complex 1 protein; Provisional 93.93
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 93.91
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 93.88
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 93.88
TIGR00595 505 priA primosomal protein N'. All proteins in this f 93.85
PRK14873 665 primosome assembly protein PriA; Provisional 93.84
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 93.84
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 93.77
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 93.59
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 93.59
PHA03333 752 putative ATPase subunit of terminase; Provisional 93.53
COG3973747 Superfamily I DNA and RNA helicases [General funct 93.4
COG0593408 DnaA ATPase involved in DNA replication initiation 93.19
CHL00181287 cbbX CbbX; Provisional 93.12
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 93.04
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 93.0
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 92.98
PF13173128 AAA_14: AAA domain 92.98
TIGR02928365 orc1/cdc6 family replication initiation protein. M 92.95
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 92.88
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 92.86
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 92.76
COG4626546 Phage terminase-like protein, large subunit [Gener 92.73
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 92.69
PRK11823446 DNA repair protein RadA; Provisional 92.64
KOG0991|consensus333 92.63
KOG0339|consensus731 92.53
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 92.4
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 92.4
PRK00771437 signal recognition particle protein Srp54; Provisi 92.34
PHA03368738 DNA packaging terminase subunit 1; Provisional 92.33
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 92.28
PHA02544316 44 clamp loader, small subunit; Provisional 92.22
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 92.2
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 92.19
PRK06964342 DNA polymerase III subunit delta'; Validated 92.19
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 92.15
PRK12402337 replication factor C small subunit 2; Reviewed 92.11
PLN03025319 replication factor C subunit; Provisional 92.1
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 92.07
PRK09112351 DNA polymerase III subunit delta'; Validated 92.06
PRK08903227 DnaA regulatory inactivator Hda; Validated 92.03
PRK08939306 primosomal protein DnaI; Reviewed 92.02
PRK06871325 DNA polymerase III subunit delta'; Validated 91.99
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 91.96
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 91.94
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 91.92
KOG0741|consensus744 91.91
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 91.86
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 91.71
COG0552340 FtsY Signal recognition particle GTPase [Intracell 91.68
COG3972660 Superfamily I DNA and RNA helicases [General funct 91.67
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 91.6
KOG1513|consensus 1300 91.58
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 91.54
COG1198 730 PriA Primosomal protein N' (replication factor Y) 91.52
PRK10436462 hypothetical protein; Provisional 91.5
PF00004132 AAA: ATPase family associated with various cellula 91.43
PRK08533230 flagellar accessory protein FlaH; Reviewed 91.36
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 91.33
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 91.28
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 91.28
PRK06090319 DNA polymerase III subunit delta'; Validated 91.17
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 91.08
PRK07993334 DNA polymerase III subunit delta'; Validated 91.06
PRK08699325 DNA polymerase III subunit delta'; Validated 91.01
KOG0331|consensus519 91.0
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 90.93
PRK13851344 type IV secretion system protein VirB11; Provision 90.82
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 90.79
COG0470325 HolB ATPase involved in DNA replication [DNA repli 90.72
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 90.7
PRK07940394 DNA polymerase III subunit delta'; Validated 90.68
PRK04328249 hypothetical protein; Provisional 90.67
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 90.59
PRK07471365 DNA polymerase III subunit delta'; Validated 90.53
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 90.52
KOG2028|consensus554 90.51
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 90.49
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 90.37
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 90.24
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 90.23
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 90.17
PTZ00146293 fibrillarin; Provisional 90.17
TIGR00064272 ftsY signal recognition particle-docking protein F 90.12
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 90.1
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 90.1
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 89.87
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 89.85
KOG0330|consensus476 89.81
KOG0336|consensus629 89.68
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 89.67
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 89.6
PRK13341 725 recombination factor protein RarA/unknown domain f 89.56
PRK05973237 replicative DNA helicase; Provisional 89.48
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 89.47
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 89.45
TIGR00767415 rho transcription termination factor Rho. Members 89.39
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 89.37
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 89.31
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 89.23
PRK13342413 recombination factor protein RarA; Reviewed 89.1
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 89.04
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 88.88
PRK06067234 flagellar accessory protein FlaH; Validated 88.88
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 88.78
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 88.75
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 88.59
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 88.41
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 88.37
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 88.29
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 88.21
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 88.2
PRK13764602 ATPase; Provisional 87.99
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 87.66
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 87.65
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 87.48
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 87.44
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 87.31
PRK10689 1147 transcription-repair coupling factor; Provisional 87.27
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 87.27
PTZ00293211 thymidine kinase; Provisional 87.16
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 87.07
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 87.07
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 86.97
PTZ00110545 helicase; Provisional 86.92
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 86.81
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 86.78
KOG0744|consensus423 86.71
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 86.7
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 86.69
cd03115173 SRP The signal recognition particle (SRP) mediates 86.68
PF05729166 NACHT: NACHT domain 86.66
KOG0298|consensus1394 86.65
TIGR02237209 recomb_radB DNA repair and recombination protein R 86.53
KOG0741|consensus744 86.17
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 86.17
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 86.16
KOG0341|consensus610 86.11
PRK10416318 signal recognition particle-docking protein FtsY; 86.07
PRK09376416 rho transcription termination factor Rho; Provisio 86.0
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 85.9
PRK03992389 proteasome-activating nucleotidase; Provisional 85.89
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 85.78
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 85.69
PHA00729226 NTP-binding motif containing protein 85.62
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 85.61
KOG0742|consensus630 85.57
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 85.54
PRK04195482 replication factor C large subunit; Provisional 85.52
TIGR00959428 ffh signal recognition particle protein. This mode 85.51
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 85.35
KOG0738|consensus491 85.3
PRK14701 1638 reverse gyrase; Provisional 85.27
TIGR02012321 tigrfam_recA protein RecA. This model describes or 85.25
PF10593239 Z1: Z1 domain; InterPro: IPR018310 This entry repr 85.24
PRK10867433 signal recognition particle protein; Provisional 85.24
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 85.23
PRK00440319 rfc replication factor C small subunit; Reviewed 85.11
cd01128249 rho_factor Transcription termination factor rho is 85.07
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 84.79
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 84.76
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 84.73
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 84.59
PRK09354349 recA recombinase A; Provisional 84.47
KOG0732|consensus 1080 84.47
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 84.22
PF10412386 TrwB_AAD_bind: Type IV secretion-system coupling p 84.21
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 84.11
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 84.1
PRK12608380 transcription termination factor Rho; Provisional 84.04
PF12846304 AAA_10: AAA-like domain 83.97
PF1355562 AAA_29: P-loop containing region of AAA domain 83.96
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 83.95
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 83.81
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 83.71
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 83.53
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 83.51
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 83.28
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 83.22
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 83.2
KOG0058|consensus716 83.13
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 82.75
COG2255332 RuvB Holliday junction resolvasome, helicase subun 82.74
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 82.25
KOG1807|consensus 1025 82.21
PRK10865 857 protein disaggregation chaperone; Provisional 82.06
PRK13897606 type IV secretion system component VirD4; Provisio 82.03
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 81.91
PRK13700732 conjugal transfer protein TraD; Provisional 81.89
TIGR02533486 type_II_gspE general secretory pathway protein E. 81.81
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 81.76
PRK09183259 transposase/IS protein; Provisional 81.69
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 81.66
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP bindi 81.51
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 81.37
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 81.27
KOG0347|consensus 731 81.21
cd01393226 recA_like RecA is a bacterial enzyme which has rol 80.95
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 80.91
KOG1806|consensus 1320 80.79
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 80.66
PHA00012361 I assembly protein 80.62
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 80.55
PRK07399314 DNA polymerase III subunit delta'; Validated 80.34
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 80.33
KOG2227|consensus529 80.19
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 80.18
>KOG0335|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.5e-75  Score=599.38  Aligned_cols=460  Identities=49%  Similarity=0.746  Sum_probs=413.6

Q ss_pred             CcccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccccccccCcccccccCCCccceeeecCCCCCCCCCc
Q psy1604         120 RDACFKCSEPKPEGAGGGAPGGADGAPFDPAKPPLYIPKDVDQSEDNLFSSGIQTGINFSGWENVEVKVSGDNPPRPIES  199 (693)
Q Consensus       120 r~~c~~c~~~~~~~~~~~~~~~~~~~~~d~~~~~~y~p~~~~~~~~~~~~~~~~~~~~f~~~~~~~v~~~~~~~~~~~~~  199 (693)
                      +..|.+|+++++....+....      ........+.++.....+...|.. ..+++||++++++.++++|.+.|.++.+
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~------~~~~~~k~~~~~~~~~~~~~~~~~-~~~~~nfd~~~~i~v~~~G~~~p~~i~~   75 (482)
T KOG0335|consen    3 LRSGRNCGEGGPRPKHCGNST------MEEEKQKGKKGPLKAYLEQAFFLG-ISTGINFDKYNDIPVKVSGRDVPPHIPT   75 (482)
T ss_pred             CccccccCCCCCCCccccccc------ccccccccccCCcccchhhhhhhc-cchhhccCCccceeeeccCCccCCCccc
Confidence            346777777766654433221      011233444445455555555533 8899999999999999999999999999


Q ss_pred             cccCCCCHHHHHHHHhCCCCCCCHHHHhhhhhhhcCCCEEEEccCCCChhHHHHHHHHHHhhcCCCCcccCC--CCCCeE
Q psy1604         200 FESAGLREILVKNLKKSNYTKPTPIQKYAIPAGLEGRDLMGCAQTGSGKTAAFLIPIMHHLLESPGELVTGY--CAQPEV  277 (693)
Q Consensus       200 f~~~~l~~~l~~~l~~~g~~~p~~~Q~~ai~~il~g~~vlv~a~TGsGKTl~~ll~il~~l~~~~~~~~~~~--~~~~~v  277 (693)
                      |.+..+.+.+..+++..+|..|||+|+.+||.+..|+++++||+||||||.+|++|++.+++..........  ...|++
T Consensus        76 f~~~~l~~~l~~ni~~~~~~~ptpvQk~sip~i~~Grdl~acAqTGsGKT~aFLiPii~~~~~~~~~~~~~~~~~~~P~~  155 (482)
T KOG0335|consen   76 FDEAILGEALAGNIKRSGYTKPTPVQKYSIPIISGGRDLMACAQTGSGKTAAFLIPIISYLLDEGPEDRGESGGGVYPRA  155 (482)
T ss_pred             ccccchhHHHhhccccccccCCCcceeeccceeecCCceEEEccCCCcchHHHHHHHHHHHHhcCcccCcccCCCCCCce
Confidence            999999999999999999999999999999999999999999999999999999999999998764322221  235899


Q ss_pred             EEEcCCHHHHHHHHHHHHHHhcCCCeeEEEEeCCCChHHHHHHHhcCCcEEEechhhHHHHHhcCCcCCCceeEEEEccc
Q psy1604         278 IICAPTRELVMQIHEVACKYAYSSVLKICLHYGGASSMHFNRQLEKGCNILVATMGRLKDILDRGRISLASVRFVVLDEA  357 (693)
Q Consensus       278 Lil~Ptr~La~Q~~~~~~~~~~~~~l~~~~~~gg~~~~~~~~~~~~~~~IlV~Tp~~L~~~l~~~~~~l~~~~~lVlDEa  357 (693)
                      ||++|||+|+.|++++.+++.....+++...||+.+...+.+.+.++|+|+||||++|.++++.+.+.+++++++|||||
T Consensus       156 lIlapTReL~~Qi~nea~k~~~~s~~~~~~~ygg~~~~~q~~~~~~gcdIlvaTpGrL~d~~e~g~i~l~~~k~~vLDEA  235 (482)
T KOG0335|consen  156 LILAPTRELVDQIYNEARKFSYLSGMKSVVVYGGTDLGAQLRFIKRGCDILVATPGRLKDLIERGKISLDNCKFLVLDEA  235 (482)
T ss_pred             EEEeCcHHHhhHHHHHHHhhcccccceeeeeeCCcchhhhhhhhccCccEEEecCchhhhhhhcceeehhhCcEEEecch
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhh-CCchHHHHHHhccCCCCCCCCcceEEeeccCchhHHhhhhhhhhhchhhhHHHHhhccccccceeEEEechhhh
Q psy1604         358 DRMLD-MGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADR  436 (693)
Q Consensus       358 h~l~~-~~~~~~i~~i~~~~~~~~~~~~q~lllSAT~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~d~~~~  436 (693)
                      |+|+| ++|.+++++|+....++....+|.+|||||+|..++.++..+                                
T Consensus       236 DrMlD~mgF~p~Ir~iv~~~~~~~~~~~qt~mFSAtfp~~iq~l~~~f--------------------------------  283 (482)
T KOG0335|consen  236 DRMLDEMGFEPQIRKIVEQLGMPPKNNRQTLLFSATFPKEIQRLAADF--------------------------------  283 (482)
T ss_pred             HHhhhhccccccHHHHhcccCCCCccceeEEEEeccCChhhhhhHHHH--------------------------------
Confidence            99999 999999999999998988889999999999999999877776                                


Q ss_pred             hhhcCcccchhHHhhcccCCccccccceeecccCchhhhcceEEEEeecccccccceeEEEEEccchhHHHHHHHHHhcc
Q psy1604         437 MLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKNYIFIAVGIIGGASTDVVQTILEVPKQQKKKKLLELLREK  516 (693)
Q Consensus       437 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~L~~~l~~~  516 (693)
                                                           +.++|+++.++..+....++.|.+..+.+..|...|+++|...
T Consensus       284 -------------------------------------l~~~yi~laV~rvg~~~~ni~q~i~~V~~~~kr~~Lldll~~~  326 (482)
T KOG0335|consen  284 -------------------------------------LKDNYIFLAVGRVGSTSENITQKILFVNEMEKRSKLLDLLNKD  326 (482)
T ss_pred             -------------------------------------hhccceEEEEeeeccccccceeEeeeecchhhHHHHHHHhhcc
Confidence                                                 5566999999999999999999999999999999999999853


Q ss_pred             C----CC-----cEEEEecChHhHHHHHHHHhhCCCceEEecCCCCHHHHHHHHHHHhcCCCcEEEEeCcccccCCCCCC
Q psy1604         517 D----ED-----GVIVFVSTIRNADFIACYLCETEIATTSIHGSRLQSQREQAIHDFKTKKMKVLVATAVASRGLDIKGI  587 (693)
Q Consensus       517 ~----~~-----kvLVF~~s~~~a~~l~~~L~~~~~~v~~lhg~~~~~~R~~~~~~F~~g~~~ILVaT~v~~~GiDip~v  587 (693)
                      .    ..     +++|||.+++.++.++.+|...++++..+||+.++.+|++.++.|++|++.+||||++++||||||+|
T Consensus       327 ~~~~~~~~~~~e~tlvFvEt~~~~d~l~~~l~~~~~~~~sIhg~~tq~er~~al~~Fr~g~~pvlVaT~VaaRGlDi~~V  406 (482)
T KOG0335|consen  327 DGPPSDGEPKWEKTLVFVETKRGADELAAFLSSNGYPAKSIHGDRTQIEREQALNDFRNGKAPVLVATNVAARGLDIPNV  406 (482)
T ss_pred             cCCcccCCcccceEEEEeeccchhhHHHHHHhcCCCCceeecchhhhhHHHHHHHHhhcCCcceEEEehhhhcCCCCCCC
Confidence            3    33     79999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CEEEEcCCCCChhhhhhhhcccccCCCcceEEEEeCCCCchHHHHHHHHHHHHcCCCchhHHhccCCCC
Q psy1604         588 RHVINYDLPQEIDEYVHRIGRTGRVGNKGRATSFYDPDQDGAIAKDLVRILEQAGQPVPEFLKFGGGGG  656 (693)
Q Consensus       588 ~~VI~~d~p~s~~~y~Qr~GRagR~G~~G~~~~~~~~~~d~~~~~~l~~~l~~~~~~vp~~l~~~~~~~  656 (693)
                      +|||+||+|.+..+|+||+|||||.|+.|.++.|++ ..+..+.+.|.++|.+++|++|+||.+++...
T Consensus       407 ~hVInyDmP~d~d~YvHRIGRTGR~Gn~G~atsf~n-~~~~~i~~~L~~~l~ea~q~vP~wl~~~~~~~  474 (482)
T KOG0335|consen  407 KHVINYDMPADIDDYVHRIGRTGRVGNGGRATSFFN-EKNQNIAKALVEILTEANQEVPQWLSELSRER  474 (482)
T ss_pred             ceeEEeecCcchhhHHHhccccccCCCCceeEEEec-cccchhHHHHHHHHHHhcccCcHHHHhhhhhc
Confidence            999999999999999999999999999999999999 67889999999999999999999999966544

>KOG0331|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF00641 zf-RanBP: Zn-finger in Ran binding protein and others; InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>KOG4198|consensus Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>smart00547 ZnF_RBZ Zinc finger domain Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>KOG4198|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>KOG1513|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0744|consensus Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1807|consensus Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK13700 conjugal transfer protein TraD; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>KOG1806|consensus Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG2227|consensus Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 1e-84
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 4e-62
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 8e-55
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 7e-25
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 5e-38
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 6e-13
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 5e-38
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 5e-13
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 2e-35
2jgn_A185 Ddx3 Helicase Domain Length = 185 3e-34
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 2e-31
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 1e-06
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 6e-30
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 2e-10
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 3e-28
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 8e-28
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 3e-09
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 2e-27
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 3e-09
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 4e-26
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 1e-24
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 3e-08
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 1e-23
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 4e-06
2hyi_C413 Structure Of The Human Exon Junction Complex With A 1e-23
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 1e-23
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 1e-23
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 2e-23
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-23
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 2e-23
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 2e-23
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-23
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 2e-23
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 7e-21
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 4e-23
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 6e-23
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 1e-22
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 1e-22
3ly5_A262 Ddx18 Dead-Domain Length = 262 5e-22
3ly5_A262 Ddx18 Dead-Domain Length = 262 2e-05
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 9e-22
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 6e-20
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 2e-21
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 9e-20
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 2e-21
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 1e-19
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 2e-20
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 2e-06
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 7e-20
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 4e-05
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 9e-20
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 3e-17
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 1e-19
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 1e-19
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 2e-05
2vso_A395 Crystal Structure Of A Translation Initiation Compl 1e-19
2vso_A395 Crystal Structure Of A Translation Initiation Compl 8e-13
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 2e-19
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 8e-17
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 3e-19
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 6e-19
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 9e-06
1fuu_A394 Yeast Initiation Factor 4a Length = 394 1e-18
1fuu_A394 Yeast Initiation Factor 4a Length = 394 4e-11
2hjv_A163 Structure Of The Second Domain (Residues 207-368) O 2e-18
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 3e-17
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 3e-06
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 1e-16
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 2e-16
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 2e-16
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 1e-15
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 1e-15
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 1e-15
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 1e-15
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 1e-15
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 4e-15
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 1e-14
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 1e-14
2rb4_A175 Crystal Structure Of The Helicase Domain Of Human D 1e-13
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 2e-13
4db4_A256 Mss116p Dead-Box Helicase Domain 2 Bound To A Chima 4e-11
4db2_C257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 4e-11
4db2_A257 Mss116p Dead-Box Helicase Domain 2 Bound To An Rna 5e-11
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 5e-11
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 8e-11
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 1e-08
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 3e-08
1oyw_A 523 Structure Of The Recq Catalytic Core Length = 523 9e-08
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 9e-08
1oyy_A 523 Structure Of The Recq Catalytic Core Bound To Atp-G 9e-08
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure 
Iteration: 1

 Score =  311 bits (796), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 157/258 (60%), Positives = 188/258 (72%), Gaps = 10/258 (3%)
Query: 400 KGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVA 459
           +GC++++AT GRL D +DR  I+    RFVVLDEADRMLDMGF  D++ +M H TM    
Sbjct: 178 RGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTM--RP 235
Query: 460 NRQTLMFSATFPETIQ-------KNYIFIAVGIIGGASTDVVQTILEVPXXXXXXXXXXX 512
             QTLMFSATFPE IQ       KNY+F+A+GI+GGA +DV QTI EV            
Sbjct: 236 EHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEV-NKYAKRSKLIE 294
Query: 513 XXXXDEDGVIVFVSTIRNADFIACYLCETEIATTSIHGSRLQSQREQAIHDFKTKKMKVL 572
                 DG IVFV T R ADF+A +L E E  TTSIHG RLQSQREQA+ DFK   MKVL
Sbjct: 295 ILSEQADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVL 354
Query: 573 VATAVASRGLDIKGIRHVINYDLPQEIDEYVHRIGRTGRVGNKGRATSFYDPDQDGAIAK 632
           +AT+VASRGLDIK I+HVINYD+P +ID+YVHRIGRTGRVGN GRATSF+DP++D AIA 
Sbjct: 355 IATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAA 414
Query: 633 DLVRILEQAGQPVPEFLK 650
           DLV+ILE +GQ VP+FL+
Sbjct: 415 DLVKILEGSGQTVPDFLR 432
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|2HJV|A Chain A, Structure Of The Second Domain (Residues 207-368) Of The Bacillus Subtilis Yxin Protein Length = 163 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|2RB4|A Chain A, Crystal Structure Of The Helicase Domain Of Human Ddx25 Rna Helicase Length = 175 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|4DB4|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To A Chimaeric Rna-Dna Duplex Length = 256 Back     alignment and structure
>pdb|4DB2|C Chain C, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|4DB2|A Chain A, Mss116p Dead-Box Helicase Domain 2 Bound To An Rna Duplex Length = 257 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-141
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-124
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 1e-140
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 1e-114
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 1e-123
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 1e-120
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 8e-50
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 1e-106
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 1e-106
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 3e-99
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 3e-31
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 3e-98
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 2e-34
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 3e-92
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 5e-32
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 3e-88
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 1e-84
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 3e-78
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 1e-65
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 2e-75
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 1e-25
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 9e-75
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 4e-63
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 1e-71
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 4e-24
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 2e-70
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 5e-28
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 4e-69
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 3e-51
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 4e-69
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 3e-60
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 2e-67
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 2e-27
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 3e-67
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 2e-21
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 6e-67
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 8e-57
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 6e-67
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 5e-59
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 7e-67
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 8e-59
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-66
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 6e-53
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 2e-63
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 1e-25
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 5e-62
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 4e-53
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 2e-59
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 8e-54
3bor_A237 Human initiation factor 4A-II; translation initiat 4e-58
3bor_A237 Human initiation factor 4A-II; translation initiat 6e-23
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 4e-58
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 2e-22
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 5e-58
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 3e-22
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-57
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 3e-53
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 7e-57
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 3e-22
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-55
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-18
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 8e-49
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 3e-44
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 2e-41
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 9e-41
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 1e-39
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 4e-36
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 8e-34
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 6e-23
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 7e-15
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 4e-10
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 2e-14
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 9e-10
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 1e-13
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 3e-10
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 1e-13
3b6e_A216 Interferon-induced helicase C domain-containing P; 2e-13
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 1e-12
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 8e-11
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 1e-11
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 4e-11
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 1e-10
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 5e-11
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 6e-11
1n0z_A45 ZNF265; zinc finger, RNA splicing, transcription; 2e-10
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-10
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 3e-05
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 2e-09
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 3e-09
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 6e-09
3gj8_B92 Nuclear pore complex protein NUP153; G protein, GD 2e-08
3gj8_B92 Nuclear pore complex protein NUP153; G protein, GD 5e-05
1yks_A440 Genome polyprotein [contains: flavivirin protease 6e-08
1yks_A440 Genome polyprotein [contains: flavivirin protease 2e-04
2lk0_A32 RNA-binding protein 5; zinc finger; NMR {Homo sapi 4e-07
3gj7_B98 Nuclear pore complex protein NUP153; G protein, GD 5e-07
3gj7_B98 Nuclear pore complex protein NUP153; G protein, GD 7e-05
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 9e-07
2k1p_A33 Zinc finger RAN-binding domain-containing protein 1e-06
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 7e-05
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 8e-05
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
 Score =  419 bits (1079), Expect = e-141
 Identities = 164/259 (63%), Positives = 199/259 (76%), Gaps = 10/259 (3%)

Query: 399 KKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDV 458
            +GC++++AT GRL D +DR  I+    RFVVLDEADRMLDMGF  D++ +M H TM   
Sbjct: 177 TRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMR-- 234

Query: 459 ANRQTLMFSATFPETIQ-------KNYIFIAVGIIGGASTDVVQTILEVPKQQKKKKLLE 511
              QTLMFSATFPE IQ       KNY+F+A+GI+GGA +DV QTI EV K  K+ KL+E
Sbjct: 235 PEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIE 294

Query: 512 LLREKDEDGVIVFVSTIRNADFIACYLCETEIATTSIHGSRLQSQREQAIHDFKTKKMKV 571
           +L E+  DG IVFV T R ADF+A +L E E  TTSIHG RLQSQREQA+ DFK   MKV
Sbjct: 295 ILSEQ-ADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKV 353

Query: 572 LVATAVASRGLDIKGIRHVINYDLPQEIDEYVHRIGRTGRVGNKGRATSFYDPDQDGAIA 631
           L+AT+VASRGLDIK I+HVINYD+P +ID+YVHRIGRTGRVGN GRATSF+DP++D AIA
Sbjct: 354 LIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIA 413

Query: 632 KDLVRILEQAGQPVPEFLK 650
            DLV+ILE +GQ VP+FL+
Sbjct: 414 ADLVKILEGSGQTVPDFLR 432
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Length = 510 Back     alignment and structure
>1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 Length = 45 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* Length = 92 Back     alignment and structure
>3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* Length = 92 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2lk0_A RNA-binding protein 5; zinc finger; NMR {Homo sapiens} PDB: 2lk1_A* Length = 32 Back     alignment and structure
>3gj7_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.93A {Rattus norvegicus} PDB: 2k0c_A 3ch5_B* 3gj6_B* Length = 98 Back     alignment and structure
>3gj7_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.93A {Rattus norvegicus} PDB: 2k0c_A 3ch5_B* 3gj6_B* Length = 98 Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
>2k1p_A Zinc finger RAN-binding domain-containing protein 2; ZNF265, RNA binding, ranbp2, RBZ, ZIS, alternative splicing, metal-binding, mRNA processing; NMR {Homo sapiens} PDB: 3g9y_A Length = 33 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
4gl2_A 699 Interferon-induced helicase C domain-containing P; 100.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 100.0
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3bor_A237 Human initiation factor 4A-II; translation initiat 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.98
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.98
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.98
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.98
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.98
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.97
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.97
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.97
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.97
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.96
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.95
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.95
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.95
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.95
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.94
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.94
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.94
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.93
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.92
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.91
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.83
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.89
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.86
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.83
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.83
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.83
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.78
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.76
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.72
2k1p_A33 Zinc finger RAN-binding domain-containing protein 98.82
2lk0_A32 RNA-binding protein 5; zinc finger; NMR {Homo sapi 98.75
1n0z_A45 ZNF265; zinc finger, RNA splicing, transcription; 98.68
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.59
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 98.05
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.93
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.92
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.91
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.87
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 97.83
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.77
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.02
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.55
3gj8_B92 Nuclear pore complex protein NUP153; G protein, GD 96.47
2ebq_A47 Nuclear pore complex protein NUP153; ZF-ranbp doma 96.19
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 96.18
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.96
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.81
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 95.7
3gj8_B92 Nuclear pore complex protein NUP153; G protein, GD 95.61
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 95.55
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.38
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 95.34
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 95.31
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.31
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 94.74
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 94.72
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.67
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.67
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 94.66
3gj5_B34 Nuclear pore complex protein NUP153; G protein, GD 94.63
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 94.57
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.4
2ebr_A47 Nuclear pore complex protein NUP153; ZF-ranbp doma 94.3
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 94.21
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.03
2v1u_A387 Cell division control protein 6 homolog; DNA repli 93.72
3gj3_B33 Nuclear pore complex protein NUP153; G protein, GD 93.64
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 93.41
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 93.22
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.03
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 92.99
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 92.9
2chg_A226 Replication factor C small subunit; DNA-binding pr 92.7
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 92.67
2d9g_A53 YY1-associated factor 2; ZF-ranbp domain, structur 92.54
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 92.47
3bos_A242 Putative DNA replication factor; P-loop containing 92.16
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 91.95
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 91.51
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 91.11
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 91.08
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 91.0
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 90.92
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 90.78
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 90.58
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 90.25
2ebv_A57 Nuclear pore complex protein NUP153; ZF-ranbp doma 90.23
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 90.2
2gno_A305 DNA polymerase III, gamma subunit-related protein; 89.92
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 89.72
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 89.28
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 88.89
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 88.08
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 87.91
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 87.82
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 87.72
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 86.69
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 86.69
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 86.37
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 85.72
2z43_A324 DNA repair and recombination protein RADA; archaea 85.62
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 85.13
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 84.61
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 84.31
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 84.23
3pvs_A447 Replication-associated recombination protein A; ma 84.12
3gj7_B98 Nuclear pore complex protein NUP153; G protein, GD 84.12
1nj3_A31 NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, 83.91
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 83.55
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 83.26
2crc_A52 Ubiquitin conjugating enzyme 7 interacting protein 82.8
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 82.74
2r6a_A454 DNAB helicase, replicative helicase; replication, 82.5
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 82.28
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 82.2
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 82.02
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 82.02
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 81.41
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 81.39
3co5_A143 Putative two-component system transcriptional RES 81.2
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 81.19
2fna_A357 Conserved hypothetical protein; structural genomic 81.09
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 80.88
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 80.83
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 80.42
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 80.34
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 80.01
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=2.3e-69  Score=591.87  Aligned_cols=428  Identities=58%  Similarity=0.944  Sum_probs=384.0

Q ss_pred             CCCCCCCCCCCCCcccccccccCcccccccCCCccceeeecCCCCCCCCCccccCCCCHHHHHHHHhCCCCCCCHHHHhh
Q psy1604         149 PAKPPLYIPKDVDQSEDNLFSSGIQTGINFSGWENVEVKVSGDNPPRPIESFESAGLREILVKNLKKSNYTKPTPIQKYA  228 (693)
Q Consensus       149 ~~~~~~y~p~~~~~~~~~~~~~~~~~~~~f~~~~~~~v~~~~~~~~~~~~~f~~~~l~~~l~~~l~~~g~~~p~~~Q~~a  228 (693)
                      ...+.+|+|++++++|.++|+....++++|++++++.+++++.+.|.++.+|++++|++.++++|+++||.+|||+|+++
T Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~a   86 (434)
T 2db3_A            7 EFPGEFYIPPEPSNDAIEIFSSGIASGIHFSKYNNIPVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCS   86 (434)
T ss_dssp             ------CCCCCCCCCHHHHTSCCCCCCTTGGGGGGSCEEEESSSCCCCCCCGGGSCCCHHHHHHHHHTTCCSCCHHHHHH
T ss_pred             CCCCCCCcCCCCchhHHHHhhcCcccccChhhhcCceeEecCCCCCCCcCChhhcCCCHHHHHHHHHcCCCCCCHHHHHH
Confidence            35678999999988888999888899999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhcCCCEEEEccCCCChhHHHHHHHHHHhhcCCCCcccCCCCCCeEEEEcCCHHHHHHHHHHHHHHhcCCCeeEEEE
Q psy1604         229 IPAGLEGRDLMGCAQTGSGKTAAFLIPIMHHLLESPGELVTGYCAQPEVIICAPTRELVMQIHEVACKYAYSSVLKICLH  308 (693)
Q Consensus       229 i~~il~g~~vlv~a~TGsGKTl~~ll~il~~l~~~~~~~~~~~~~~~~vLil~Ptr~La~Q~~~~~~~~~~~~~l~~~~~  308 (693)
                      ++.+++++|++++|+||||||++|++|+++++...+...   ...++++|||+|||+|+.|+++.+.++....++++..+
T Consensus        87 i~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~~~~~~---~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~  163 (434)
T 2db3_A           87 IPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHEL---ELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIV  163 (434)
T ss_dssp             HHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHHSCCCC---CTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEE
T ss_pred             HHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHhccccc---ccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEE
Confidence            999999999999999999999999999999998765321   13467899999999999999999999998888999999


Q ss_pred             eCCCChHHHHHHHhcCCcEEEechhhHHHHHhcCCcCCCceeEEEEccchhhhhCCchHHHHHHhccCCCCCCCCcceEE
Q psy1604         309 YGGASSMHFNRQLEKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLM  388 (693)
Q Consensus       309 ~gg~~~~~~~~~~~~~~~IlV~Tp~~L~~~l~~~~~~l~~~~~lVlDEah~l~~~~~~~~i~~i~~~~~~~~~~~~q~ll  388 (693)
                      +|+.....+...+..+++|+|+||++|.+++.+..+.+.++++|||||||+|++++|...+..++....++  ..+|+++
T Consensus       164 ~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~l~~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~--~~~q~l~  241 (434)
T 2db3_A          164 YGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMR--PEHQTLM  241 (434)
T ss_dssp             CTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTSCCCTTCCEEEEETHHHHTSTTTHHHHHHHHHCTTSC--SSCEEEE
T ss_pred             ECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCCcccccCCeEEEccHhhhhccCcHHHHHHHHHhcCCC--CCceEEE
Confidence            99999888888888899999999999999999888889999999999999999999999999998875433  4789999


Q ss_pred             eeccCchhHHhhhhhhhhhchhhhHHHHhhccccccceeEEEechhhhhhhcCcccchhHHhhcccCCccccccceeecc
Q psy1604         389 FSATFPETIQKKGCNILVATMGRLKDILDRGRISLASVRFVVLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSA  468 (693)
Q Consensus       389 lSAT~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  468 (693)
                      ||||+|..+..++..+                                                                
T Consensus       242 ~SAT~~~~~~~~~~~~----------------------------------------------------------------  257 (434)
T 2db3_A          242 FSATFPEEIQRMAGEF----------------------------------------------------------------  257 (434)
T ss_dssp             EESCCCHHHHHHHHTT----------------------------------------------------------------
T ss_pred             EeccCCHHHHHHHHHh----------------------------------------------------------------
Confidence            9999998877665444                                                                


Q ss_pred             cCchhhhcceEEEEeecccccccceeEEEEEccchhHHHHHHHHHhccCCCcEEEEecChHhHHHHHHHHhhCCCceEEe
Q psy1604         469 TFPETIQKNYIFIAVGIIGGASTDVVQTILEVPKQQKKKKLLELLREKDEDGVIVFVSTIRNADFIACYLCETEIATTSI  548 (693)
Q Consensus       469 t~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~L~~~l~~~~~~kvLVF~~s~~~a~~l~~~L~~~~~~v~~l  548 (693)
                           + .++..+..+.......++.+.+..+....|...|.+++..... ++||||++++.++.+++.|.+.++.+..+
T Consensus       258 -----l-~~~~~i~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~~l~~~~~-~~lVF~~t~~~a~~l~~~L~~~~~~~~~l  330 (434)
T 2db3_A          258 -----L-KNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQAD-GTIVFVETKRGADFLASFLSEKEFPTTSI  330 (434)
T ss_dssp             -----C-SSCEEEEESSTTCCCTTEEEEEEECCGGGHHHHHHHHHHHCCT-TEEEECSSHHHHHHHHHHHHHTTCCEEEE
T ss_pred             -----c-cCCEEEEeccccccccccceEEEEeCcHHHHHHHHHHHHhCCC-CEEEEEeCcHHHHHHHHHHHhCCCCEEEE
Confidence                 1 2444555555555667778888888888999999999987654 49999999999999999999999999999


Q ss_pred             cCCCCHHHHHHHHHHHhcCCCcEEEEeCcccccCCCCCCCEEEEcCCCCChhhhhhhhcccccCCCcceEEEEeCCCCch
Q psy1604         549 HGSRLQSQREQAIHDFKTKKMKVLVATAVASRGLDIKGIRHVINYDLPQEIDEYVHRIGRTGRVGNKGRATSFYDPDQDG  628 (693)
Q Consensus       549 hg~~~~~~R~~~~~~F~~g~~~ILVaT~v~~~GiDip~v~~VI~~d~p~s~~~y~Qr~GRagR~G~~G~~~~~~~~~~d~  628 (693)
                      ||++++.+|++++++|++|+.+|||||+++++|||+|++++||+||+|+++.+|+||+||+||.|+.|.|++|++++++.
T Consensus       331 hg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR~g~~G~a~~~~~~~~~~  410 (434)
T 2db3_A          331 HGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDR  410 (434)
T ss_dssp             STTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSCCCTTCCEEEESSCCSSHHHHHHHHTTSSCTTCCEEEEEEECTTTCG
T ss_pred             eCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCCCcccCCEEEEECCCCCHHHHHHHhcccccCCCCCEEEEEEeccccH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999988889


Q ss_pred             HHHHHHHHHHHHcCCCchhHHhcc
Q psy1604         629 AIAKDLVRILEQAGQPVPEFLKFG  652 (693)
Q Consensus       629 ~~~~~l~~~l~~~~~~vp~~l~~~  652 (693)
                      .++.++.+.|..+.+++|+||.++
T Consensus       411 ~~~~~l~~~l~~~~~~vp~~l~~~  434 (434)
T 2db3_A          411 AIAADLVKILEGSGQTVPDFLRTC  434 (434)
T ss_dssp             GGHHHHHHHHHHTTCCCCGGGC--
T ss_pred             HHHHHHHHHHHHcCCCCCHHHHhC
Confidence            999999999999999999999764
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2k1p_A Zinc finger RAN-binding domain-containing protein 2; ZNF265, RNA binding, ranbp2, RBZ, ZIS, alternative splicing, metal-binding, mRNA processing; NMR {Homo sapiens} PDB: 3g9y_A Back     alignment and structure
>2lk0_A RNA-binding protein 5; zinc finger; NMR {Homo sapiens} PDB: 2lk1_A* Back     alignment and structure
>1n0z_A ZNF265; zinc finger, RNA splicing, transcription; NMR {Homo sapiens} SCOP: g.41.11.1 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* Back     alignment and structure
>2ebq_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3gj8_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.82A {Rattus norvegicus} PDB: 3gj4_B* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3gj5_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.79A {Rattus norvegicus} SCOP: g.41.11.1 Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2ebr_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3gj3_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.79A {Rattus norvegicus} SCOP: g.41.11.1 PDB: 2gqe_A Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2d9g_A YY1-associated factor 2; ZF-ranbp domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2ebv_A Nuclear pore complex protein NUP153; ZF-ranbp domain, nucleoporin NUP153, 153 kDa nucleoporin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3gj7_B Nuclear pore complex protein NUP153; G protein, GDP, RAN, zinc finger, acetylation, cytoplasm, GTP-binding, HOST-virus interaction; HET: GDP; 1.93A {Rattus norvegicus} PDB: 2k0c_A 3ch5_B* 3gj6_B* Back     alignment and structure
>1nj3_A NPL4; NZF domain, rubredoxin knuckle, beta-ribbon, zinc- finger, ubiquitin, protein binding; NMR {Rattus norvegicus} SCOP: g.41.11.1 PDB: 1q5w_A Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2crc_A Ubiquitin conjugating enzyme 7 interacting protein 3; ZF-ranbp domain, hepatitis B virus X-associated protein 4, HBV associated factor 4; NMR {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 693
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 4e-51
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 4e-16
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 3e-47
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 2e-25
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 5e-45
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 2e-16
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 8e-45
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 5e-16
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 1e-42
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 7e-13
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 7e-37
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 7e-10
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 7e-37
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 5e-13
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 3e-34
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 2e-08
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 1e-32
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 3e-31
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 4e-10
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 3e-30
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 5e-07
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 8e-29
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 4e-06
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 3e-28
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 7e-28
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 6e-27
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 7e-27
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-25
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 7e-23
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 8e-22
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 7e-18
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 1e-20
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 2e-20
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 2e-20
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 8e-20
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 7e-19
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 0.002
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 9e-19
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 4e-17
d1s2ma2171 c.37.1.19 (A:252-422) Putative ATP-dependent RNA h 1e-16
d1n0za_45 g.41.11.1 (A:) Znf265, first zinc-finger domain {H 7e-13
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 1e-12
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 1e-09
d1gm5a4206 c.37.1.19 (A:550-755) RecG helicase domain {Thermo 2e-09
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 2e-07
d1z3ix1346 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi 1e-05
d1tf5a4175 c.37.1.19 (A:396-570) Translocation ATPase SecA, n 6e-04
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 0.001
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: putative ATP-dependent RNA helicase VlgB
species: Flatworm (Dugesia japonica) [TaxId: 6161]

 Score =  175 bits (445), Expect = 4e-51
 Identities = 106/222 (47%), Positives = 152/222 (68%), Gaps = 3/222 (1%)

Query: 181 WENVEVKVSGDN--PPRPIESFESAGLREILVKNLKKSNYTKPTPIQKYAIPAGLEGRDL 238
           ++++ V V+G +      IE+F+   L   +  N+  ++Y +PTPIQK AIPA LE RD+
Sbjct: 2   YDSIPVSVTGPDYSATNVIENFDELKLDPTIRNNILLASYQRPTPIQKNAIPAILEHRDI 61

Query: 239 MGCAQTGSGKTAAFLIPIMHHLLESP-GELVTGYCAQPEVIICAPTRELVMQIHEVACKY 297
           M CAQTGSGKTAAFLIPI++HL+     +      A P+ +I APTREL +QI   + K+
Sbjct: 62  MACAQTGSGKTAAFLIPIINHLVCQDLNQQRYSKTAYPKCLILAPTRELAIQILSESQKF 121

Query: 298 AYSSVLKICLHYGGASSMHFNRQLEKGCNILVATMGRLKDILDRGRISLASVRFVVLDEA 357
           + ++ L+ C+ YGGA +    R+++ GC++LVAT GRL D +++ +ISL   +++VLDEA
Sbjct: 122 SLNTPLRSCVVYGGADTHSQIREVQMGCHLLVATPGRLVDFIEKNKISLEFCKYIVLDEA 181

Query: 358 DRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQK 399
           DRMLDMGF   I+ +++ S MP   NRQTLMFSATFP+ IQK
Sbjct: 182 DRMLDMGFEPQIRKIIEESNMPSGINRQTLMFSATFPKEIQK 223
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 206 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Length = 175 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.98
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.97
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.96
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.96
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.96
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.96
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.95
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.95
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.94
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.91
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.91
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.91
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.91
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.9
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.88
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.85
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.81
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.76
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.73
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.73
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.72
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.71
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.71
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.71
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.71
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.7
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.64
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.63
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.58
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.53
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.51
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.46
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.36
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.32
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.28
d1n0za_45 Znf265, first zinc-finger domain {Human (Homo sapi 98.84
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.76
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.63
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.58
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.79
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.29
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.92
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.13
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 96.1
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 96.0
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.94
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.72
d2qy9a2211 GTPase domain of the signal recognition particle r 95.38
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.3
d1vmaa2213 GTPase domain of the signal recognition particle r 94.88
d1okkd2207 GTPase domain of the signal recognition particle r 94.65
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.5
d1ls1a2207 GTPase domain of the signal sequence recognition p 94.31
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.07
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.0
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 93.75
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 93.41
d2gqea129 Nuclear pore complex protein nup153 {Human (Homo s 92.85
d1j8yf2211 GTPase domain of the signal sequence recognition p 92.59
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 92.37
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 91.99
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.5
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 90.92
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 90.82
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 90.73
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 90.58
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 89.49
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 89.01
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 88.69
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 87.89
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 87.64
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 87.58
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 87.52
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 87.1
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 86.39
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 86.08
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 84.84
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 84.73
d1q5wa_31 Npl4 {Rat (Rattus norvegicus) [TaxId: 10116]} 84.33
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 84.28
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 84.06
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 83.65
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 83.29
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 82.67
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 81.83
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 80.99
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 80.95
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 80.44
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 80.18
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.5e-38  Score=310.05  Aligned_cols=200  Identities=31%  Similarity=0.464  Sum_probs=185.1

Q ss_pred             CCCCCCccccCCCCHHHHHHHHhCCCCCCCHHHHhhhhhhhcCCCEEEEccCCCChhHHHHHHHHHHhhcCCCCcccCCC
Q psy1604         193 PPRPIESFESAGLREILVKNLKKSNYTKPTPIQKYAIPAGLEGRDLMGCAQTGSGKTAAFLIPIMHHLLESPGELVTGYC  272 (693)
Q Consensus       193 ~~~~~~~f~~~~l~~~l~~~l~~~g~~~p~~~Q~~ai~~il~g~~vlv~a~TGsGKTl~~ll~il~~l~~~~~~~~~~~~  272 (693)
                      ......+|++++|++.++++|+++||.+|||+|+++||.+++|+|++++|+||||||++|++|+++++...        .
T Consensus        12 ~~~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~--------~   83 (222)
T d2j0sa1          12 EVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQ--------V   83 (222)
T ss_dssp             TCCCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTT--------S
T ss_pred             CCCCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhccccccccccc--------c
Confidence            34455689999999999999999999999999999999999999999999999999999999999988654        3


Q ss_pred             CCCeEEEEcCCHHHHHHHHHHHHHHhcCCCeeEEEEeCCCChHHHHHHHhcCCcEEEechhhHHHHHhcCCcCCCceeEE
Q psy1604         273 AQPEVIICAPTRELVMQIHEVACKYAYSSVLKICLHYGGASSMHFNRQLEKGCNILVATMGRLKDILDRGRISLASVRFV  352 (693)
Q Consensus       273 ~~~~vLil~Ptr~La~Q~~~~~~~~~~~~~l~~~~~~gg~~~~~~~~~~~~~~~IlV~Tp~~L~~~l~~~~~~l~~~~~l  352 (693)
                      ..+++||++|||+|+.|+++.+.++.....+++..++|+.........+..+++|+|+||++|.+++.+..+.+++++++
T Consensus        84 ~~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~~~~~~l~~l  163 (222)
T d2j0sa1          84 RETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKML  163 (222)
T ss_dssp             CSCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTSSCCTTCCEE
T ss_pred             cCceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccccccccccceee
Confidence            45689999999999999999999999999999999999999998888888999999999999999999999999999999


Q ss_pred             EEccchhhhhCCchHHHHHHhccCCCCCCCCcceEEeeccCchhHHhhhhhh
Q psy1604         353 VLDEADRMLDMGFLGDIQHVMQHSTMPDVANRQTLMFSATFPETIQKKGCNI  404 (693)
Q Consensus       353 VlDEah~l~~~~~~~~i~~i~~~~~~~~~~~~q~lllSAT~~~~~~~~~~~~  404 (693)
                      |+||||+|++.+|...+..|+....    ..+|++++|||+++++..++..+
T Consensus       164 VlDEaD~ll~~~f~~~i~~I~~~l~----~~~Q~ilfSAT~~~~v~~l~~~~  211 (222)
T d2j0sa1         164 VLDEADEMLNKGFKEQIYDVYRYLP----PATQVVLISATLPHEILEMTNKF  211 (222)
T ss_dssp             EEETHHHHTSTTTHHHHHHHHTTSC----TTCEEEEEESCCCHHHHTTGGGT
T ss_pred             eecchhHhhhcCcHHHHHHHHHhCC----CCCEEEEEEEeCCHHHHHHHHHH
Confidence            9999999999999999999998743    47899999999999998887776
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n0za_ g.41.11.1 (A:) Znf265, first zinc-finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2gqea1 g.41.11.1 (A:3-31) Nuclear pore complex protein nup153 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5wa_ g.41.11.1 (A:) Npl4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure