Psyllid ID: psy16107

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MDSPQMYDNTPQPNAASIQQEAMNVKKQQLTQHQHMKRYTDLADLNTPEISLDLQNLIDDSQFNEGLFTEILNQGQGKPRQQFPARSNTLAYMPQPVHFESSSSNSTGGPNIKEEPVESEFRHQTTPYNVISNGAPTNFNTPLAHSSKSSNQHHSHHHHHRKNGKSVDKNTDEYKRRRERNNIAVRKSREKAKIRSRETEEKVKLLVKENERLQKRIELLSEELNVLRSLFTNVGVLPEHLHRELNKHFDSYPHVQ
cccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccc
cccccHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHccccccEEcHHHHcccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHcccccccHcHHHHHHHHcccccc
mdspqmydntpqpnaASIQQEAMNVKKQQLTQHQHMKRYtdladlntpeisLDLQnliddsqfneGLFTEILnqgqgkprqqfparsntlaympqpvhfessssnstggpnikeepvesefrhqttpynvisngaptnfntplahsskssnqhhshhhhhrkngksvdkntdeykrrRERNNIAVRKSREKAKIRSRETEEKVKLLVKENERLQKRIELLSEELNVLRSLFTNVGVLPEHLHRELNkhfdsyphvq
mdspqmydNTPQPNAASIQQEAMNVKKQQLTQHQHMKRYTDLADLNTPEISLDLQNLIDDSQFNEGLFTEIlnqgqgkprQQFPARSNTLAYMPQPVHFessssnstggpnIKEEPVESEFRHQTTPYNVISNGAPTNFNTPLAHSSKSSNQHHShhhhhrkngksvdkntdeykrrrernniavrksrekakirsreteekvKLLVKENERLQKRIELLSEELNVLRSLFTNVGVLPEHLHRelnkhfdsyphvq
MDSPQMYDNTPQPNAASIQQEAMNVKKQQLTQHQHMKRYTDLADLNTPEISLDLQNLIDDSQFNEGLFTEILNQGQGKPRQQFPARSNTLAYMPQPVHFESSSSNSTGGPNIKEEPVESEFRHQTTPYNVISNGAPTNFNTPLAhsskssnqhhshhhhhRKNGKSVDKNTDEYKRRRERNNIAVRKSREKAKIRSRETeekvkllvkeNERLQKRIELLSEELNVLRSLFTNVGVLPEHLHRELNKHFDSYPHVQ
****************************************DLADLNTPEISLDLQNLIDDSQFNEGLFTEIL********************************************************************************************************************************************LQKRIELLSEELNVLRSLFTNVGVLPEHLHREL***********
*******************************************DLNTPEISLDLQNLIDDSQFNE*********************************************************************************************************************************RSRETEEKVKLLVKENERLQKRIELLSEELNVLRSLFTNVGV*************DSYP***
**************AASIQQEAM************MKRYTDLADLNTPEISLDLQNLIDDSQFNEGLFTEILNQ********FPARSNTLAYMPQPVH************************HQTTPYNVISNGAPTNFNTPL*************************KNTDEYKRRRERNNIAVR**************EKVKLLVKENERLQKRIELLSEELNVLRSLFTNVGVLPEHLHRELNKHFDSYPHVQ
************PNAASIQQEAM*VKKQQLTQHQHMKRYTDLADLNTPEISLDLQNLIDDSQFNEGLFTEILNQGQ****QQFPARSNTLAYMP****************************************************************************TDEYKRRRERNNIAVRKSREKAKIRSRETEEKVKLLVKENERLQKRIELLSEELNVLRSLFTNVGVLPEHLHRELNKHFDSYP***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSPQMYDNTPQPNAASIQQEAMNVKKQQLTQHQHMKRYTDLADLNTPEISLDLQNLIDDSQFNEGLFTEILNQGQGKPRQQFPARSNTLAYMPQPVHFESSSSNSTGGPNIKEEPVESEFRHQTTPYNVISNGAPTNFNTPLAHSSKSSNQHHSHHHHHRKNGKSVDKNTDEYKRRRERNNIAVRKSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFTNVGVLPEHLHRELNKHFDSYPHVQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query256 2.2.26 [Sep-21-2011]
Q02637449 CCAAT/enhancer-binding pr yes N/A 0.871 0.496 0.325 4e-22
Q05826328 CCAAT/enhancer-binding pr yes N/A 0.289 0.225 0.649 2e-18
P17676345 CCAAT/enhancer-binding pr yes N/A 0.300 0.223 0.637 2e-18
O02755348 CCAAT/enhancer-binding pr yes N/A 0.300 0.221 0.625 6e-18
P28033296 CCAAT/enhancer-binding pr yes N/A 0.285 0.246 0.644 3e-17
P21272297 CCAAT/enhancer-binding pr yes N/A 0.281 0.242 0.653 5e-17
P49715358 CCAAT/enhancer-binding pr no N/A 0.292 0.209 0.602 6e-17
P05554358 CCAAT/enhancer-binding pr no N/A 0.277 0.198 0.608 3e-16
O02754353 CCAAT/enhancer-binding pr yes N/A 0.277 0.201 0.608 4e-16
P53566359 CCAAT/enhancer-binding pr no N/A 0.273 0.194 0.602 1e-15
>sp|Q02637|CEBP_DROME CCAAT/enhancer-binding protein OS=Drosophila melanogaster GN=slbo PE=1 SV=3 Back     alignment and function desciption
 Score =  105 bits (261), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 113/347 (32%), Positives = 157/347 (45%), Gaps = 124/347 (35%)

Query: 8   DNTPQPNAASIQQEAMNVKKQ--------QLTQHQHMKRY---TDLADLNTPEISLDLQN 56
           +NT Q  A  ++Q AM+  +Q         L Q Q +++Y   TDL +L T EI+LDLQ+
Sbjct: 78  NNTSQDAALLVKQHAMHQMQQVAALGSNNNLLQKQMLQQYSTQTDLDELTTQEITLDLQH 137

Query: 57  LIDDSQFNE----GLFTEILNQGQG---------------KPRQQFPARS---------- 87
           LIDD QF +    G+F++++    G               K  QQ   R+          
Sbjct: 138 LIDD-QFRDTETLGIFSDMVTSPGGLSATLPPSGMVSAAAKVLQQQTLRNQHGYGGRGGG 196

Query: 88  ----NTLAYMPQPVHFE---SSSSNSTGGPN---IKEEPVESEFRH-------------- 123
                 LAYMPQPVH     SS  NS+ G +   IKEEP++ E+R               
Sbjct: 197 GGAGGALAYMPQPVHATYNNSSDENSSVGSDSSTIKEEPIDPEYRRHLQEAASQQAAFMG 256

Query: 124 --------------------------QTTPYNVISNGAP--------TNFNTP------- 142
                                      TTP +  SNG+         TN  T        
Sbjct: 257 NGAGLYNGYGSGANGLTGGGNPLNGGNTTPSSNGSNGSTGSSNGSQFTNLTTANVLAHHN 316

Query: 143 LAHSSKSSNQH-----HSHHH-------------HHRKNGKSVDKNTDEYKRRRERNNIA 184
           L H + ++  H     HS  H             H + + K VDK TDEY+RRRERNNIA
Sbjct: 317 LPHLAAAAGAHNLLKQHSKLHAQQQHQQHQQQQQHRKHSNKHVDKGTDEYRRRRERNNIA 376

Query: 185 VRKSREKAKIRSRETEEKVKLLVKENERLQKRIELLSEELNVLRSLF 231
           VRKSREKAK+RSRE EE+VK L+KE + L +++  ++ EL + + ++
Sbjct: 377 VRKSREKAKVRSREVEERVKSLLKEKDALIRQLGEMTNELQLHKQIY 423
May be required for the expression of gene products mediating border cell migration. Among the DNA sequences that this protein binds with high affinity is a conserved site within the promoter of its gene.
Drosophila melanogaster (taxid: 7227)
>sp|Q05826|CEBPB_CHICK CCAAT/enhancer-binding protein beta OS=Gallus gallus GN=CEBPB PE=2 SV=1 Back     alignment and function description
>sp|P17676|CEBPB_HUMAN CCAAT/enhancer-binding protein beta OS=Homo sapiens GN=CEBPB PE=1 SV=2 Back     alignment and function description
>sp|O02755|CEBPB_BOVIN CCAAT/enhancer-binding protein beta OS=Bos taurus GN=CEBPB PE=3 SV=1 Back     alignment and function description
>sp|P28033|CEBPB_MOUSE CCAAT/enhancer-binding protein beta OS=Mus musculus GN=Cebpb PE=1 SV=1 Back     alignment and function description
>sp|P21272|CEBPB_RAT CCAAT/enhancer-binding protein beta OS=Rattus norvegicus GN=Cebpb PE=2 SV=1 Back     alignment and function description
>sp|P49715|CEBPA_HUMAN CCAAT/enhancer-binding protein alpha OS=Homo sapiens GN=CEBPA PE=1 SV=3 Back     alignment and function description
>sp|P05554|CEBPA_RAT CCAAT/enhancer-binding protein alpha OS=Rattus norvegicus GN=Cebpa PE=1 SV=3 Back     alignment and function description
>sp|O02754|CEBPA_BOVIN CCAAT/enhancer-binding protein alpha OS=Bos taurus GN=CEBPA PE=3 SV=1 Back     alignment and function description
>sp|P53566|CEBPA_MOUSE CCAAT/enhancer-binding protein alpha OS=Mus musculus GN=Cebpa PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
328719345285 PREDICTED: CCAAT/enhancer-binding protei 0.976 0.877 0.632 4e-77
270009897317 hypothetical protein TcasGA2_TC009220 [T 0.972 0.785 0.496 3e-59
91086097333 PREDICTED: similar to ccaat/enhancer bin 0.972 0.747 0.496 3e-59
307207492346 CCAAT/enhancer-binding protein [Harpegna 0.847 0.627 0.482 2e-47
328787763 358 PREDICTED: CCAAT/enhancer-binding protei 0.851 0.608 0.486 3e-46
340712766353 PREDICTED: CCAAT/enhancer-binding protei 0.851 0.617 0.486 4e-46
380021546 357 PREDICTED: CCAAT/enhancer-binding protei 0.851 0.610 0.475 1e-44
307166783349 CCAAT/enhancer-binding protein [Camponot 0.910 0.667 0.456 7e-44
322802836316 hypothetical protein SINV_03281 [Solenop 0.906 0.734 0.453 3e-43
332021215 485 CCAAT/enhancer-binding protein [Acromyrm 0.824 0.435 0.450 4e-43
>gi|328719345|ref|XP_003246737.1| PREDICTED: CCAAT/enhancer-binding protein-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  293 bits (751), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 184/291 (63%), Positives = 209/291 (71%), Gaps = 41/291 (14%)

Query: 1   MDSPQMYDNTPQPNA-------ASIQQEAMNVKKQQLTQHQHMKRYTDLADLNTPEISLD 53
           M+SPQMYD  PQP+A        S Q+ AM  KK QL Q   +K   D+++L+TPEISLD
Sbjct: 1   MNSPQMYDTAPQPHAHQPQHHQISQQELAMAAKKAQLGQ---LKNRYDISELSTPEISLD 57

Query: 54  LQNLIDDSQFNEGLFTEILNQGQGK--------------PRQQFPARSNTLAYMPQPVHF 99
           LQNLIDDSQF+EGLFTEIL QGQ K               +  F +R+ TLAYMPQPVH+
Sbjct: 58  LQNLIDDSQFSEGLFTEILQQGQVKLPNGTGGGGGRNGVNQNGFNSRT-TLAYMPQPVHY 116

Query: 100 ESSSSNSTGGPNIKEEPVES-EFRHQTTPYN--------VISNGAPTNFNTPLAHSSKSS 150
           ES+ + STGGP IKEEP ES EFR+Q              +SNG    F T    S+ SS
Sbjct: 117 ESTPA-STGGP-IKEEPPESVEFRNQQQQQQQQQQQQQQYLSNGQGGAFQTSPVSSNGSS 174

Query: 151 NQHHSHHHHHRK-----NGKSVDKNTDEYKRRRERNNIAVRKSREKAKIRSRETEEKVKL 205
           +   +HHH+H +     + KSVDKNTDEYKRRRERNNIAVRKSREKAKIRSRETEEKVKL
Sbjct: 175 SHLKAHHHNHHRKSSSGSNKSVDKNTDEYKRRRERNNIAVRKSREKAKIRSRETEEKVKL 234

Query: 206 LVKENERLQKRIELLSEELNVLRSLFTNVGVLPEHLHRELNKHFDSYPHVQ 256
           LVKENERLQKRIELLSEELNVLRSLFTNVGVLPEHLHRELNKHFD+YPH+Q
Sbjct: 235 LVKENERLQKRIELLSEELNVLRSLFTNVGVLPEHLHRELNKHFDAYPHLQ 285

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270009897|gb|EFA06345.1| hypothetical protein TcasGA2_TC009220 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91086097|ref|XP_967524.1| PREDICTED: similar to ccaat/enhancer binding protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307207492|gb|EFN85203.1| CCAAT/enhancer-binding protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328787763|ref|XP_003251000.1| PREDICTED: CCAAT/enhancer-binding protein [Apis mellifera] Back     alignment and taxonomy information
>gi|340712766|ref|XP_003394926.1| PREDICTED: CCAAT/enhancer-binding protein-like [Bombus terrestris] gi|350409195|ref|XP_003488647.1| PREDICTED: CCAAT/enhancer-binding protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380021546|ref|XP_003694624.1| PREDICTED: CCAAT/enhancer-binding protein-like [Apis florea] Back     alignment and taxonomy information
>gi|307166783|gb|EFN60745.1| CCAAT/enhancer-binding protein [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322802836|gb|EFZ23032.1| hypothetical protein SINV_03281 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332021215|gb|EGI61600.1| CCAAT/enhancer-binding protein [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query256
FB|FBgn0005638449 slbo "slow border cells" [Dros 0.562 0.320 0.304 7.2e-21
ZFIN|ZDB-GENE-020111-2288 cebpa "CCAAT/enhancer binding 0.273 0.243 0.557 4.5e-20
UNIPROTKB|O02754353 CEBPA "CCAAT/enhancer-binding 0.292 0.212 0.564 6.8e-18
UNIPROTKB|F1RNW6354 CEBPA "Uncharacterized protein 0.292 0.211 0.564 6.9e-18
UNIPROTKB|P49715358 CEBPA "CCAAT/enhancer-binding 0.292 0.209 0.564 7.5e-18
RGD|2326358 Cebpa "CCAAT/enhancer binding 0.292 0.209 0.564 7.5e-18
MGI|MGI:99480359 Cebpa "CCAAT/enhancer binding 0.292 0.208 0.564 7.7e-18
UNIPROTKB|E5Q8C6346 CEBPB "CCAAT enhancer binding 0.300 0.222 0.587 4.4e-17
UNIPROTKB|F1SBE1346 F1SBE1 "Uncharacterized protei 0.300 0.222 0.587 4.4e-17
MGI|MGI:88373296 Cebpb "CCAAT/enhancer binding 0.300 0.260 0.587 6.7e-17
FB|FBgn0005638 slbo "slow border cells" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 171 (65.3 bits), Expect = 7.2e-21, Sum P(2) = 7.2e-21
 Identities = 45/148 (30%), Positives = 68/148 (45%)

Query:   101 SSSSNSTGGPNIKEEPVESEFRHQTTPYNVISNGAPTNFNTPLAXXXXXXXXXXXXXXXX 160
             + S+ S+ G         +   H   P+   + GA                         
Sbjct:   292 NGSTGSSNGSQFTNLTTANVLAHHNLPHLAAAAGAHNLLKQHSKLHAQQQHQQHQQQQQH 351

Query:   161 RKNG-KSVDKNTDEYKRRRERNNIAVRKSREKAKIRSRETXXXXXXXXXXNERLQKRIEL 219
             RK+  K VDK TDEY+RRRERNNIAVRKSREKAK+RSRE            + L +++  
Sbjct:   352 RKHSNKHVDKGTDEYRRRRERNNIAVRKSREKAKVRSREVEERVKSLLKEKDALIRQLGE 411

Query:   220 LSEELNVLRSLFTNVGVLPEHLHRELNK 247
             ++ EL + + ++     L  H + E+++
Sbjct:   412 MTNELQLHKQIYMQ---LMNHANPEVSR 436
GO:0005634 "nucleus" evidence=NAS;IDA
GO:0007298 "border follicle cell migration" evidence=NAS;IMP;TAS
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0000977 "RNA polymerase II regulatory region sequence-specific DNA binding" evidence=IDA
GO:0001708 "cell fate specification" evidence=TAS
GO:0046982 "protein heterodimerization activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=NAS
GO:0003677 "DNA binding" evidence=NAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0046427 "positive regulation of JAK-STAT cascade" evidence=IPI
ZFIN|ZDB-GENE-020111-2 cebpa "CCAAT/enhancer binding protein (C/EBP), alpha" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O02754 CEBPA "CCAAT/enhancer-binding protein alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RNW6 CEBPA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P49715 CEBPA "CCAAT/enhancer-binding protein alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|2326 Cebpa "CCAAT/enhancer binding protein (C/EBP), alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:99480 Cebpa "CCAAT/enhancer binding protein (C/EBP), alpha" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E5Q8C6 CEBPB "CCAAT enhancer binding protein beta" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1SBE1 F1SBE1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:88373 Cebpb "CCAAT/enhancer binding protein (C/EBP), beta" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 5e-14
smart0033865 smart00338, BRLZ, basic region leucin zipper 5e-13
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 8e-08
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 3e-06
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information 
 Score = 64.6 bits (158), Expect = 5e-14
 Identities = 28/54 (51%), Positives = 38/54 (70%)

Query: 170 NTDEYKRRRERNNIAVRKSREKAKIRSRETEEKVKLLVKENERLQKRIELLSEE 223
             DEY+ RR RNN A R+SREK K R  E EE+VK L +EN +L++++E L +E
Sbjct: 1   KDDEYRDRRRRNNEAARRSREKKKQREEELEERVKELEEENAQLRQKVEQLEKE 54

Length = 54
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 256
KOG3119|consensus269 99.77
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.47
smart0033865 BRLZ basic region leucin zipper. 99.39
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.04
KOG4571|consensus294 98.92
KOG0837|consensus279 98.0
KOG4005|consensus 292 97.79
KOG3584|consensus348 97.69
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 97.14
KOG3863|consensus604 97.01
KOG4343|consensus 655 96.92
KOG0709|consensus 472 96.51
KOG1414|consensus 395 95.81
KOG4196|consensus135 94.52
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 90.52
PF0733476 IFP_35_N: Interferon-induced 35 kDa protein (IFP 3 90.27
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 90.21
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 88.69
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 88.67
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 88.36
TIGR0244965 conserved hypothetical protein TIGR02449. Members 88.14
PRK00888105 ftsB cell division protein FtsB; Reviewed 88.04
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 87.19
PF0755846 Shugoshin_N: Shugoshin N-terminal coiled-coil regi 86.89
PRK09413121 IS2 repressor TnpA; Reviewed 86.54
PRK13922 276 rod shape-determining protein MreC; Provisional 86.17
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 85.92
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 85.82
PRK00888105 ftsB cell division protein FtsB; Reviewed 85.72
PF1270987 Kinetocho_Slk19: Central kinetochore-associated; I 85.65
KOG1414|consensus395 85.0
KOG1318|consensus411 84.87
COG2433 652 Uncharacterized conserved protein [Function unknow 84.7
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 84.34
KOG1318|consensus411 84.02
TIGR0220985 ftsL_broad cell division protein FtsL. This model 83.6
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 82.62
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 82.45
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 82.23
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 82.21
PF07047134 OPA3: Optic atrophy 3 protein (OPA3); InterPro: IP 81.8
PRK10884206 SH3 domain-containing protein; Provisional 80.89
PF05529192 Bap31: B-cell receptor-associated protein 31-like 80.45
>KOG3119|consensus Back     alignment and domain information 
Probab=99.77  E-value=9.5e-18  Score=152.72  Aligned_cols=72  Identities=49%  Similarity=0.650  Sum_probs=67.8

Q ss_pred             CCCCCCCCCCHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy16107        162 KNGKSVDKNTDEYKRRRERNNIAVRKSREKAKIRSRETEEKVKLLVKENERLQKRIELLSEELNVLRSLFTN  233 (256)
Q Consensus       162 k~~k~~~k~dd~Yr~RReRNNiAaRKSReKrK~R~~el~~kv~~Le~EN~~Lk~~Ie~L~kEl~~LK~ll~q  233 (256)
                      ........+|++||+||+|||+||||||+|+|+++.++..|+..|++||+.|+.+|++|++|+..||.+|.+
T Consensus       183 ~~~~~~~~~~~~y~err~rNN~A~~kSR~~~k~~~~e~~~r~~~leken~~lr~~v~~l~~el~~~~~~~~~  254 (269)
T KOG3119|consen  183 KLSSPVEKKDPEYKERRRRNNEAVRKSRDKRKQKEDEMAHRVAELEKENEALRTQVEQLKKELATLRRLFLQ  254 (269)
T ss_pred             cCCCchhcCCHHHHHHHHhhhHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            344556678999999999999999999999999999999999999999999999999999999999999998

>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4571|consensus Back     alignment and domain information
>KOG0837|consensus Back     alignment and domain information
>KOG4005|consensus Back     alignment and domain information
>KOG3584|consensus Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG3863|consensus Back     alignment and domain information
>KOG4343|consensus Back     alignment and domain information
>KOG0709|consensus Back     alignment and domain information
>KOG1414|consensus Back     alignment and domain information
>KOG4196|consensus Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF07334 IFP_35_N: Interferon-induced 35 kDa protein (IFP 35) N-terminus; InterPro: IPR009938 This entry represents the N terminus of interferon-induced 35 kDa protein (IFP 35) (approximately 80 residues long), which contains a leucine zipper motif in an alpha helical configuration [] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF07558 Shugoshin_N: Shugoshin N-terminal coiled-coil region; InterPro: IPR011516 This entry represents the N-terminal domain of Shugoshin (Sgo1) kinetochore-attachment proteins Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore Back     alignment and domain information
>KOG1414|consensus Back     alignment and domain information
>KOG1318|consensus Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>KOG1318|consensus Back     alignment and domain information
>TIGR02209 ftsL_broad cell division protein FtsL Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF07047 OPA3: Optic atrophy 3 protein (OPA3); InterPro: IPR010754 OPA3 deficiency causes type III 3-methylglutaconic aciduria (MGA) in humans Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF05529 Bap31: B-cell receptor-associated protein 31-like ; InterPro: IPR008417 Bap31 is a polytopic integral protein of the endoplasmic reticulum membrane and a substrate of caspase-8 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
1hjb_A87 Crystal Structure Of Runx-1AML1CBFALPHA RUNT DOMAIN 5e-16
1io4_A78 Crystal Structure Of Runx-1AML1CBFALPHA RUNT DOMAIN 8e-16
2e42_A78 Crystal Structure Of CEBPBETA BZIP HOMODIMER V285A 3e-15
2e43_A78 Crystal Structure Of CEBPBETA BZIP HOMODIMER K269A 3e-15
1ci6_B63 Transcription Factor Atf4-CEBP BETA BZIP HETERODIME 4e-12
1h89_A64 Crystal Structure Of Ternary Protein-Dna Complex2 L 6e-12
1nwq_A62 Crystal Structure Of CEBPALPHA-Dna Complex Length = 5e-10
>pdb|1HJB|A Chain A, Crystal Structure Of Runx-1AML1CBFALPHA RUNT DOMAIN AND CEBPBETA BZIP DIMERIC BOUND TO A DNA FRAGMENT FROM THE Csf-1r Promoter Length = 87 Back     alignment and structure 
Iteration: 1

 Score = 81.3 bits (199), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 57/80 (71%), Gaps = 3/80 (3%)
Query: 162 KNGKSVDKNTDEYKRRRERNNIAVRKSREKAKIRSRETXXXXXXXXXXNERLQKRIELLS 221
           K  K+VDK++DEYK RRERNNIAVRKSR+KAK+R+ ET          NERLQK++E LS
Sbjct: 4   KAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLS 63
Query: 222 EELNVLRSLFTNVGVLPEHL 241
            EL+ LR+LF     LPE L
Sbjct: 64  RELSTLRNLFKQ---LPEPL 80
>pdb|1IO4|A Chain A, Crystal Structure Of Runx-1AML1CBFALPHA RUNT DOMAIN- Cbfbeta Core Domain Heterodimer And CEBPBETA BZIP Homodimer Bound To A Dna Fragment From The Csf-1r Promoter Length = 78 Back     alignment and structure
>pdb|2E42|A Chain A, Crystal Structure Of CEBPBETA BZIP HOMODIMER V285A MUTANT Bound To A High Affinity Dna Fragment Length = 78 Back     alignment and structure
>pdb|2E43|A Chain A, Crystal Structure Of CEBPBETA BZIP HOMODIMER K269A MUTANT Bound To A High Affinity Dna Fragment Length = 78 Back     alignment and structure
>pdb|1CI6|B Chain B, Transcription Factor Atf4-CEBP BETA BZIP HETERODIMER Length = 63 Back     alignment and structure
>pdb|1H89|A Chain A, Crystal Structure Of Ternary Protein-Dna Complex2 Length = 64 Back     alignment and structure
>pdb|1NWQ|A Chain A, Crystal Structure Of CEBPALPHA-Dna Complex Length = 62 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query256
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 3e-20
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 1e-19
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 1e-10
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 2e-10
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 5e-10
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 5e-10
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 4e-09
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 3e-05
2wt7_B90 Transcription factor MAFB; transcription, transcri 7e-05
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 7e-05
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 2e-04
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure
 Score = 81.1 bits (200), Expect = 3e-20
 Identities = 47/74 (63%), Positives = 59/74 (79%)

Query: 161 RKNGKSVDKNTDEYKRRRERNNIAVRKSREKAKIRSRETEEKVKLLVKENERLQKRIELL 220
            K  K+VDK++DEYK RRERNNIAVRKSR+KAK+R+ ET+ KV  L  ENERLQK++E L
Sbjct: 3   SKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQL 62

Query: 221 SEELNVLRSLFTNV 234
           S EL+ LR+LF  +
Sbjct: 63  SRELSTLRNLFKQL 76
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 99.85
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 99.85
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.51
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.51
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 99.49
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.44
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.3
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 98.65
2wt7_B90 Transcription factor MAFB; transcription, transcri 97.88
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 97.75
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 97.73
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 97.23
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 96.77
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 95.58
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 95.14
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 94.98
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 93.91
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 93.89
3m48_A33 General control protein GCN4; leucine zipper, synt 93.32
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 93.31
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 92.52
3ra3_B28 P2F; coiled coil domain, fiber, KIH interactions, 91.79
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 91.58
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 91.43
3m48_A33 General control protein GCN4; leucine zipper, synt 91.32
2hy6_A34 General control protein GCN4; protein design, para 91.2
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 90.71
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 90.35
2bni_A34 General control protein GCN4; four helix bundle, a 90.2
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 90.17
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 90.15
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 89.87
3ra3_A28 P1C; coiled coil domain, fiber, KIH interactions, 89.59
1uo4_A34 General control protein GCN4; four helix bundle, c 89.44
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 89.43
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 89.02
1uo4_A34 General control protein GCN4; four helix bundle, c 88.97
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 88.79
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 87.7
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 87.56
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 87.52
1deb_A54 APC protein, adenomatous polyposis coli protein; c 87.13
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 87.04
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 86.86
2hy6_A34 General control protein GCN4; protein design, para 86.7
1a93_B34 MAX protein, coiled coil, LZ; leucine zipper, 2D s 86.58
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 86.18
2wvr_A209 Geminin; DNA replication license, DNA replication 86.08
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 85.66
2bni_A34 General control protein GCN4; four helix bundle, a 85.59
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 85.49
4dzn_A33 Coiled-coil peptide CC-PIL; de novo protein; HET: 85.25
1uii_A83 Geminin; human, DNA replication, cell cycle; 2.00A 84.95
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 84.94
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 84.64
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 83.82
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 83.42
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 83.35
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 83.22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 82.33
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 81.79
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 81.68
1uii_A83 Geminin; human, DNA replication, cell cycle; 2.00A 81.66
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 81.52
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 80.71
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 80.16
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 80.02
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.85  E-value=2.3e-21  Score=150.73  Aligned_cols=73  Identities=67%  Similarity=0.918  Sum_probs=64.7

Q ss_pred             CCCCCCHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCchh
Q psy16107        166 SVDKNTDEYKRRRERNNIAVRKSREKAKIRSRETEEKVKLLVKENERLQKRIELLSEELNVLRSLFTNVGVLPEHL  241 (256)
Q Consensus       166 ~~~k~dd~Yr~RReRNNiAaRKSReKrK~R~~el~~kv~~Le~EN~~Lk~~Ie~L~kEl~~LK~ll~q~~~lpe~~  241 (256)
                      ....+|++||+||+|||+||+|||+|+|+++.+++.++.+|+.||..|+++|++|++|+..||.+|++   +|+.+
T Consensus         8 ~~dk~d~~Y~~rR~rNN~AarrSR~krk~r~~e~~~r~~~Le~EN~~Lr~~v~~L~~E~~~Lr~ll~~---~p~~~   80 (87)
T 1hjb_A            8 TVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQ---LPEPL   80 (87)
T ss_dssp             --CTTSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--------
T ss_pred             CcCcccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---CcHHH
Confidence            34567999999999999999999999999999999999999999999999999999999999999999   88864
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3ra3_B P2F; coiled coil domain, fiber, KIH interactions, synthetic biolo helical reconstruction, de novo protein; HET: PHI; 2.31A {Synthetic} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3ra3_A P1C; coiled coil domain, fiber, KIH interactions, synthetic biolo helical reconstruction, de novo protein; HET: PHI; 2.31A {Synthetic} Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>1a93_B MAX protein, coiled coil, LZ; leucine zipper, 2D solution structure, H-bonds, buried salt bridge, proto-oncogene, nuclear protein; NMR {Mus musculus} SCOP: h.1.3.1 PDB: 2a93_B Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2wvr_A Geminin; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>4dzn_A Coiled-coil peptide CC-PIL; de novo protein; HET: PHI; 1.59A {Synthetic} PDB: 4dzm_A* 4dzl_A* 4dzk_A 1u0i_A 1u0i_B Back     alignment and structure
>1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query256
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 86.41
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=86.41  E-value=0.12  Score=37.42  Aligned_cols=22  Identities=36%  Similarity=0.552  Sum_probs=18.3

Q ss_pred             HHHHHHhhhHHHHHHHHHHHHH
Q psy16107        174 YKRRRERNNIAVRKSREKAKIR  195 (256)
Q Consensus       174 Yr~RReRNNiAaRKSReKrK~R  195 (256)
                      -.+||-||.+||+.||..|-.+
T Consensus        49 DIRRRGKNKvAAqnCRKRKld~   70 (74)
T d1sknp_          49 KIRRRGKNKVAARTCRQRRTDR   70 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhcccHHHHHHHHHhhhhh
Confidence            4578999999999999877544