Psyllid ID: psy16202

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MWFVLMLQLLSWMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKFYELYHKICPRNDIEELFQSITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALEIINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRLDFYMDMDQPLAHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGCRFV
cHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccccccccHHHHHHHHHHccccHHHHccccccHHHHHHHHccccccccccccccccccccccccHHHHHccccHHHccccccccccHHHHHHHHHcccccc
cHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHccccccHHHHHHHHHHccccHHHHHcccccHHHHHHHHcccccccccHHHccHHHcccccccEEEEEcccccEEEccccccccHHHHHHHHHHcccccc
MWFVLMLQLLSWMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAElglpsgkndviepadftFDKFYELYhkicprndIEELFQSITKGKAETINLDQFITFLnekqrdprlneilyplydEKRALEIINTYEQNeeirneksfskDGLIRYLmsdenapvfLDRLDfymdmdqplahyyinsshntylsgrqfggksSVEMYRQTLLAGCRFV
MWFVLMLQLLSWMRLGMLVEAKGKVPVKVVSRtfasgkteklVYQTMAELglpsgkndviEPADFTFDKFYELYHKICPRNDIEELFQSITKGKAETINLDQFItflnekqrdprLNEILYPLYDEKRALEIINTyeqneeirneksfSKDGLIRYLMSDENAPVFLDRLDFYMDMDQPLAHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGCRFV
MWFVLMLQLLSWMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKFYELYHKICPRNDIEELFQSITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALEIINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRLDFYMDMDQPLAHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGCRFV
*WFVLMLQLLSWMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKFYELYHKICPRNDIEELFQSITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALEIINTYEQNEEIR***SFSKDGLIRYLMSDENAPVFLDRLDFYMDMDQPLAHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGC***
MWFVLMLQLLSWMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQT****************ADFTFDKFYELYHKICPRNDIEELFQSITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALEIINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRLDFYMDMDQPLAHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGCRFV
MWFVLMLQLLSWMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKFYELYHKICPRNDIEELFQSITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALEIINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRLDFYMDMDQPLAHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGCRFV
MWFVLMLQLLSWMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKFYELYHKICPRNDIEELFQSITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALEIINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRLDFYMDMDQPLAHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGCRFV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWFVLMLQLLSWMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKFYELYHKICPRNDIEELFQSITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALEIINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRLDFYMDMDQPLAHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGCRFV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query218 2.2.26 [Sep-21-2011]
P13217 1095 1-phosphatidylinositol 4, yes N/A 0.949 0.189 0.729 1e-87
Q9QW07 1175 1-phosphatidylinositol 4, yes N/A 0.949 0.176 0.661 1e-83
Q15147 1175 1-phosphatidylinositol 4, yes N/A 0.949 0.176 0.642 4e-82
Q07722 1023 1-phosphatidylinositol 4, no N/A 0.885 0.188 0.673 1e-78
P25455 1318 1-phosphatidylinositol 4, no N/A 0.986 0.163 0.465 9e-50
Q9Z1B3 1216 1-phosphatidylinositol 4, no N/A 0.944 0.169 0.423 7e-45
P10687 1216 1-phosphatidylinositol 4, no N/A 0.944 0.169 0.423 8e-45
P10894 1216 1-phosphatidylinositol 4, no N/A 0.944 0.169 0.418 3e-44
Q9NQ66 1216 1-phosphatidylinositol 4, no N/A 0.944 0.169 0.418 3e-44
P51432 1234 1-phosphatidylinositol 4, no N/A 0.944 0.166 0.408 3e-40
>sp|P13217|PIPA_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Drosophila melanogaster GN=norpA PE=1 SV=4 Back     alignment and function desciption
 Score =  322 bits (826), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 151/207 (72%), Positives = 169/207 (81%)

Query: 12  WMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKFY 71
           WMRL   VE  GK+PVK +++TFASGKTEKLVY  + + GLP  KN  +    FTFDKFY
Sbjct: 157 WMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFY 216

Query: 72  ELYHKICPRNDIEELFQSITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALE 131
            LYHK+CPRNDIEELF SITKGK + I+L+QFI F+N+KQRDPR+NEILYPLY+EKR  E
Sbjct: 217 ALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTE 276

Query: 132 IINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRLDFYMDMDQPLAHYYINSSHNT 191
           IIN YE +EE +     S DG  RYLMSDENAPVFLDRLDFYM+MDQPLAHYYINSSHNT
Sbjct: 277 IINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNT 336

Query: 192 YLSGRQFGGKSSVEMYRQTLLAGCRFV 218
           YLSGRQ GGKSSVEMYRQTLLAGCR V
Sbjct: 337 YLSGRQIGGKSSVEMYRQTLLAGCRCV 363
The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. Essential component of the phototransduction pathway.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 4EC: .EC: 1EC: 1
>sp|Q9QW07|PLCB4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Rattus norvegicus GN=Plcb4 PE=2 SV=2 Back     alignment and function description
>sp|Q15147|PLCB4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens GN=PLCB4 PE=1 SV=3 Back     alignment and function description
>sp|Q07722|PLCB4_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (Fragment) OS=Bos taurus GN=PLCB4 PE=1 SV=1 Back     alignment and function description
>sp|P25455|PIP1_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase classes I and II OS=Drosophila melanogaster GN=Plc21C PE=2 SV=3 Back     alignment and function description
>sp|Q9Z1B3|PLCB1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Mus musculus GN=Plcb1 PE=1 SV=2 Back     alignment and function description
>sp|P10687|PLCB1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Rattus norvegicus GN=Plcb1 PE=1 SV=1 Back     alignment and function description
>sp|P10894|PLCB1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Bos taurus GN=PLCB1 PE=1 SV=1 Back     alignment and function description
>sp|Q9NQ66|PLCB1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Homo sapiens GN=PLCB1 PE=1 SV=1 Back     alignment and function description
>sp|P51432|PLCB3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Mus musculus GN=Plcb3 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
328724634 1097 PREDICTED: 1-phosphatidylinositol-4,5-bi 0.949 0.188 0.879 1e-107
347966830 1089 AGAP001936-PB [Anopheles gambiae str. PE 0.986 0.197 0.839 1e-105
347966828 1089 AGAP001936-PA [Anopheles gambiae str. PE 0.949 0.190 0.869 1e-105
157123053 1082 phospholipase c beta [Aedes aegypti] gi| 0.949 0.191 0.859 1e-104
157123055 1075 phospholipase c beta [Aedes aegypti] gi| 0.949 0.192 0.859 1e-104
332028521 1112 1-phosphatidylinositol-4,5-bisphosphate 0.949 0.186 0.864 1e-104
345492439 1100 PREDICTED: 1-phosphatidylinositol-4,5-bi 0.949 0.188 0.855 1e-104
307189725 1104 1-phosphatidylinositol-4,5-bisphosphate 0.949 0.187 0.864 1e-103
383848731 1103 PREDICTED: 1-phosphatidylinositol-4,5-bi 0.949 0.187 0.855 1e-102
380012389 1104 PREDICTED: 1-phosphatidylinositol-4,5-bi 0.949 0.187 0.850 1e-102
>gi|328724634|ref|XP_001948241.2| PREDICTED: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase-like isoform 1 [Acyrthosiphon pisum] gi|328724636|ref|XP_003248206.1| PREDICTED: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 182/207 (87%), Positives = 196/207 (94%)

Query: 12  WMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKFY 71
           WMRLGMLV+ KGKVPVKV++RTFASGKTEK+VYQ +A+L LPSGKND IEP+DFTFDKFY
Sbjct: 151 WMRLGMLVDPKGKVPVKVIARTFASGKTEKMVYQCLADLNLPSGKNDTIEPSDFTFDKFY 210

Query: 72  ELYHKICPRNDIEELFQSITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALE 131
           ELYHKICPRNDIEELFQSIT+GKAE I+LDQFITFLNEKQRDPRLNEILYPLYDEKRALE
Sbjct: 211 ELYHKICPRNDIEELFQSITQGKAENISLDQFITFLNEKQRDPRLNEILYPLYDEKRALE 270

Query: 132 IINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRLDFYMDMDQPLAHYYINSSHNT 191
           II  YE +EE++NEK  SK+GLIRYLMSDENAPVFLDRL+FYMDMDQPLAHYYINSSHNT
Sbjct: 271 IITDYEPSEEVKNEKQLSKEGLIRYLMSDENAPVFLDRLEFYMDMDQPLAHYYINSSHNT 330

Query: 192 YLSGRQFGGKSSVEMYRQTLLAGCRFV 218
           YLSGRQFGGKSSVEMYRQTLLAGCR V
Sbjct: 331 YLSGRQFGGKSSVEMYRQTLLAGCRCV 357

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|347966830|ref|XP_003435972.1| AGAP001936-PB [Anopheles gambiae str. PEST] gi|333469881|gb|EGK97441.1| AGAP001936-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|347966828|ref|XP_321126.5| AGAP001936-PA [Anopheles gambiae str. PEST] gi|333469880|gb|EAA00962.5| AGAP001936-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157123053|ref|XP_001653804.1| phospholipase c beta [Aedes aegypti] gi|108874530|gb|EAT38755.1| AAEL009380-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157123055|ref|XP_001653805.1| phospholipase c beta [Aedes aegypti] gi|157123057|ref|XP_001653806.1| phospholipase c beta [Aedes aegypti] gi|108874531|gb|EAT38756.1| AAEL009380-PB [Aedes aegypti] gi|108874532|gb|EAT38757.1| AAEL009380-PC [Aedes aegypti] Back     alignment and taxonomy information
>gi|332028521|gb|EGI68559.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345492439|ref|XP_001600088.2| PREDICTED: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307189725|gb|EFN74018.1| 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383848731|ref|XP_003700001.1| PREDICTED: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380012389|ref|XP_003690266.1| PREDICTED: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase-like isoform 1 [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query218
FB|FBgn0262738 1095 norpA "no receptor potential A 0.949 0.189 0.729 3.7e-80
RGD|3345 1175 Plcb4 "phospholipase C, beta 4 0.949 0.176 0.661 1.2e-74
UNIPROTKB|Q9QW07 1175 Plcb4 "1-phosphatidylinositol 0.949 0.176 0.661 1.2e-74
UNIPROTKB|E1BY87 1178 PLCB4 "Uncharacterized protein 0.949 0.175 0.657 1.2e-74
UNIPROTKB|D4A8C5 1194 Plcb4 "RCG26434, isoform CRA_a 0.949 0.173 0.661 1.4e-74
UNIPROTKB|F6XJT6 1194 PLCB4 "Uncharacterized protein 0.949 0.173 0.652 4.8e-74
UNIPROTKB|F1PLB3 1206 PLCB4 "Uncharacterized protein 0.949 0.171 0.652 5.1e-74
UNIPROTKB|F1MSD7 1194 PLCB4 "1-phosphatidylinositol 0.949 0.173 0.647 1e-73
UNIPROTKB|Q15147 1175 PLCB4 "1-phosphatidylinositol 0.949 0.176 0.642 3.2e-73
UNIPROTKB|E2QRH8 1187 PLCB4 "1-phosphatidylinositol 0.949 0.174 0.642 3.4e-73
FB|FBgn0262738 norpA "no receptor potential A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 805 (288.4 bits), Expect = 3.7e-80, P = 3.7e-80
 Identities = 151/207 (72%), Positives = 169/207 (81%)

Query:    12 WMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKFY 71
             WMRL   VE  GK+PVK +++TFASGKTEKLVY  + + GLP  KN  +    FTFDKFY
Sbjct:   157 WMRLSYCVEKSGKIPVKTLAKTFASGKTEKLVYTCIKDAGLPDDKNATMTKEQFTFDKFY 216

Query:    72 ELYHKICPRNDIEELFQSITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALE 131
              LYHK+CPRNDIEELF SITKGK + I+L+QFI F+N+KQRDPR+NEILYPLY+EKR  E
Sbjct:   217 ALYHKVCPRNDIEELFTSITKGKQDFISLEQFIQFMNDKQRDPRMNEILYPLYEEKRCTE 276

Query:   132 IINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRLDFYMDMDQPLAHYYINSSHNT 191
             IIN YE +EE +     S DG  RYLMSDENAPVFLDRLDFYM+MDQPLAHYYINSSHNT
Sbjct:   277 IINDYELDEEKKKNVQMSLDGFKRYLMSDENAPVFLDRLDFYMEMDQPLAHYYINSSHNT 336

Query:   192 YLSGRQFGGKSSVEMYRQTLLAGCRFV 218
             YLSGRQ GGKSSVEMYRQTLLAGCR V
Sbjct:   337 YLSGRQIGGKSSVEMYRQTLLAGCRCV 363
GO:0046488 "phosphatidylinositol metabolic process" evidence=IMP
GO:0016028 "rhabdomere" evidence=IDA
GO:0007608 "sensory perception of smell" evidence=IMP
GO:0008377 "light-induced release of internally sequestered calcium ion" evidence=TAS
GO:0004435 "phosphatidylinositol phospholipase C activity" evidence=IEA;NAS;TAS
GO:0051482 "elevation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway" evidence=TAS
GO:0016027 "inaD signaling complex" evidence=TAS;IPI
GO:0006651 "diacylglycerol biosynthetic process" evidence=TAS
GO:0019722 "calcium-mediated signaling" evidence=TAS
GO:0007602 "phototransduction" evidence=IMP;NAS;TAS
GO:0008654 "phospholipid biosynthetic process" evidence=TAS
GO:0004629 "phospholipase C activity" evidence=TAS
GO:0006644 "phospholipid metabolic process" evidence=TAS
GO:0005096 "GTPase activator activity" evidence=NAS
GO:0046673 "negative regulation of compound eye retinal cell programmed cell death" evidence=IMP
GO:0005509 "calcium ion binding" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0009649 "entrainment of circadian clock" evidence=IMP
GO:0008344 "adult locomotory behavior" evidence=IMP
GO:0045494 "photoreceptor cell maintenance" evidence=IMP
GO:0016059 "deactivation of rhodopsin mediated signaling" evidence=IDA
GO:0016056 "rhodopsin mediated signaling pathway" evidence=IMP
GO:0002385 "mucosal immune response" evidence=IMP
GO:0001580 "detection of chemical stimulus involved in sensory perception of bitter taste" evidence=IMP
GO:0043052 "thermotaxis" evidence=IMP
RGD|3345 Plcb4 "phospholipase C, beta 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9QW07 Plcb4 "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BY87 PLCB4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|D4A8C5 Plcb4 "RCG26434, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F6XJT6 PLCB4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PLB3 PLCB4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSD7 PLCB4 "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q15147 PLCB4 "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QRH8 PLCB4 "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q15147PLCB4_HUMAN3, ., 1, ., 4, ., 1, 10.64250.94950.1761yesN/A
Q9QW07PLCB4_RAT3, ., 1, ., 4, ., 1, 10.66180.94950.1761yesN/A
P13217PIPA_DROME3, ., 1, ., 4, ., 1, 10.72940.94950.1890yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.4.11LOW CONFIDENCE prediction!
3rd Layer3.1.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
cd08591 257 cd08591, PI-PLCc_beta, Catalytic domain of metazoa 5e-29
cd08626 257 cd08626, PI-PLCc_beta4, Catalytic domain of metazo 8e-29
cd08558 226 cd08558, PI-PLCc_eukaryota, Catalytic domain of eu 8e-28
pfam00388 145 pfam00388, PI-PLC-X, Phosphatidylinositol-specific 4e-23
pfam0927983 pfam09279, efhand_like, Phosphoinositide-specific 6e-23
smart00148143 smart00148, PLCXc, Phospholipase C, catalytic doma 1e-19
cd08593 257 cd08593, PI-PLCc_delta, Catalytic domain of metazo 1e-19
cd08598 231 cd08598, PI-PLC1c_yeast, Catalytic domain of putat 8e-19
cd08596 254 cd08596, PI-PLCc_epsilon, Catalytic domain of meta 2e-18
cd08624 261 cd08624, PI-PLCc_beta2, Catalytic domain of metazo 6e-17
cd08625 258 cd08625, PI-PLCc_beta3, Catalytic domain of metazo 1e-15
cd08594 227 cd08594, PI-PLCc_eta, Catalytic domain of metazoan 1e-15
cd08623 258 cd08623, PI-PLCc_beta1, Catalytic domain of metazo 2e-15
cd08597 260 cd08597, PI-PLCc_PRIP_metazoa, Catalytic domain of 7e-15
cd08592 229 cd08592, PI-PLCc_gamma, Catalytic domain of metazo 8e-15
cd08630 258 cd08630, PI-PLCc_delta3, Catalytic domain of metaz 1e-13
cd08632 253 cd08632, PI-PLCc_eta1, Catalytic domain of metazoa 1e-12
cd08631 258 cd08631, PI-PLCc_delta4, Catalytic domain of metaz 2e-12
cd08599 228 cd08599, PI-PLCc_plant, Catalytic domain of plant 3e-12
cd08629 258 cd08629, PI-PLCc_delta1, Catalytic domain of metaz 3e-12
PLN02228 567 PLN02228, PLN02228, Phosphoinositide phospholipase 3e-12
cd08633 254 cd08633, PI-PLCc_eta2, Catalytic domain of metazoa 3e-12
cd08627 229 cd08627, PI-PLCc_gamma1, Catalytic domain of metaz 2e-11
cd08628 254 cd08628, PI-PLCc_gamma2, Catalytic domain of metaz 6e-11
cd08595 257 cd08595, PI-PLCc_zeta, Catalytic domain of metazoa 7e-11
cd00137 274 cd00137, PI-PLCc, Catalytic domain of prokaryotic 1e-10
PLN02222 581 PLN02222, PLN02222, phosphoinositide phospholipase 4e-09
PLN02952 599 PLN02952, PLN02952, phosphoinositide phospholipase 9e-07
PLN02230 598 PLN02230, PLN02230, phosphoinositide phospholipase 4e-05
PLN02223 537 PLN02223, PLN02223, phosphoinositide phospholipase 1e-04
>gnl|CDD|176533 cd08591, PI-PLCc_beta, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta Back     alignment and domain information 
 Score =  108 bits (272), Expect = 5e-29
 Identities = 38/46 (82%), Positives = 43/46 (93%)

Query: 173 YMDMDQPLAHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGCRFV 218
           Y DMDQPL+HY+INSSHNTYL+GRQFGGKSSVEMYRQ LL+GCR +
Sbjct: 1   YQDMDQPLSHYFINSSHNTYLTGRQFGGKSSVEMYRQVLLSGCRCI 46

This subfamily corresponds to the catalytic domain present in metazoan phosphoinositide-specific phospholipase C (PI-PLC, EC 3.1.4.11)-beta isozymes. PI-PLC is a signaling enzyme that hydrolyzes the membrane phospholipids phosphatidylinositol-4,5-bisphosphate (PIP2) to generate two important second messengers in eukaryotic signal transduction cascades, Inositol 1,4,5-trisphosphate (InsP3) and diacylglycerol (DAG). InsP3 triggers inflow of calcium from intracellular stores, while DAG, together with calcium, activates protein kinase C, which goes on to phosphorylate other molecules, leading to altered cellular activity. Calcium is required for the catalysis. PLC-beta represents a class of mammalian PI-PLC that has an N-terminal pleckstrin homology (PH) domain, an array of EF hands, a PLC catalytic core domain, a C2 domain, and a unique C-terminal coiled-coil (CT) domain necessary for homodimerization. The PLC catalytic core domain is a TIM barrel with two highly conserved regions (X and Y) split by a highly degenerate linker sequence. There are four PLC-beta isozymes (1-4). They are activated by the heterotrimeric G protein alpha q subunits through their C2 domain and long C-terminal extension. The beta-gamma subunits of heterotrimeric G proteins are known to activate the PLC-beta2 and -beta3 isozymes only. Aside from four PLC-beta isozymes identified in mammals, some eukaryotic PLC-beta homologs have been classified into this subfamily, such as NorpA and PLC-21 from Drosophila and PLC-beta from turkey, Xenopus, sponge, and hydra. Length = 257
>gnl|CDD|176563 cd08626, PI-PLCc_beta4, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta4 Back     alignment and domain information
>gnl|CDD|176501 cd08558, PI-PLCc_eukaryota, Catalytic domain of eukaryotic phosphoinositide-specific phospholipase C and similar proteins Back     alignment and domain information
>gnl|CDD|215892 pfam00388, PI-PLC-X, Phosphatidylinositol-specific phospholipase C, X domain Back     alignment and domain information
>gnl|CDD|150071 pfam09279, efhand_like, Phosphoinositide-specific phospholipase C, efhand-like Back     alignment and domain information
>gnl|CDD|197543 smart00148, PLCXc, Phospholipase C, catalytic domain (part); domain X Back     alignment and domain information
>gnl|CDD|176535 cd08593, PI-PLCc_delta, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta Back     alignment and domain information
>gnl|CDD|176540 cd08598, PI-PLC1c_yeast, Catalytic domain of putative yeast phosphatidylinositide-specific phospholipases C Back     alignment and domain information
>gnl|CDD|176538 cd08596, PI-PLCc_epsilon, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-epsilon Back     alignment and domain information
>gnl|CDD|176561 cd08624, PI-PLCc_beta2, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta2 Back     alignment and domain information
>gnl|CDD|176562 cd08625, PI-PLCc_beta3, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta3 Back     alignment and domain information
>gnl|CDD|176536 cd08594, PI-PLCc_eta, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta Back     alignment and domain information
>gnl|CDD|176560 cd08623, PI-PLCc_beta1, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta1 Back     alignment and domain information
>gnl|CDD|176539 cd08597, PI-PLCc_PRIP_metazoa, Catalytic domain of metazoan phospholipase C related, but catalytically inactive protein Back     alignment and domain information
>gnl|CDD|176534 cd08592, PI-PLCc_gamma, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma Back     alignment and domain information
>gnl|CDD|176567 cd08630, PI-PLCc_delta3, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta3 Back     alignment and domain information
>gnl|CDD|176569 cd08632, PI-PLCc_eta1, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta1 Back     alignment and domain information
>gnl|CDD|176568 cd08631, PI-PLCc_delta4, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta4 Back     alignment and domain information
>gnl|CDD|176541 cd08599, PI-PLCc_plant, Catalytic domain of plant phosphatidylinositide-specific phospholipases C Back     alignment and domain information
>gnl|CDD|176566 cd08629, PI-PLCc_delta1, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta1 Back     alignment and domain information
>gnl|CDD|177873 PLN02228, PLN02228, Phosphoinositide phospholipase C Back     alignment and domain information
>gnl|CDD|176570 cd08633, PI-PLCc_eta2, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta2 Back     alignment and domain information
>gnl|CDD|176564 cd08627, PI-PLCc_gamma1, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma1 Back     alignment and domain information
>gnl|CDD|176565 cd08628, PI-PLCc_gamma2, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma2 Back     alignment and domain information
>gnl|CDD|176537 cd08595, PI-PLCc_zeta, Catalytic domain of metazoan phosphoinositide-specific phospholipase C-zeta Back     alignment and domain information
>gnl|CDD|176497 cd00137, PI-PLCc, Catalytic domain of prokaryotic and eukaryotic phosphoinositide-specific phospholipase C Back     alignment and domain information
>gnl|CDD|177868 PLN02222, PLN02222, phosphoinositide phospholipase C 2 Back     alignment and domain information
>gnl|CDD|178538 PLN02952, PLN02952, phosphoinositide phospholipase C Back     alignment and domain information
>gnl|CDD|177875 PLN02230, PLN02230, phosphoinositide phospholipase C 4 Back     alignment and domain information
>gnl|CDD|165867 PLN02223, PLN02223, phosphoinositide phospholipase C Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 218
KOG1265|consensus 1189 100.0
KOG0169|consensus 746 100.0
PLN02952 599 phosphoinositide phospholipase C 100.0
PLN02228 567 Phosphoinositide phospholipase C 100.0
KOG1264|consensus 1267 100.0
PLN02222 581 phosphoinositide phospholipase C 2 100.0
PLN02230 598 phosphoinositide phospholipase C 4 100.0
PLN02223 537 phosphoinositide phospholipase C 100.0
KOG0027|consensus151 99.75
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.74
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 99.72
smart00148135 PLCXc Phospholipase C, catalytic domain (part); do 99.63
PTZ00183158 centrin; Provisional 99.56
KOG0028|consensus172 99.55
PTZ00184149 calmodulin; Provisional 99.55
KOG0031|consensus171 99.47
KOG0030|consensus152 99.44
KOG0037|consensus221 99.41
KOG0036|consensus 463 99.23
KOG0034|consensus187 99.05
KOG0044|consensus193 98.88
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.74
PLN02964 644 phosphatidylserine decarboxylase 98.7
PTZ00183158 centrin; Provisional 98.67
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.66
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.63
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.62
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.6
PTZ00184149 calmodulin; Provisional 98.54
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.48
KOG4223|consensus325 98.43
KOG0044|consensus193 98.42
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.41
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.41
KOG0027|consensus151 98.38
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.37
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.37
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.37
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.36
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.34
KOG0037|consensus221 98.33
KOG0038|consensus189 98.33
cd0005267 EH Eps15 homology domain; found in proteins implic 98.32
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.32
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.31
cd0005267 EH Eps15 homology domain; found in proteins implic 98.3
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.27
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.26
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.25
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.24
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.23
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.23
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.22
KOG4223|consensus325 98.2
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.19
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.14
KOG0028|consensus172 98.08
PLN02964 644 phosphatidylserine decarboxylase 98.08
PF1465866 EF-hand_9: EF-hand domain 98.06
KOG2643|consensus489 98.03
cd0021388 S-100 S-100: S-100 domain, which represents the la 97.99
KOG2562|consensus493 97.91
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.9
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.85
PF1465866 EF-hand_9: EF-hand domain 97.82
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.81
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.79
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.76
KOG0034|consensus187 97.69
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.68
KOG4251|consensus362 97.67
KOG0041|consensus244 97.52
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.49
KOG2643|consensus489 97.4
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.4
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.38
KOG0377|consensus631 97.36
KOG0036|consensus 463 97.35
KOG0041|consensus244 97.29
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.29
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.23
KOG0040|consensus2399 96.98
KOG0031|consensus171 96.66
KOG0751|consensus 694 96.43
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.41
KOG2562|consensus493 96.39
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.29
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 96.24
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 96.23
KOG0030|consensus152 96.09
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.08
PRK12309391 transaldolase/EF-hand domain-containing protein; P 96.03
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 95.79
KOG0377|consensus631 95.78
KOG0040|consensus2399 95.67
KOG4666|consensus412 95.57
KOG4251|consensus362 95.5
KOG0046|consensus 627 95.09
KOG0751|consensus 694 95.09
KOG4666|consensus412 95.04
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 95.01
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 94.6
PF0906990 EF-hand_3: EF-hand; InterPro: IPR015154 Like other 94.28
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 94.22
KOG0046|consensus 627 93.37
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 92.95
KOG4065|consensus144 92.58
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 92.27
KOG0038|consensus189 92.22
KOG1707|consensus 625 91.64
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 91.11
PLN02952 599 phosphoinositide phospholipase C 88.06
KOG4065|consensus144 87.58
KOG0169|consensus 746 86.58
PF0102344 S_100: S-100/ICaBP type calcium binding domain; In 86.11
KOG3555|consensus434 85.71
PF0872669 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr 85.7
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 85.21
>KOG1265|consensus Back     alignment and domain information 
Probab=100.00  E-value=2e-57  Score=415.25  Aligned_cols=204  Identities=56%  Similarity=0.951  Sum_probs=197.4

Q ss_pred             hhhhcCCCCcccHHHHHHHhcCCCcHHHHHHHHHHhCCCCCCCCCCCCCCCCHHHHHHHHHHcCCchHHHHHHHHHcCCC
Q psy16202         15 LGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKFYELYHKICPRNDIEELFQSITKGK   94 (218)
Q Consensus        15 ~~fd~d~~G~I~~~el~~~l~~~~~~~~i~~~~~~~~~~~~k~d~~~~g~l~f~eF~~~~~~l~~r~ei~~iF~~~d~~~   94 (218)
                      .+...|..|+|+++.|.++|.++..++.|+..+..+|+|++|+|......++|+.|..+++.+|.|++|++||.++.+++
T Consensus       155 lkmqvn~~grip~knI~k~F~~~k~~KrVe~al~~~gLp~~k~dsI~~d~f~~e~f~~~l~klcpR~eie~iF~ki~~~~  234 (1189)
T KOG1265|consen  155 LKMQVNFEGRIPVKNIIKTFSADKKEKRVEKALEACGLPSGKNDSIEPDDFTLEKFYRLLNKLCPRPEIEEIFRKISGKK  234 (1189)
T ss_pred             hhhcccccccccHHHHHHHhhcCCchhHHHHHHHhcCCCCCCcCccChhhccHHHHHHHHHhcCCchhHHHHHHHhccCC
Confidence            34568899999999999999999888999999999999999999999999999999999999999999999999999988


Q ss_pred             CCcccHHHHHHHHHHhcCCccccccccccCCHHHHHHHHHHhcchhhhhccCCcCHHHHHHHHcCCCCCCcccccccccc
Q psy16202         95 AETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALEIINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRLDFYM  174 (218)
Q Consensus        95 ~g~it~~ef~~FL~~~Q~e~~~~~~~~~~~t~~~~~~li~~~~~~~~~~~~g~ls~~~F~~~L~s~~n~~~~~~~~~~~~  174 (218)
                      ..++|.++|.+||++.|++|++||+|||++++.++..||++|+|+.....+|+|+.+||++||++++|.|+.+++...++
T Consensus       235 kpylT~~ql~dfln~~QrDpRLNeilfp~~~~~r~~~liekyEp~~~~a~~gqms~dgf~ryl~gdEn~i~a~~~l~l~~  314 (1189)
T KOG1265|consen  235 KPYLTKEQLVDFLNKKQRDPRLNEILFPPADPRRIQSLIEKYEPNSDNAEKGQMSTDGFVRYLMGDENAIVALDKLDLVT  314 (1189)
T ss_pred             CccccHHHHHHHHhhhccCcchhhhhcCCCCHHHHHHHHHHcCCchhhhhccccchhhhHHHhhCCccccccHHHHHhhh
Confidence            78999999999999999999999999999999999999999999988888999999999999999999999999999999


Q ss_pred             ccCCccccccccCCCcccccCCCCCCCCcHHHHHHHHHcCCccC
Q psy16202        175 DMDQPLAHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGCRFV  218 (218)
Q Consensus       175 dm~~Pls~YfI~SSHNTYL~g~Ql~~~ss~e~y~~aL~~GcRcv  218 (218)
                      ||+||||||||||||||||||+||+|.||||||++||++|||||
T Consensus       315 dM~qPl~hYFINSSHNTYlTg~Ql~g~sSvEmYRQvLLsGcRCV  358 (1189)
T KOG1265|consen  315 DMDQPLSHYFINSSHNTYLTGGQLGGKSSVEMYRQVLLSGCRCV  358 (1189)
T ss_pred             hhccchhhhhccccccceeecccccCcchHHHHHHHHHhcCceE
Confidence            99999999999999999999999999999999999999999998

>KOG0169|consensus Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>smart00148 PLCXc Phospholipase C, catalytic domain (part); domain X Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>KOG1707|consensus Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>PF01023 S_100: S-100/ICaBP type calcium binding domain; InterPro: IPR013787 The calcium-binding domain found in S100 and CaBP-9k proteins is a subfamily of the EF-hand calcium-binding domain [] Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes Back     alignment and domain information
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
3ohm_B 885 Crystal Structure Of Activated G Alpha Q Bound To I 5e-41
4gnk_B 1235 Crystal Structure Of Galphaq In Complex With Full-l 5e-41
3qr0_A 816 Crystal Structure Of S. Officinalis Plc21 Length = 6e-41
3qr1_A 813 Crystal Structure Of L. Pealei Plc21 Length = 813 8e-41
2fju_B 799 Activated Rac1 Bound To Its Effector Phospholipase 9e-39
1qas_A 622 1-Phosphatidylinositol-4,5-Bisphosphate Phosphodies 2e-21
1djg_A 624 Phosphoinositide-Specific Phospholipase C-Delta1 Fr 2e-21
>pdb|3OHM|B Chain B, Crystal Structure Of Activated G Alpha Q Bound To Its Effector Phospholipase C Beta 3 Length = 885 Back     alignment and structure 
Iteration: 1

 Score =  164 bits (414), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 123/208 (59%), Gaps = 2/208 (0%)
Query: 11  SWMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKF 70
           ++ +L + V   G++PVK + + F++ K  K V   +   GL   +++ I P +F+ + F
Sbjct: 155 AYTKLKLQVNQDGRIPVKNILKMFSADK--KRVETALESCGLKFNRSESIRPDEFSLEIF 212
Query: 71  YELYHKICPRNDIEELFQSITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRAL 130
               +K+C R DI+++   I       + L+Q + F+N+KQRDPRLNE+LYP     +A 
Sbjct: 213 ERFLNKLCLRPDIDKILLEIGAKGKPYLTLEQLMDFINQKQRDPRLNEVLYPPLRPSQAR 272
Query: 131 EIINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRLDFYMDMDQPLAHYYINSSHN 190
            +I  YE N++       S +G  RYL  +EN  + L+ LD   DM QPL+ Y+INSSHN
Sbjct: 273 LLIEKYEPNQQFLERDQMSMEGFSRYLGGEENGILPLEALDLSTDMTQPLSAYFINSSHN 332
Query: 191 TYLSGRQFGGKSSVEMYRQTLLAGCRFV 218
           TYL+  Q  G SSVEMYRQ LL GCR V
Sbjct: 333 TYLTAGQLAGTSSVEMYRQALLWGCRCV 360
>pdb|4GNK|B Chain B, Crystal Structure Of Galphaq In Complex With Full-length Human Plcbeta3 Length = 1235 Back     alignment and structure
>pdb|3QR0|A Chain A, Crystal Structure Of S. Officinalis Plc21 Length = 816 Back     alignment and structure
>pdb|3QR1|A Chain A, Crystal Structure Of L. Pealei Plc21 Length = 813 Back     alignment and structure
>pdb|2FJU|B Chain B, Activated Rac1 Bound To Its Effector Phospholipase C Beta 2 Length = 799 Back     alignment and structure
>pdb|1QAS|A Chain A, 1-Phosphatidylinositol-4,5-Bisphosphate Phosphodiesterase Delta 1 Length = 622 Back     alignment and structure
>pdb|1DJG|A Chain A, Phosphoinositide-Specific Phospholipase C-Delta1 From Rat Complexed With Lanthanum Length = 624 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query218
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 3e-57
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 5e-55
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 2e-54
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 6e-47
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Length = 799 Back     alignment and structure
 Score =  192 bits (488), Expect = 3e-57
 Identities = 80/207 (38%), Positives = 117/207 (56%), Gaps = 2/207 (0%)

Query: 12  WMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKFY 71
            ++L M + ++GK+PVK   + F + +  K V   ++   LP GKND I P DF    + 
Sbjct: 152 LVKLKMQLNSEGKIPVKNFFQMFPADR--KRVEAALSACHLPKGKNDAINPEDFPEPVYK 209

Query: 72  ELYHKICPRNDIEELFQSITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALE 131
                +CPR +I+E+F S        +  +    F+N+KQRD RLN +L+P     +   
Sbjct: 210 SFLMSLCPRPEIDEIFTSYHAKAKPYMTKEHLTKFINQKQRDSRLNSLLFPPARPDQVQG 269

Query: 132 IINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRLDFYMDMDQPLAHYYINSSHNT 191
           +I+ YE +         S +G++ +L   EN+ +  D+L  + DM QPL HY+INSSHNT
Sbjct: 270 LIDKYEPSGINAQRGQLSPEGMVWFLCGPENSVLAQDKLLLHHDMTQPLNHYFINSSHNT 329

Query: 192 YLSGRQFGGKSSVEMYRQTLLAGCRFV 218
           YL+  QF G SS EMYRQ LL+GCR V
Sbjct: 330 YLTAGQFSGLSSAEMYRQVLLSGCRCV 356
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Length = 885 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Length = 816 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 100.0
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 100.0
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 100.0
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 100.0
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.78
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.77
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.77
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.76
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.74
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.74
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.74
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.74
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.74
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.74
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.73
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.73
3fwb_A161 Cell division control protein 31; gene gating, com 99.73
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.73
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.72
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.72
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.71
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.71
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.71
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.7
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.7
1y1x_A191 Leishmania major homolog of programmed cell death 99.7
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.69
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.69
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.69
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.69
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.69
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.69
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.68
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.68
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.68
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.68
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.67
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.67
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.67
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.66
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.66
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.66
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.66
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.66
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.66
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.66
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.65
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.65
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.65
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.64
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.64
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.64
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.64
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.64
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.64
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.64
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.64
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.64
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.64
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.63
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.63
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.63
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.62
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.61
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.6
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.6
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.6
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.6
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.59
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.59
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.59
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.59
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.58
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.58
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.57
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.56
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.55
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.54
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.54
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.54
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.53
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.53
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.53
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.51
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.51
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.5
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.48
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.47
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.46
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.45
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.45
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.45
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.44
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.44
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.44
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.42
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.42
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.4
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.39
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.35
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.33
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.31
1y1x_A191 Leishmania major homolog of programmed cell death 99.31
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.3
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.26
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.25
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.25
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.23
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.19
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.13
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.13
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.12
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.12
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.11
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.1
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.08
3a4u_B143 Multiple coagulation factor deficiency protein 2; 99.07
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.07
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.07
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.06
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.06
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.05
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.04
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.03
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.02
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.0
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.0
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.99
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.98
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.98
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.98
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.97
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.96
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.95
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.95
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.94
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.93
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.93
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.93
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.91
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 98.9
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.9
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.89
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.89
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.88
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.88
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.88
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.88
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.86
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.86
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 98.85
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.85
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.84
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.84
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.83
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.83
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.83
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.83
1exr_A148 Calmodulin; high resolution, disorder, metal trans 98.82
3fwb_A161 Cell division control protein 31; gene gating, com 98.81
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.81
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.81
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.81
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.81
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.8
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.8
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.79
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.78
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.78
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.77
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.77
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.76
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.76
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.76
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.75
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.75
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.74
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.74
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.74
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.74
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.73
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.73
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.72
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.71
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.71
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.71
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.71
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.71
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.71
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.7
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.7
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.68
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.68
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.68
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.68
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.67
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.67
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.67
3li6_A66 Calcium-binding protein; calcium signaling protein 98.67
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.67
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.67
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.67
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.66
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.66
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.66
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.66
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.65
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.65
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.65
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.64
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.63
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.63
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.62
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.62
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.62
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.61
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.6
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.6
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.59
1c07_A95 Protein (epidermal growth factor receptor pathway 98.59
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.59
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.58
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.58
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.58
1c07_A95 Protein (epidermal growth factor receptor pathway 98.58
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.58
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.58
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.57
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.57
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.57
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.56
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.56
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 98.56
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.55
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.55
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.55
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.54
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.54
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.54
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.54
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.54
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.54
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.53
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.53
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.52
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.52
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.52
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.5
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.5
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.5
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.49
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.49
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.48
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.48
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.47
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.47
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.47
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.45
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.45
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.44
3li6_A66 Calcium-binding protein; calcium signaling protein 98.44
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.44
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.43
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.43
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.43
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.43
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.43
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.42
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.42
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.41
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.4
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.4
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.4
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.39
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.39
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.38
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.38
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.37
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.37
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.36
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.36
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.35
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.35
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.35
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.34
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.34
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.33
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.33
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.32
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.32
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.32
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.31
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.31
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.31
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.28
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.26
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.23
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.21
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.18
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.18
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.18
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.1
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.08
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 97.93
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.87
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 97.86
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 97.66
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.64
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.61
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 97.4
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.34
1nub_A229 Basement membrane protein BM-40; extracellular mod 96.97
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 96.51
3h4x_A 339 Phosphatidylinositol-specific phospholipase C1; PI 96.03
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 95.98
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 95.81
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 94.26
1nub_A229 Basement membrane protein BM-40; extracellular mod 93.28
2jrf_A184 Tubulin polymerization-promoting protein family me 92.0
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 91.74
3kev_A199 Galieria sulfuraria DCUN1 domain-containing prote; 87.86
2l5y_A150 Stromal interaction molecule 2; EF-hand, SAM domai 86.91
4gba_A221 DCN1-like protein 3; E3 ligase, ligase-peptide com 85.19
3tdu_A200 DCN1-like protein 1; E2:E3, ligase-protein binding 81.59
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
Probab=100.00  E-value=9.8e-61  Score=452.43  Aligned_cols=208  Identities=40%  Similarity=0.750  Sum_probs=198.2

Q ss_pred             HHHHHhhhhcCCCCcccHHHHHHHhcCCCcH-HHHHHHHHHhCCCCCCCCCCCCCCCCHHHHHHHHHHcCCchHHHHHHH
Q psy16202         10 LSWMRLGMLVEAKGKVPVKVVSRTFASGKTE-KLVYQTMAELGLPSGKNDVIEPADFTFDKFYELYHKICPRNDIEELFQ   88 (218)
Q Consensus        10 ~~wl~~~fd~d~~G~I~~~el~~~l~~~~~~-~~i~~~~~~~~~~~~k~d~~~~g~l~f~eF~~~~~~l~~r~ei~~iF~   88 (218)
                      .+|++.+||+|+||+|+++||+++|+...++ +++.+++++++++++|+|.+++|.|+|+||..||+.++.|+||+++|+
T Consensus       157 ~~~~~~~fd~n~dG~Is~kEl~~~l~~~~~~~~el~~~~~~~~~~~~k~D~~~~g~L~FeEF~~f~~~L~~R~EI~eiF~  236 (816)
T 3qr0_A          157 KLYFRLTTVEMEKNKIPVKAIQKCLSKDKDDRARISKALEKIGWPSGKNDAIDLKAFDFDTFFKFYLALLERSEIEGIFK  236 (816)
T ss_dssp             HHHHHHHHTSCCSSEEEHHHHHHHHCSCHHHHHHHHHHHHHHTSCCSTTCEEETTTCCHHHHHHHHHHHCCCTHHHHHHH
T ss_pred             HHHHHHhccCCCCCCCCHHHHHHHHHhcCChHHHHHHHHHHhcccccccccCCCCcCCHHHHHHHHHhcCCHHHHHHHHH
Confidence            5799999999999999999999999976544 569999999999999999999999999999999999999999999999


Q ss_pred             HHcCCCCCcccHHHHHHHHHHhcCCccccccccccCCHHHHHHHHHHhcc--hhhhhccCCcCHHHHHHHHcCCCCCCcc
Q psy16202         89 SITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALEIINTYEQ--NEEIRNEKSFSKDGLIRYLMSDENAPVF  166 (218)
Q Consensus        89 ~~d~~~~g~it~~ef~~FL~~~Q~e~~~~~~~~~~~t~~~~~~li~~~~~--~~~~~~~g~ls~~~F~~~L~s~~n~~~~  166 (218)
                      .|+.+++|.||. +|++||+++|+++.+||++||.++.++|.+||++|++  +...+++|.|+++||.+||+|++|++++
T Consensus       237 ~y~~dg~~~mT~-eL~~FL~~~Q~E~~~~~~~~~~~t~e~~~~iI~kye~~~~~~~~~~g~LsldgF~~yL~S~~~~~~~  315 (816)
T 3qr0_A          237 ELSKNKGNITTV-MFRDFLNDMQRHPSLHKTLFPLYTDAQCEALINDYESAVNKKGKKKGQLTKEGLLYFLMCEENNLTP  315 (816)
T ss_dssp             HHTTTSSSEEHH-HHHHHHHHTSSCTTSCTTTSCCCCHHHHHHHHHHHHHHHHGGGCBTTEECHHHHHHHHHSGGGCSSC
T ss_pred             HHccCCCCcccH-HHHHHHHHhCCccccccccccccCHHHHHHHHHHhccccchhhhccCCccHHHHHHHhhcccccccc
Confidence            999988889999 9999999999999999999999999999999999998  7666678999999999999999999999


Q ss_pred             ccccccccccCCccccccccCCCcccccCCCCCCCCcHHHHHHHHHcCCccC
Q psy16202        167 LDRLDFYMDMDQPLAHYYINSSHNTYLSGRQFGGKSSVEMYRQTLLAGCRFV  218 (218)
Q Consensus       167 ~~~~~~~~dm~~Pls~YfI~SSHNTYL~g~Ql~~~ss~e~y~~aL~~GcRcv  218 (218)
                      |.+..|+|||++|||||||||||||||+|+||.|+||+|+|++||++|||||
T Consensus       316 ~~~~~v~~dm~~Pl~~YfI~sshntyL~g~ql~g~ss~~~y~~aL~~gcRcv  367 (816)
T 3qr0_A          316 MHRLDLGANMKLTLAAYYINSSHNTYLTGHQLTGKSSVEIYRQVLLTGCRCL  367 (816)
T ss_dssp             HHHHSSCSCCCSCGGGEEECBBSSTTBSSCTTTSCBCSHHHHHHHHTTCCEE
T ss_pred             hhhcccccccCCchhhheecccccchhccccccCcccHHHHHHHHHhCCcEE
Confidence            9999999999999999999999999999999999999999999999999997
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3h4x_A Phosphatidylinositol-specific phospholipase C1; PI-PLC, Ca2+-dependent, catalytic TIM barrel, disulfide-LINK loop, hydrolase; 1.23A {Streptomyces antibioticus} PDB: 3h4w_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} Back     alignment and structure
>2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} Back     alignment and structure
>3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 218
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 6e-41
d1qasa194 a.39.1.7 (A:205-298) Phosphoinositide-specific pho 1e-25
d2zkmx4 349 c.1.18.1 (X:312-660) Phospholipase C-beta-2 {Human 1e-21
d1qasa3 327 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (P 4e-20
d2ptda_ 296 c.1.18.2 (A:) Phosphatidylinositol-specific phosph 2e-04
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: EF-hand modules in multidomain proteins
domain: Phospholipase C-beta-2
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  135 bits (341), Expect = 6e-41
 Identities = 48/162 (29%), Positives = 82/162 (50%), Gaps = 2/162 (1%)

Query: 12  WMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKFY 71
            ++L M + ++GK+PVK   + F + +  K V   ++   LP GKND I P DF    + 
Sbjct: 11  LVKLKMQLNSEGKIPVKNFFQMFPADR--KRVEAALSACHLPKGKNDAINPEDFPEPVYK 68

Query: 72  ELYHKICPRNDIEELFQSITKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALE 131
                +CPR +I+E+F S        +  +    F+N+KQRD RLN +L+P     +   
Sbjct: 69  SFLMSLCPRPEIDEIFTSYHAKAKPYMTKEHLTKFINQKQRDSRLNSLLFPPARPDQVQG 128

Query: 132 IINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRLDFY 173
           +I+ YE +         S +G++ +L   EN+ +  D+L  +
Sbjct: 129 LIDKYEPSGINAQRGQLSPEGMVWFLCGPENSVLAQDKLLLH 170
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 94 Back     information, alignment and structure
>d2zkmx4 c.1.18.1 (X:312-660) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 349 Back     information, alignment and structure
>d1qasa3 c.1.18.1 (A:299-625) Phospholipase C isozyme D1 (PLC-D1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 327 Back     information, alignment and structure
>d2ptda_ c.1.18.2 (A:) Phosphatidylinositol-specific phospholipase C {Bacillus cereus [TaxId: 1396]} Length = 296 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query218
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.97
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 99.87
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.73
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.71
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.69
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.69
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.67
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.67
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.67
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.66
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.66
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.65
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.65
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.65
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.62
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.6
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.57
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.56
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.56
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.52
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.51
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.5
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.46
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.45
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.45
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.45
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.44
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.43
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.42
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.41
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.41
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.4
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.38
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.36
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.36
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.36
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.35
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.35
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.34
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.34
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.33
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.19
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.1
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.09
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.08
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.06
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.05
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.02
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.0
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.99
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.98
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.97
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.97
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.96
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.95
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.95
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.94
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.93
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.93
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 98.91
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.91
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.91
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.9
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.87
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.85
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.85
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.84
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.83
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.82
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.81
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.8
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.79
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.78
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 98.77
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.76
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.73
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.71
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.71
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.71
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.7
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 98.67
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.67
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.67
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.66
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.66
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.66
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.65
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.63
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.62
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.59
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.59
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.59
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.57
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.55
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.55
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.55
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.54
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.52
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.52
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.48
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.47
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.45
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.44
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.43
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.43
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.43
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.42
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.41
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.38
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.38
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.37
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.37
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.35
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.34
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.33
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.33
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.31
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.28
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.26
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.25
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.25
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.24
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.22
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.22
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.2
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.18
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.18
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.17
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.16
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.14
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.08
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.07
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.07
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.04
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.04
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.03
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.99
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 97.99
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 97.87
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.79
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 97.75
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.69
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.68
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.64
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.53
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.47
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.36
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.1
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 96.97
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 96.9
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.85
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.57
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.45
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 94.98
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 94.49
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 94.27
d2ptda_ 296 Phosphatidylinositol-specific phospholipase C {Bac 92.38
d1eg3a297 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 90.5
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 90.4
d1wlma1138 Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 88.74
d1q88a_192 39 kda initiator binding protein, IBP39, C-termina 83.1
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: EF-hand modules in multidomain proteins
domain: Phospholipase C-beta-2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.97  E-value=1.5e-32  Score=214.77  Aligned_cols=161  Identities=30%  Similarity=0.544  Sum_probs=119.0

Q ss_pred             HHHHhhhhcCCCCcccHHHHHHHhcCCCcHHHHHHHHHHhCCCCCCCCCCCCCCCCHHHHHHHHHHcCCchHHHHHHHHH
Q psy16202         11 SWMRLGMLVEAKGKVPVKVVSRTFASGKTEKLVYQTMAELGLPSGKNDVIEPADFTFDKFYELYHKICPRNDIEELFQSI   90 (218)
Q Consensus        11 ~wl~~~fd~d~~G~I~~~el~~~l~~~~~~~~i~~~~~~~~~~~~k~d~~~~g~l~f~eF~~~~~~l~~r~ei~~iF~~~   90 (218)
                      .|.|.++|+|++|+||++||+++|+...  ..+....+.++...++.|.+++|.|+|+||..+|..+++|++|..+|..|
T Consensus        10 ~~~k~~~d~n~dG~Is~~el~k~l~~~~--~~~~~~~~~~~~~~~~~D~~~~~~i~F~eF~~~~~~l~~r~ei~~~F~~~   87 (170)
T d2zkmx1          10 ILVKLKMQLNSEGKIPVKNFFQMFPADR--KRVEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEIDEIFTSY   87 (170)
T ss_dssp             HHHHHHHSCCTTSCEEHHHHHHHSCSCH--HHHHHHHHHTTCCCCTTCEECGGGCCHHHHHHHHHHHSCCHHHHTTCC--
T ss_pred             HHHHHhcccCCCCCCcHHHHHHHHHHhh--hhHHHHHHHHhhhhccccccCCCccCHHHHHHHHhccCCHHHHHHHHHHH
Confidence            4677778999999999999999997643  34556677788888888999999999999999999999999999999999


Q ss_pred             cCCCCCcccHHHHHHHHHHhcCCccccccccccCCHHHHHHHHHHhcchhhhhccCCcCHHHHHHHHcCCCCCCcccccc
Q psy16202         91 TKGKAETINLDQFITFLNEKQRDPRLNEILYPLYDEKRALEIINTYEQNEEIRNEKSFSKDGLIRYLMSDENAPVFLDRL  170 (218)
Q Consensus        91 d~~~~g~it~~ef~~FL~~~Q~e~~~~~~~~~~~t~~~~~~li~~~~~~~~~~~~g~ls~~~F~~~L~s~~n~~~~~~~~  170 (218)
                      +++++|+||.+||++||+++|+++++||+++|.++.+.|.++|.+|+++....++|.||++||++||+|++|+|++|++.
T Consensus        88 d~d~~~~it~~el~~fL~~~Q~~~~~~e~~~~~~~~~~~~~~i~~~~~~~~~~~~~~ls~d~F~~fL~S~en~i~~~~~~  167 (170)
T d2zkmx1          88 HAKAKPYMTKEHLTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINAQRGQLSPEGMVWFLCGPENSVLAQDKL  167 (170)
T ss_dssp             ------CCCHHHHHHHHHHTCC---------------CHHHHHHHHCCC--------CCHHHHHHHHHSTTSCSBCGGGG
T ss_pred             cCCCCCcccHHHHHHHHHHHhcchhhhhhccccCCHHHHHHHHHHHccccccccCCeECHHHHHHHHcCccCCCCChhhh
Confidence            99988999999999999999999999999999999999999999999997777789999999999999999999999998


Q ss_pred             ccc
Q psy16202        171 DFY  173 (218)
Q Consensus       171 ~~~  173 (218)
                      .+|
T Consensus       168 ~~~  170 (170)
T d2zkmx1         168 LLH  170 (170)
T ss_dssp             SSC
T ss_pred             ccC
Confidence            765
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ptda_ c.1.18.2 (A:) Phosphatidylinositol-specific phospholipase C {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q88a_ e.47.1.1 (A:) 39 kda initiator binding protein, IBP39, C-terminal domains {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure