Psyllid ID: psy16207
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| 189236678 | 306 | PREDICTED: similar to CG32698 CG32698-PA | 1.0 | 0.843 | 0.738 | 1e-116 | |
| 242021100 | 296 | conserved hypothetical protein [Pediculu | 1.0 | 0.871 | 0.732 | 1e-115 | |
| 270005179 | 303 | hypothetical protein TcasGA2_TC007197 [T | 1.0 | 0.851 | 0.732 | 1e-115 | |
| 357615711 | 326 | hypothetical protein KGM_15292 [Danaus p | 1.0 | 0.791 | 0.72 | 1e-113 | |
| 345480872 | 318 | PREDICTED: carbonic anhydrase-related pr | 0.996 | 0.808 | 0.672 | 1e-106 | |
| 383856396 | 400 | PREDICTED: carbonic anhydrase-related pr | 0.992 | 0.64 | 0.647 | 1e-104 | |
| 340717423 | 317 | PREDICTED: carbonic anhydrase-related pr | 0.992 | 0.807 | 0.658 | 1e-103 | |
| 66559986 | 317 | PREDICTED: carbonic anhydrase-related pr | 0.992 | 0.807 | 0.658 | 1e-103 | |
| 194890374 | 327 | GG18326 [Drosophila erecta] gi|190648947 | 1.0 | 0.788 | 0.657 | 1e-103 | |
| 195565993 | 310 | GD16965 [Drosophila simulans] gi|1942039 | 1.0 | 0.832 | 0.657 | 1e-103 |
| >gi|189236678|ref|XP_972474.2| PREDICTED: similar to CG32698 CG32698-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 424 bits (1089), Expect = e-116, Method: Compositional matrix adjust.
Identities = 203/275 (73%), Positives = 227/275 (82%), Gaps = 17/275 (6%)
Query: 1 PAFWGLINPEWSLCNKGRRQSPVNLEPSKLLYDPNLRPVHIDKIRINGGLTNTGHSVVFT 60
PAFWGLINPEWSLCNKGRRQSPVNLEP+KLL+DPNLRP+HIDK R++G + NTGHSV+FT
Sbjct: 25 PAFWGLINPEWSLCNKGRRQSPVNLEPNKLLFDPNLRPLHIDKHRVSGSIMNTGHSVIFT 84
Query: 61 VENTTRYHINVTGGPLSYKYQFHELHIHYGLQDNMGSEHVINEYVFPAEIQIFGFNSQLY 120
V+N TR+HINVTGGPLSYKYQF E+HIHYGL D GSEH IN Y FPAEIQIFGFNSQLY
Sbjct: 85 VDNDTRHHINVTGGPLSYKYQFQEIHIHYGLHDQFGSEHSINGYNFPAEIQIFGFNSQLY 144
Query: 121 TNFSEALYRAQGVVAISLLLQF-PLS----------------PGGAVEVKHLSIVGLLPE 163
TNFSEAL++AQG+V ISLLLQ LS G VEVK LS+ GLLPE
Sbjct: 145 TNFSEALHKAQGIVVISLLLQMGDLSNPELRILTDQLEKIRYGGDEVEVKRLSVRGLLPE 204
Query: 164 TKYYMTYDGSITMPACYETVTWIIFNKPIYITKQQLHGLRKLMQGDMKHPKAPLGNNYRP 223
T YYMTYDGS TMPAC+ETVTW+I NKPIYITKQQ+H LR+LMQGD KHPKAPLGNN+RP
Sbjct: 205 TDYYMTYDGSTTMPACHETVTWLILNKPIYITKQQMHALRRLMQGDAKHPKAPLGNNFRP 264
Query: 224 PQPLHHRPLRTNIDFNTKEINGKDCPTMHHKVFYK 258
PQPLHHRP+RTNIDF T + GK CP+M+ V+YK
Sbjct: 265 PQPLHHRPVRTNIDFKTTKHAGKQCPSMYKDVYYK 299
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242021100|ref|XP_002430984.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212516208|gb|EEB18246.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|270005179|gb|EFA01627.1| hypothetical protein TcasGA2_TC007197 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|357615711|gb|EHJ69794.1| hypothetical protein KGM_15292 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|345480872|ref|XP_003424234.1| PREDICTED: carbonic anhydrase-related protein 10-like isoform 2 [Nasonia vitripennis] gi|345480874|ref|XP_001606280.2| PREDICTED: carbonic anhydrase-related protein 10-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383856396|ref|XP_003703695.1| PREDICTED: carbonic anhydrase-related protein 10-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340717423|ref|XP_003397183.1| PREDICTED: carbonic anhydrase-related protein 10-like [Bombus terrestris] gi|350407443|ref|XP_003488089.1| PREDICTED: carbonic anhydrase-related protein 10-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|66559986|ref|XP_396828.2| PREDICTED: carbonic anhydrase-related protein 10-like [Apis mellifera] gi|380030596|ref|XP_003698930.1| PREDICTED: carbonic anhydrase-related protein 10-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|194890374|ref|XP_001977298.1| GG18326 [Drosophila erecta] gi|190648947|gb|EDV46225.1| GG18326 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195565993|ref|XP_002106578.1| GD16965 [Drosophila simulans] gi|194203958|gb|EDX17534.1| GD16965 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| FB|FBgn0052698 | 327 | CG32698 [Drosophila melanogast | 0.546 | 0.431 | 0.702 | 7.9e-93 | |
| FB|FBgn0029962 | 333 | CG1402 [Drosophila melanogaste | 0.589 | 0.456 | 0.552 | 1.1e-76 | |
| UNIPROTKB|Q9NS85 | 328 | CA10 "Carbonic anhydrase-relat | 0.538 | 0.423 | 0.384 | 2.6e-51 | |
| MGI|MGI:1919855 | 328 | Car10 "carbonic anhydrase 10" | 0.538 | 0.423 | 0.384 | 2.6e-51 | |
| ZFIN|ZDB-GENE-051030-123 | 328 | ca10a "carbonic anhydrase Xa" | 0.538 | 0.423 | 0.377 | 3.7e-50 | |
| WB|WBGene00000280 | 337 | cah-2 [Caenorhabditis elegans | 0.709 | 0.543 | 0.367 | 6.8e-49 | |
| UNIPROTKB|O75493 | 328 | CA11 "Carbonic anhydrase-relat | 0.534 | 0.420 | 0.443 | 1.2e-39 | |
| UNIPROTKB|Q5R665 | 328 | CA11 "Carbonic anhydrase-relat | 0.534 | 0.420 | 0.443 | 1.2e-39 | |
| RGD|735155 | 328 | Car11 "carbonic anhydrase 11" | 0.534 | 0.420 | 0.436 | 3.2e-39 | |
| MGI|MGI:1336193 | 328 | Car11 "carbonic anhydrase 11" | 0.534 | 0.420 | 0.436 | 4e-39 |
| FB|FBgn0052698 CG32698 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 574 (207.1 bits), Expect = 7.9e-93, Sum P(2) = 7.9e-93
Identities = 104/148 (70%), Positives = 123/148 (83%)
Query: 1 PAFWGLINPEWSLCNKGRRQSPVNLEPSKLLYDPNLRPVHIDKIRINGGLTNTGHSVVFT 60
PAFWGLINPEWSLCNKGRRQSPVNLEP +LL+DPNLRP+HIDK RI+G +TNTGHSV+FT
Sbjct: 38 PAFWGLINPEWSLCNKGRRQSPVNLEPQRLLFDPNLRPMHIDKHRISGLITNTGHSVIFT 97
Query: 61 VENTT--RYH-----INVTGGPLSYKYQFHELHIHYGLQDNMGSEHVINEYVFPAEIQIF 113
N T Y +N++GGPLSY+Y+FHE+H+HYGL D GSEH + Y FPAEIQIF
Sbjct: 98 AGNDTVANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIF 157
Query: 114 GFNSQLYTNFSEALYRAQGVVAISLLLQ 141
G+NSQLY NFS+AL RAQG+V +S+LLQ
Sbjct: 158 GYNSQLYANFSDALNRAQGIVGVSILLQ 185
|
|
| FB|FBgn0029962 CG1402 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9NS85 CA10 "Carbonic anhydrase-related protein 10" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919855 Car10 "carbonic anhydrase 10" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-051030-123 ca10a "carbonic anhydrase Xa" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00000280 cah-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O75493 CA11 "Carbonic anhydrase-related protein 11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R665 CA11 "Carbonic anhydrase-related protein 11" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| RGD|735155 Car11 "carbonic anhydrase 11" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1336193 Car11 "carbonic anhydrase 11" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| cd03121 | 256 | cd03121, alpha_CARP_X_XI_like, Carbonic anhydrase | 1e-115 | |
| smart01057 | 247 | smart01057, Carb_anhydrase, Eukaryotic-type carbon | 2e-66 | |
| cd00326 | 227 | cd00326, alpha_CA, Carbonic anhydrase alpha (verte | 1e-63 | |
| pfam00194 | 238 | pfam00194, Carb_anhydrase, Eukaryotic-type carboni | 1e-47 | |
| cd03149 | 236 | cd03149, alpha_CA_VII, Carbonic anhydrase alpha, C | 3e-44 | |
| cd03123 | 248 | cd03123, alpha_CA_VI_IX_XII_XIV, Carbonic anhydras | 1e-42 | |
| cd03119 | 259 | cd03119, alpha_CA_I_II_III_XIII, Carbonic anhydras | 4e-42 | |
| cd03117 | 234 | cd03117, alpha_CA_IV_XV_like, Carbonic anhydrase a | 2e-41 | |
| cd03124 | 216 | cd03124, alpha_CA_prokaryotic_like, Carbonic anhyd | 4e-40 | |
| cd03122 | 253 | cd03122, alpha_CARP_receptor_like, Carbonic anhydr | 1e-39 | |
| cd03118 | 236 | cd03118, alpha_CA_V, Carbonic anhydrase alpha, CA | 2e-39 | |
| cd03120 | 256 | cd03120, alpha_CARP_VIII, Carbonic anhydrase alpha | 6e-35 | |
| cd03126 | 249 | cd03126, alpha_CA_XII_XIV, Carbonic anhydrase alph | 5e-34 | |
| cd03150 | 247 | cd03150, alpha_CA_IX, Carbonic anhydrase alpha, is | 2e-33 | |
| cd03125 | 249 | cd03125, alpha_CA_VI, Carbonic anhydrase alpha, is | 1e-28 | |
| COG3338 | 250 | COG3338, Cah, Carbonic anhydrase [Inorganic ion tr | 6e-20 | |
| PLN02202 | 284 | PLN02202, PLN02202, carbonate dehydratase | 2e-15 | |
| PLN02179 | 235 | PLN02179, PLN02179, carbonic anhydrase | 2e-08 |
| >gnl|CDD|239395 cd03121, alpha_CARP_X_XI_like, Carbonic anhydrase alpha related protein: groups X, XI and related proteins | Back alignment and domain information |
|---|
Score = 330 bits (849), Expect = e-115
Identities = 122/257 (47%), Positives = 169/257 (65%), Gaps = 22/257 (8%)
Query: 1 PAFWGLINPEWSLCNKGRRQSPVNLEPSKLLYDPNLRPVHIDK-IRINGGLTNTGHSVVF 59
P+FWGL+N W+LC+KGRRQSPV++EPS+LL+DP L P+ ID +++G NTG V F
Sbjct: 2 PSFWGLVNSAWNLCSKGRRQSPVDIEPSRLLFDPFLTPLRIDTGRKVSGTFYNTGRHVSF 61
Query: 60 TVENTTRYHINVTGGPLSYKYQFHELHIHYGLQDNMGSEHVINEYVFPAEIQIFGFNSQL 119
+ +N++GGPLSY+Y+ E+ +H+G +D GSEH +N FP E+Q+ +NS+L
Sbjct: 62 RPDKDP--VVNISGGPLSYRYRLEEIRLHFGREDEQGSEHTVNGQAFPGEVQLIHYNSEL 119
Query: 120 YTNFSEALYRAQGVVAISLLLQFPLSP-------------------GGAVEVKHLSIVGL 160
Y NFSEA G+V +SL ++ + G A ++ LSI L
Sbjct: 120 YPNFSEASKSPNGLVIVSLFVKIGETSNPELRRLTNRDTITSIRYKGDAYFLQDLSIELL 179
Query: 161 LPETKYYMTYDGSITMPACYETVTWIIFNKPIYITKQQLHGLRKLMQGDMKHPKAPLGNN 220
LPET +Y+TY+GS+T P C+ETVTWII NKPIYITK+Q+H LR L Q KAP+ N
Sbjct: 180 LPETDHYITYEGSLTSPGCHETVTWIILNKPIYITKEQMHSLRLLSQNSPSQEKAPMSPN 239
Query: 221 YRPPQPLHHRPLRTNID 237
+RP QPL++RP+RTNI+
Sbjct: 240 FRPVQPLNNRPVRTNIN 256
|
This subgroup contains carbonic anhydrase related proteins (CARPs) X and XI, which have been implicated in various biological processes of the central nervous system. CARPs are sequence similar to carbonic anhydrases. Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism. CARPs have lost conserved histidines involved in zinc binding and consequently their catalytic activity. CARP XI plays a role in the development of gastrointestinal stromal tumors. Length = 256 |
| >gnl|CDD|215000 smart01057, Carb_anhydrase, Eukaryotic-type carbonic anhydrase | Back alignment and domain information |
|---|
| >gnl|CDD|238200 cd00326, alpha_CA, Carbonic anhydrase alpha (vertebrate-like) group | Back alignment and domain information |
|---|
| >gnl|CDD|201071 pfam00194, Carb_anhydrase, Eukaryotic-type carbonic anhydrase | Back alignment and domain information |
|---|
| >gnl|CDD|239402 cd03149, alpha_CA_VII, Carbonic anhydrase alpha, CA isozyme VII_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|239397 cd03123, alpha_CA_VI_IX_XII_XIV, Carbonic anhydrase alpha, isozymes VI, IX, XII and XIV | Back alignment and domain information |
|---|
| >gnl|CDD|239393 cd03119, alpha_CA_I_II_III_XIII, Carbonic anhydrase alpha, isozymes I, II, and III and XIII | Back alignment and domain information |
|---|
| >gnl|CDD|239391 cd03117, alpha_CA_IV_XV_like, Carbonic anhydrase alpha, CA_IV, CA_XV, like isozymes | Back alignment and domain information |
|---|
| >gnl|CDD|239398 cd03124, alpha_CA_prokaryotic_like, Carbonic anhydrase alpha, prokaryotic-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239396 cd03122, alpha_CARP_receptor_like, Carbonic anhydrase alpha related protein, receptor_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239392 cd03118, alpha_CA_V, Carbonic anhydrase alpha, CA isozyme V_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|239394 cd03120, alpha_CARP_VIII, Carbonic anhydrase alpha related protein, group VIII | Back alignment and domain information |
|---|
| >gnl|CDD|239400 cd03126, alpha_CA_XII_XIV, Carbonic anhydrase alpha, isozymes XII and XIV | Back alignment and domain information |
|---|
| >gnl|CDD|239403 cd03150, alpha_CA_IX, Carbonic anhydrase alpha, isozyme IX | Back alignment and domain information |
|---|
| >gnl|CDD|239399 cd03125, alpha_CA_VI, Carbonic anhydrase alpha, isozyme VI | Back alignment and domain information |
|---|
| >gnl|CDD|225875 COG3338, Cah, Carbonic anhydrase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|177853 PLN02202, PLN02202, carbonate dehydratase | Back alignment and domain information |
|---|
| >gnl|CDD|177835 PLN02179, PLN02179, carbonic anhydrase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| cd03121 | 256 | alpha_CARP_X_XI_like Carbonic anhydrase alpha rela | 100.0 | |
| cd03119 | 259 | alpha_CA_I_II_III_XIII Carbonic anhydrase alpha, i | 100.0 | |
| cd03126 | 249 | alpha_CA_XII_XIV Carbonic anhydrase alpha, isozyme | 100.0 | |
| PF00194 | 256 | Carb_anhydrase: Eukaryotic-type carbonic anhydrase | 100.0 | |
| cd03149 | 236 | alpha_CA_VII Carbonic anhydrase alpha, CA isozyme | 100.0 | |
| cd03118 | 236 | alpha_CA_V Carbonic anhydrase alpha, CA isozyme V_ | 100.0 | |
| cd03122 | 253 | alpha_CARP_receptor_like Carbonic anhydrase alpha | 100.0 | |
| cd03123 | 248 | alpha_CA_VI_IX_XII_XIV Carbonic anhydrase alpha, i | 100.0 | |
| cd03120 | 256 | alpha_CARP_VIII Carbonic anhydrase alpha related p | 100.0 | |
| cd03150 | 247 | alpha_CA_IX Carbonic anhydrase alpha, isozyme IX. | 100.0 | |
| cd03125 | 249 | alpha_CA_VI Carbonic anhydrase alpha, isozyme VI. | 100.0 | |
| KOG0382|consensus | 262 | 100.0 | ||
| cd03117 | 234 | alpha_CA_IV_XV_like Carbonic anhydrase alpha, CA_I | 100.0 | |
| PLN02202 | 284 | carbonate dehydratase | 100.0 | |
| cd00326 | 227 | alpha_CA Carbonic anhydrase alpha (vertebrate-like | 100.0 | |
| cd03124 | 216 | alpha_CA_prokaryotic_like Carbonic anhydrase alpha | 100.0 | |
| COG3338 | 250 | Cah Carbonic anhydrase [Inorganic ion transport an | 100.0 | |
| PLN02179 | 235 | carbonic anhydrase | 100.0 |
| >cd03121 alpha_CARP_X_XI_like Carbonic anhydrase alpha related protein: groups X, XI and related proteins | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.6e-75 Score=514.29 Aligned_cols=235 Identities=52% Similarity=0.961 Sum_probs=210.1
Q ss_pred CCCcCCcCCCCccCCCCCCCCCceecCCCceecCCCCCeeeecc-CceeEEEecCceeEEEEcCCCceeEEEeCCCccee
Q psy16207 1 PAFWGLINPEWSLCNKGRRQSPVNLEPSKLLYDPNLRPVHIDKI-RINGGLTNTGHSVVFTVENTTRYHINVTGGPLSYK 79 (258)
Q Consensus 1 P~~W~~l~~~~~~C~~G~~QSPInI~~~~~~~~~~l~~l~~~~~-~~~~~i~N~G~tv~v~~~~~~~~~~~l~gg~l~~~ 79 (258)
|++|+.++++|..|++|++||||||.+..+.+++.+.+|.|.|. ....+|.|+||||+|.+..+ ..+.+.||+|..+
T Consensus 2 P~~W~~~~~~~~~C~~G~~QSPI~I~~~~~~~~~~l~~L~~~~~~~~~~~l~N~Ghtv~v~~~~~--~~~~i~gG~l~~~ 79 (256)
T cd03121 2 PSFWGLVNSAWNLCSKGRRQSPVDIEPSRLLFDPFLTPLRIDTGRKVSGTFYNTGRHVSFRPDKD--PVVNISGGPLSYR 79 (256)
T ss_pred CCcccccCCchhhccCCCCcCCEeEeccceEECCCCCceeeccCCCCceEEEECCEEEEEEECCC--CceEEeCCCCCCc
Confidence 88999999999999999999999999888777788888999887 66789999999999998643 3478889999999
Q ss_pred eeeEEEEEEecCCCCCCCceeecceecceeEEEEeecccccCCHHHHhhccCceeEEEEEEEccCC--------------
Q psy16207 80 YQFHELHIHYGLQDNMGSEHVINEYVFPAEIQIFGFNSQLYTNFSEALYRAQGVVAISLLLQFPLS-------------- 145 (258)
Q Consensus 80 Y~l~q~HfHwG~~~~~gSEH~i~G~~~~~E~H~Vh~~~~~y~~~~eA~~~~~g~~vlav~~~~~~~-------------- 145 (258)
|+|.|||||||+.++.||||+|||++|||||||||++.++|.+++||.++++++|||||||+++..
T Consensus 80 Y~l~Q~HFHwG~~~~~gSEH~idG~~yp~E~HlVH~n~~~y~~~~~A~~~~~glaVvgv~~~~g~~~n~~l~~i~~~l~~ 159 (256)
T cd03121 80 YRLEEIRLHFGREDEQGSEHTVNGQAFPGEVQLIHYNSELYPNFSEASKSPNGLVIVSLFVKIGETSNPELRRLTNRDTI 159 (256)
T ss_pred EEEEEEEEecCCCCCCCCceeeCCcccCceEEEEEEcccccCCHHHHhcCCCCeEEEEEEEeecccCCHHHHHHHHhccc
Confidence 999999999999999999999999999999999999988999999999999999999999999821
Q ss_pred -----CCCeeEecccCccccCCCCCCcEEEeccccCCCCccceEEeeeceeeecCHHHHHHHHHhhcCCCCCCCCCCCCC
Q psy16207 146 -----PGGAVEVKHLSIVGLLPETKYYMTYDGSITMPACYETVTWIIFNKPIYITKQQLHGLRKLMQGDMKHPKAPLGNN 220 (258)
Q Consensus 146 -----~g~~~~~~~~~l~~Llp~~~~yy~Y~GSLTtPPCtE~V~WiV~~~p~~Is~~Ql~~fr~l~~~~~~~~~~~~~~N 220 (258)
+++...+..|++.+|||....||+|.||||||||+|+|+|+||++|+.||.+||++||+++..........+.+|
T Consensus 160 ~~i~~~~~~~~~~~~~l~~Llp~~~~yy~Y~GSLTTPPC~E~V~W~V~~~pi~Is~~Ql~~fr~l~~~~~~~~~~~~~~N 239 (256)
T cd03121 160 TSIRYKGDAYFLQDLSIELLLPETDHYITYEGSLTSPGCHETVTWIILNKPIYITKEQMHSLRLLSQNSPSQEKAPMSPN 239 (256)
T ss_pred cccccCCceeecCCCCHHHHCCCCCceEEeeccccCCCCCcceEEEEeCccEecCHHHHHHHHHHhhccCCcccCcCCCC
Confidence 233344557999999999899999999999999999999999999999999999999999865433333457899
Q ss_pred CCCCCCCCCCeEEEeee
Q psy16207 221 YRPPQPLHHRPLRTNID 237 (258)
Q Consensus 221 ~Rp~Qpln~R~V~~~~~ 237 (258)
+||+||||||.|+.++|
T Consensus 240 ~Rp~Q~ln~R~V~~~~~ 256 (256)
T cd03121 240 FRPVQPLNNRPVRTNIN 256 (256)
T ss_pred CCCCCCCCCCeEEeeCC
Confidence 99999999999998765
|
This subgroup contains carbonic anhydrase related proteins (CARPs) X and XI, which have been implicated in various biological processes of the central nervous system. CARPs are sequence similar to carbonic anhydrases. Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism. CARPs have lost conserved histidines involved in zinc binding and consequently their catalytic activity. CARP XI plays a role in the development of gastrointestinal stromal tumors. |
| >cd03119 alpha_CA_I_II_III_XIII Carbonic anhydrase alpha, isozymes I, II, and III and XIII | Back alignment and domain information |
|---|
| >cd03126 alpha_CA_XII_XIV Carbonic anhydrase alpha, isozymes XII and XIV | Back alignment and domain information |
|---|
| >PF00194 Carb_anhydrase: Eukaryotic-type carbonic anhydrase; InterPro: IPR001148 Carbonic anhydrases (CA: 4 | Back alignment and domain information |
|---|
| >cd03149 alpha_CA_VII Carbonic anhydrase alpha, CA isozyme VII_like subgroup | Back alignment and domain information |
|---|
| >cd03118 alpha_CA_V Carbonic anhydrase alpha, CA isozyme V_like subgroup | Back alignment and domain information |
|---|
| >cd03122 alpha_CARP_receptor_like Carbonic anhydrase alpha related protein, receptor_like subfamily | Back alignment and domain information |
|---|
| >cd03123 alpha_CA_VI_IX_XII_XIV Carbonic anhydrase alpha, isozymes VI, IX, XII and XIV | Back alignment and domain information |
|---|
| >cd03120 alpha_CARP_VIII Carbonic anhydrase alpha related protein, group VIII | Back alignment and domain information |
|---|
| >cd03150 alpha_CA_IX Carbonic anhydrase alpha, isozyme IX | Back alignment and domain information |
|---|
| >cd03125 alpha_CA_VI Carbonic anhydrase alpha, isozyme VI | Back alignment and domain information |
|---|
| >KOG0382|consensus | Back alignment and domain information |
|---|
| >cd03117 alpha_CA_IV_XV_like Carbonic anhydrase alpha, CA_IV, CA_XV, like isozymes | Back alignment and domain information |
|---|
| >PLN02202 carbonate dehydratase | Back alignment and domain information |
|---|
| >cd00326 alpha_CA Carbonic anhydrase alpha (vertebrate-like) group | Back alignment and domain information |
|---|
| >cd03124 alpha_CA_prokaryotic_like Carbonic anhydrase alpha, prokaryotic-like subfamily | Back alignment and domain information |
|---|
| >COG3338 Cah Carbonic anhydrase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02179 carbonic anhydrase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 258 | ||||
| 3ml5_A | 269 | Crystal Structure Of The C183sC217S MUTANT OF HUMAN | 3e-28 | ||
| 3mdz_A | 281 | Crystal Structure Of Human Carbonic Anhydrase Vii [ | 6e-28 | ||
| 3da2_A | 262 | X-Ray Structure Of Human Carbonic Anhydrase 13 In C | 2e-27 | ||
| 3czv_A | 264 | Crystal Structure Of The Human Carbonic Anhydrase X | 2e-27 | ||
| 3v3g_B | 260 | Kinetic And Structural Studies Of Thermostabilized | 1e-26 | ||
| 3v3f_A | 260 | Kinetic And Structural Studies Of Thermostabilized | 1e-26 | ||
| 3v3i_B | 260 | Kinetic And Structural Studies Of Thermostabilized | 1e-26 | ||
| 3v3h_B | 260 | Kinetic And Structural Studies Of Thermostabilized | 1e-26 | ||
| 3v3j_A | 260 | Kinetic And Structural Studies Of Thermostabilized | 2e-26 | ||
| 1mua_A | 256 | Structure And Energetics Of A Non-Proline Cis-Pepti | 1e-25 | ||
| 1h9q_A | 259 | H119q Carbonic Anhydrase Ii Length = 259 | 1e-25 | ||
| 3u45_X | 260 | Human Carbonic Anhydrase Ii V143a Length = 260 | 2e-25 | ||
| 3dvc_A | 259 | X-Ray Crystal Structure Of Mutant N62t Of Human Car | 2e-25 | ||
| 1cnh_A | 259 | X-Ray Crystallographic Studies Of Engineered Hydrog | 2e-25 | ||
| 1ugd_A | 258 | Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu | 3e-25 | ||
| 3uyq_A | 260 | Hca 3 Length = 260 | 3e-25 | ||
| 2nwy_A | 260 | Structural And Kinetic Effects Of Hydrophobic Mutat | 3e-25 | ||
| 4bcw_A | 257 | Carbonic Anhydrase Ix Mimic In Complex With (e)-2-( | 3e-25 | ||
| 3dbu_A | 260 | Use Of Carbonic Anhydrase Ii, Ix Active-Site Mimic, | 3e-25 | ||
| 1urt_A | 248 | Murine Carbonic Anhydrase V Length = 248 | 3e-25 | ||
| 2hfw_A | 260 | Structural And Kinetic Analysis Of Proton Shuttle R | 4e-25 | ||
| 7ca2_A | 260 | Engineering The Hydrophobic Pocket Of Carbonic Anhy | 4e-25 | ||
| 1dmx_A | 248 | Murine Mitochondrial Carbonic Anyhdrase V At 2.45 A | 5e-25 | ||
| 1cve_A | 259 | Structural Consequences Of Redesigning A Protein-Zi | 5e-25 | ||
| 3dv7_A | 259 | Role Of Hydrophilic Residues In Proton Transfer Dur | 5e-25 | ||
| 3mnh_A | 260 | Human Carbonic Anhydrase Ii Mutant K170a Length = 2 | 5e-25 | ||
| 4g0c_A | 257 | Neutron Structure Of Acetazolamide-Bound Human Carb | 5e-25 | ||
| 1xpz_A | 258 | Structure Of Human Carbonic Anhydrase Ii With 4-[4- | 5e-25 | ||
| 3tmj_A | 258 | Joint X-RayNEUTRON STRUCTURE OF HUMAN CARBONIC ANHY | 5e-25 | ||
| 3r16_A | 257 | Human Caii Bound To N-(4-Sulfamoylphenyl)-2-(Thioph | 5e-25 | ||
| 1uge_A | 258 | Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) M | 5e-25 | ||
| 1lzv_A | 260 | Site-Specific Mutant (Tyr7 Replaced With His) Of Hu | 5e-25 | ||
| 2nxr_A | 260 | Structural Effects Of Hydrophobic Mutations On The | 5e-25 | ||
| 3dvd_A | 259 | X-Ray Crystal Structure Of Mutant N62d Of Human Car | 5e-25 | ||
| 2cbe_A | 260 | Structure Of Native And Apo Carbonic Anhydrase Ii A | 6e-25 | ||
| 1f2w_A | 259 | The Mechanism Of Cyanamide Hydration Catalyzed By C | 6e-25 | ||
| 3rld_A | 260 | Crystal Structure Of The Y7i Mutant Of Human Carbon | 6e-25 | ||
| 1h9n_A | 259 | H119n Carbonic Anhydrase Ii Length = 259 | 6e-25 | ||
| 3mni_A | 260 | Human Carbonic Anhydrase Ii Mutant K170d Length = 2 | 6e-25 | ||
| 1ugf_A | 258 | Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) M | 6e-25 | ||
| 3pyk_A | 260 | Human Carbonic Anhydrase Ii As Host For Pianostool | 6e-25 | ||
| 1g6v_A | 260 | Complex Of The Camelid Heavy-Chain Antibody Fragmen | 6e-25 | ||
| 3kkx_A | 260 | Neutron Structure Of Human Carbonic Anhydrase Ii Le | 6e-25 | ||
| 3dvb_A | 259 | X-Ray Crystal Structure Of Mutant N62v Human Carbon | 6e-25 | ||
| 2pov_A | 259 | The Crystal Structure Of The Human Carbonic Anhydra | 6e-25 | ||
| 3tvo_X | 258 | Human Carbonic Anhydrase Ii Proton Transfer Double | 6e-25 | ||
| 3ryv_B | 259 | Carbonic Anhydrase Complexed With N-Ethyl-4-Sulfamo | 6e-25 | ||
| 3mnj_A | 260 | Human Carbonic Anhydrase Ii Mutant K170e Length = 2 | 6e-25 | ||
| 1zh9_A | 259 | Carbonic Anhydrase Ii In Complex With N-4-methyl-1- | 6e-25 | ||
| 2foq_A | 260 | Human Carbonic Anhydrase Ii Complexed With Two-Pron | 6e-25 | ||
| 5ca2_A | 260 | Conformational Mobility Of His-64 In The Thr-200 (R | 6e-25 | ||
| 3tvn_X | 258 | Human Carbonic Anhydrase Ii Proton Transfer Mutant | 6e-25 | ||
| 3rg3_A | 260 | Crystal Structure Of The W5e Mutant Of Human Carbon | 6e-25 | ||
| 3m1k_A | 265 | Carbonic Anhydrase In Complex With Fragment Length | 6e-25 | ||
| 3mnk_A | 260 | Human Carbonic Anhydrase Ii Mutant K170h Length = 2 | 7e-25 | ||
| 12ca_A | 260 | Altering The Mouth Of A Hydrophobic Pocket. Structu | 7e-25 | ||
| 3rge_A | 260 | Crystal Structure Of The W5h Mutant Of Human Carbon | 7e-25 | ||
| 1keq_A | 248 | Crystal Structure Of F65aY131C CARBONIC ANHYDRASE V | 7e-25 | ||
| 3rg4_A | 260 | Crystal Structure Of The W5f Mutant Of Human Carbon | 7e-25 | ||
| 2nwo_A | 260 | Structural And Kinetic Effect Of Hydrophobic Mutati | 8e-25 | ||
| 1bic_A | 259 | Crystallographic Analysis Of Thr-200-> His Human Ca | 8e-25 | ||
| 1ugb_A | 258 | Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu | 8e-25 | ||
| 3u47_A | 260 | Human Carbonic Anhydrase Ii V143l Length = 260 | 9e-25 | ||
| 3u3a_X | 260 | Structure Of Human Carbonic Anhydrase Ii V143i Leng | 9e-25 | ||
| 1fqm_A | 260 | X-Ray Crystal Structure Of Zinc-Bound F93iF95MW97V | 9e-25 | ||
| 1cvd_A | 255 | Structural Consequences Of Redesigning A Protein-Zi | 9e-25 | ||
| 8ca2_A | 260 | Engineering The Hydrophobic Pocket Of Carbonic Anhy | 9e-25 | ||
| 1uga_A | 258 | Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mu | 9e-25 | ||
| 1ydb_A | 259 | Structural Basis Of Inhibitor Affinity To Variants | 1e-24 | ||
| 3pjj_A | 259 | Synthetic Dimer Of Human Carbonic Anhydrase Ii Leng | 1e-24 | ||
| 1tg3_A | 260 | Effect Of Shuttle Location And Ph Environment On H+ | 1e-24 | ||
| 1th9_A | 260 | Effect Of Shuttle Location And Ph Environment On H+ | 1e-24 | ||
| 9ca2_A | 260 | Engineering The Hydrophobic Pocket Of Carbonic Anhy | 1e-24 | ||
| 6ca2_A | 260 | Engineering The Hydrophobic Pocket Of Carbonic Anhy | 1e-24 | ||
| 1hed_A | 260 | Structural Consequences Of Hydrophilic Amino-Acid S | 1e-24 | ||
| 1cni_A | 259 | X-Ray Crystallographic Studies Of Engineered Hydrog | 1e-24 | ||
| 1cnj_A | 259 | X-Ray Crystallographic Studies Of Engineered Hydrog | 1e-24 | ||
| 1ugc_A | 258 | Human Carbonic Anhydrase Ii [hcaii] (e.c.4.2.1.1) M | 1e-24 | ||
| 1caj_A | 259 | Structural Analysis Of The Zinc Hydroxide-Thr 199-G | 1e-24 | ||
| 1fql_A | 260 | X-Ray Crystal Structure Of Zinc-Bound F95mW97V CARB | 1e-24 | ||
| 1z97_A | 266 | Human Carbonic Anhydrase Iii: Structural And Kineti | 1e-24 | ||
| 1cak_A | 259 | Structural Analysis Of The Zinc Hydroxide-Thr 199-G | 1e-24 | ||
| 1zsa_A | 259 | Carbonic Anhydrase Ii Mutant E117q, Apo Form Length | 1e-24 | ||
| 1ydd_A | 259 | Structural Basis Of Inhibitor Affinity To Variants | 2e-24 | ||
| 1lg5_A | 260 | Crystal Structure Analysis Of The Hca Ii Mutant T19 | 2e-24 | ||
| 1cal_A | 259 | Structural Analysis Of The Zinc Hydroxide-Thr 199-G | 2e-24 | ||
| 1yda_A | 259 | Structural Basis Of Inhibitor Affinity To Variants | 2e-24 | ||
| 1hea_A | 260 | Carbonic Anhydrase Ii (Carbonate Dehydratase) (Hca | 2e-24 | ||
| 1dca_A | 260 | Structure Of An Engineered Metal Binding Site In Hu | 2e-24 | ||
| 1ccs_A | 259 | Structure-Assisted Redesign Of A Protein-Zinc Bindi | 2e-24 | ||
| 1heb_A | 260 | Structural Consequences Of Hydrophilic Amino-Acid S | 2e-24 | ||
| 1fr7_A | 260 | X-Ray Crystal Structure Of Zinc-Bound F93sF95LW97M | 2e-24 | ||
| 1cva_A | 259 | Structural And Functional Importance Of A Conserved | 2e-24 | ||
| 1z93_A | 266 | Human Carbonic Anhydrase Iii:structural And Kinetic | 2e-24 | ||
| 1cnk_A | 259 | X-Ray Crystallographic Studies Of Engineered Hydrog | 2e-24 | ||
| 1cct_A | 259 | Structure-Assisted Redesign Of A Protein-Zinc Bindi | 2e-24 | ||
| 1g0e_A | 260 | Site-Specific Mutant (His64 Replaced With Ala) Of H | 2e-24 | ||
| 1hec_A | 260 | Structural Consequences Of Hydrophilic Amino-Acid S | 2e-24 | ||
| 3m1q_A | 265 | Carbonic Anhydrase Ii Mutant W5c-H64c With Opened D | 3e-24 | ||
| 3kig_A | 265 | Mutant Carbonic Anhydrase Ii In Complex With An Azi | 3e-24 | ||
| 1cai_A | 259 | Structural Analysis Of The Zinc Hydroxide-Thr 199-G | 3e-24 | ||
| 1cng_A | 259 | X-Ray Crystallographic Studies Of Engineered Hydrog | 3e-24 | ||
| 3uyn_A | 260 | Hca 3 Length = 260 | 3e-24 | ||
| 1h4n_A | 259 | H94n Carbonic Anhydrase Ii Complexed With Tris Leng | 3e-24 | ||
| 1ccu_A | 259 | Structure-Assisted Redesign Of A Protein-Zinc Bindi | 3e-24 | ||
| 1g3z_A | 259 | Carbonic Anhydrase Ii (F131v) Length = 259 | 4e-24 | ||
| 1yo0_A | 260 | Proton Transfer From His200 In Human Carbonic Anhyd | 4e-24 | ||
| 1cvc_A | 259 | Redesigning The Zinc Binding Site Of Human Carbonic | 4e-24 | ||
| 2fnk_A | 260 | Activation Of Human Carbonic Anhydrase Ii By Exogen | 5e-24 | ||
| 2w2j_A | 291 | Crystal Structure Of The Human Carbonic Anhydrase R | 5e-24 | ||
| 2fnn_A | 260 | Activation Of Human Carbonic Anhydrase Ii By Exogen | 5e-24 | ||
| 1flj_A | 260 | Crystal Structure Of S-Glutathiolated Carbonic Anhy | 5e-24 | ||
| 2fnm_A | 260 | Activation Of Human Carbonic Anhdyrase Ii By Exogen | 5e-24 | ||
| 1cvf_A | 259 | Structural Consequences Of Redesigning A Protein-Zi | 6e-24 | ||
| 1cvh_A | 255 | Structural Consequences Of Redesigning A Protein-Zi | 7e-24 | ||
| 1cnb_A | 259 | Compensatory Plastic Effects In The Redesign Of Pro | 7e-24 | ||
| 1hva_A | 260 | Engineering The Zinc Binding Site Of Human Carbonic | 7e-24 | ||
| 1j9w_A | 260 | Solution Structure Of The Cai Michigan 1 Variant Le | 9e-24 | ||
| 2foy_A | 260 | Human Carbonic Anhydrase I Complexed With A Two-Pro | 1e-23 | ||
| 2it4_A | 256 | X Ray Structure Of The Complex Between Carbonic Anh | 2e-23 | ||
| 1crm_A | 260 | Structure And Function Of Carbonic Anhydrases Lengt | 2e-23 | ||
| 1rj5_A | 261 | Crystal Structure Of The Extracellular Domain Of Mu | 3e-22 | ||
| 1v9e_A | 259 | Crystal Structure Analysis Of Bovine Carbonic Anhyd | 1e-21 | ||
| 1v9i_C | 261 | Crystal Structure Analysis Of The Site Specific Mut | 1e-21 | ||
| 3iai_A | 257 | Crystal Structure Of The Catalytic Domain Of The Tu | 4e-21 | ||
| 1jcz_A | 263 | Crystal Structure Of The Extracellular Domain Of Hu | 1e-19 | ||
| 3jxf_A | 272 | Ca-Like Domain Of Human Ptprz Length = 272 | 3e-16 | ||
| 3s97_A | 273 | Ptprz Cntn1 Complex Length = 273 | 4e-16 | ||
| 3fe4_A | 278 | Crystal Structure Of Human Carbonic Anhydrase Vi Le | 8e-15 | ||
| 3jxh_C | 265 | Ca-Like Domain Of Human Ptprg Length = 265 | 2e-14 | ||
| 1znc_A | 266 | Human Carbonic Anhydrase Iv Length = 266 | 8e-14 | ||
| 3jxg_B | 269 | Ca-Like Domain Of Mouse Ptprg Length = 269 | 2e-13 | ||
| 4e9o_X | 269 | Vaccinia D8l Ectodomain Structure Length = 269 | 3e-13 | ||
| 2znc_A | 258 | Murine Carbonic Anhydrase Iv Length = 258 | 6e-12 | ||
| 1kop_A | 223 | Neisseria Gonorrhoeae Carbonic Anhydrase Length = 2 | 1e-09 | ||
| 1y7w_A | 291 | Crystal Structure Of A Halotolerant Carbonic Anhydr | 2e-07 | ||
| 3q31_A | 244 | Structure Of Fungal Alpha Carbonic Anhydrase From A | 6e-07 |
| >pdb|3ML5|A Chain A, Crystal Structure Of The C183sC217S MUTANT OF HUMAN CA VII IN COMPLEX With Acetazolamide Length = 269 | Back alignment and structure |
|
| >pdb|3MDZ|A Chain A, Crystal Structure Of Human Carbonic Anhydrase Vii [isoform 1], Ca7 Length = 281 | Back alignment and structure |
| >pdb|3DA2|A Chain A, X-Ray Structure Of Human Carbonic Anhydrase 13 In Complex With Inhibitor Length = 262 | Back alignment and structure |
| >pdb|3CZV|A Chain A, Crystal Structure Of The Human Carbonic Anhydrase Xiii In Complex With Acetazolamide Length = 264 | Back alignment and structure |
| >pdb|3V3G|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 | Back alignment and structure |
| >pdb|3V3F|A Chain A, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 | Back alignment and structure |
| >pdb|3V3I|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 | Back alignment and structure |
| >pdb|3V3H|B Chain B, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 | Back alignment and structure |
| >pdb|3V3J|A Chain A, Kinetic And Structural Studies Of Thermostabilized Mutants Of Hca Ii Length = 260 | Back alignment and structure |
| >pdb|1MUA|A Chain A, Structure And Energetics Of A Non-Proline Cis-Peptidyl Linkage In An Engineered Protein Length = 256 | Back alignment and structure |
| >pdb|1H9Q|A Chain A, H119q Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|3U45|X Chain X, Human Carbonic Anhydrase Ii V143a Length = 260 | Back alignment and structure |
| >pdb|3DVC|A Chain A, X-Ray Crystal Structure Of Mutant N62t Of Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1CNH|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|1UGD|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Ser (A65s) Length = 258 | Back alignment and structure |
| >pdb|3UYQ|A Chain A, Hca 3 Length = 260 | Back alignment and structure |
| >pdb|2NWY|A Chain A, Structural And Kinetic Effects Of Hydrophobic Mutations On The Active Site Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|4BCW|A Chain A, Carbonic Anhydrase Ix Mimic In Complex With (e)-2-(5-bromo- 2-hydroxyphenyl)ethenesulfonic Acid Length = 257 | Back alignment and structure |
| >pdb|3DBU|A Chain A, Use Of Carbonic Anhydrase Ii, Ix Active-Site Mimic, For The Purpose Of Screening Inhibitors For Possible Anti-Cancer Properties Length = 260 | Back alignment and structure |
| >pdb|1URT|A Chain A, Murine Carbonic Anhydrase V Length = 248 | Back alignment and structure |
| >pdb|2HFW|A Chain A, Structural And Kinetic Analysis Of Proton Shuttle Residues In The Active Site Of Human Carbonic Anhydrase Iii Length = 260 | Back alignment and structure |
| >pdb|7CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1DMX|A Chain A, Murine Mitochondrial Carbonic Anyhdrase V At 2.45 Angstroms Resolution Length = 248 | Back alignment and structure |
| >pdb|1CVE|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|3DV7|A Chain A, Role Of Hydrophilic Residues In Proton Transfer During Catalysis By Human Carbonic Anhydrase Ii (N62a) Length = 259 | Back alignment and structure |
| >pdb|3MNH|A Chain A, Human Carbonic Anhydrase Ii Mutant K170a Length = 260 | Back alignment and structure |
| >pdb|4G0C|A Chain A, Neutron Structure Of Acetazolamide-Bound Human Carbonic Anhydrase Ii Reveal Molecular Details Of Drug Binding Length = 257 | Back alignment and structure |
| >pdb|1XPZ|A Chain A, Structure Of Human Carbonic Anhydrase Ii With 4-[4-O- Sulfamoylbenzyl)(4-Cyanophenyl)amino]-4h-[1,2, 4]-Triazole Length = 258 | Back alignment and structure |
| >pdb|3TMJ|A Chain A, Joint X-RayNEUTRON STRUCTURE OF HUMAN CARBONIC ANHYDRASE II AT PH 7.8 Length = 258 | Back alignment and structure |
| >pdb|3R16|A Chain A, Human Caii Bound To N-(4-Sulfamoylphenyl)-2-(Thiophen-2-Yl) Acetamide Length = 257 | Back alignment and structure |
| >pdb|1UGE|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Leu (A65l) Length = 258 | Back alignment and structure |
| >pdb|1LZV|A Chain A, Site-Specific Mutant (Tyr7 Replaced With His) Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|2NXR|A Chain A, Structural Effects Of Hydrophobic Mutations On The Active Site Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|3DVD|A Chain A, X-Ray Crystal Structure Of Mutant N62d Of Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|2CBE|A Chain A, Structure Of Native And Apo Carbonic Anhydrase Ii And Some Of Its Anion-Ligand Complexes Length = 260 | Back alignment and structure |
| >pdb|1F2W|A Chain A, The Mechanism Of Cyanamide Hydration Catalyzed By Carbonic Anhydrase Ii Revealed By Cryogenic X-Ray Diffraction Length = 259 | Back alignment and structure |
| >pdb|3RLD|A Chain A, Crystal Structure Of The Y7i Mutant Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1H9N|A Chain A, H119n Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|3MNI|A Chain A, Human Carbonic Anhydrase Ii Mutant K170d Length = 260 | Back alignment and structure |
| >pdb|1UGF|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Thr (A65t) Length = 258 | Back alignment and structure |
| >pdb|3PYK|A Chain A, Human Carbonic Anhydrase Ii As Host For Pianostool Complexes Bearing A Sulfonamide Anchor Length = 260 | Back alignment and structure |
| >pdb|1G6V|A Chain A, Complex Of The Camelid Heavy-Chain Antibody Fragment Cab- Ca05 With Bovine Carbonic Anhydrase Length = 260 | Back alignment and structure |
| >pdb|3KKX|A Chain A, Neutron Structure Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|3DVB|A Chain A, X-Ray Crystal Structure Of Mutant N62v Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|2POV|A Chain A, The Crystal Structure Of The Human Carbonic Anhydrase Ii In Complex With 4-Amino-6-Chloro-Benzene-1,3-Disulfonamide Length = 259 | Back alignment and structure |
| >pdb|3TVO|X Chain X, Human Carbonic Anhydrase Ii Proton Transfer Double Mutant Length = 258 | Back alignment and structure |
| >pdb|3RYV|B Chain B, Carbonic Anhydrase Complexed With N-Ethyl-4-Sulfamoylbenzamide Length = 259 | Back alignment and structure |
| >pdb|3MNJ|A Chain A, Human Carbonic Anhydrase Ii Mutant K170e Length = 260 | Back alignment and structure |
| >pdb|1ZH9|A Chain A, Carbonic Anhydrase Ii In Complex With N-4-methyl-1- Piperazinyl-n'-(p-sulfonamide)phenylthiourea As Sulfonamide Inhibitor Length = 259 | Back alignment and structure |
| >pdb|2FOQ|A Chain A, Human Carbonic Anhydrase Ii Complexed With Two-Prong Inhibitors Length = 260 | Back alignment and structure |
| >pdb|5CA2|A Chain A, Conformational Mobility Of His-64 In The Thr-200 (Right Arrow) Ser Mutant Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|3TVN|X Chain X, Human Carbonic Anhydrase Ii Proton Transfer Mutant Length = 258 | Back alignment and structure |
| >pdb|3RG3|A Chain A, Crystal Structure Of The W5e Mutant Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|3M1K|A Chain A, Carbonic Anhydrase In Complex With Fragment Length = 265 | Back alignment and structure |
| >pdb|3MNK|A Chain A, Human Carbonic Anhydrase Ii Mutant K170h Length = 260 | Back alignment and structure |
| >pdb|12CA|A Chain A, Altering The Mouth Of A Hydrophobic Pocket. Structure And Kinetics Of Human Carbonic Anhydrase Ii Mutants At Residue Val-121 Length = 260 | Back alignment and structure |
| >pdb|3RGE|A Chain A, Crystal Structure Of The W5h Mutant Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1KEQ|A Chain A, Crystal Structure Of F65aY131C CARBONIC ANHYDRASE V, Covalently Modified With 4-Chloromethylimidazole Length = 248 | Back alignment and structure |
| >pdb|3RG4|A Chain A, Crystal Structure Of The W5f Mutant Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|2NWO|A Chain A, Structural And Kinetic Effect Of Hydrophobic Mutations In The Active Site Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1BIC|A Chain A, Crystallographic Analysis Of Thr-200-> His Human Carbonic Anhydrase Ii And Its Complex With The Substrate, Hco3- Length = 259 | Back alignment and structure |
| >pdb|1UGB|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Gly (A65g) Length = 258 | Back alignment and structure |
| >pdb|3U47|A Chain A, Human Carbonic Anhydrase Ii V143l Length = 260 | Back alignment and structure |
| >pdb|3U3A|X Chain X, Structure Of Human Carbonic Anhydrase Ii V143i Length = 260 | Back alignment and structure |
| >pdb|1FQM|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F93iF95MW97V Carbonic Anhydrase (Caii) Variant Length = 260 | Back alignment and structure |
| >pdb|1CVD|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 255 | Back alignment and structure |
| >pdb|8CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1UGA|A Chain A, Human Carbonic Anhydrase Ii[hcaii] (E.C.4.2.1.1) Mutant With Ala 65 Replaced By Phe (A65f) Length = 258 | Back alignment and structure |
| >pdb|1YDB|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|3PJJ|A Chain A, Synthetic Dimer Of Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1TG3|A Chain A, Effect Of Shuttle Location And Ph Environment On H+ Transfer In Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1TH9|A Chain A, Effect Of Shuttle Location And Ph Environment On H+ Transfer In Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|9CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|6CA2|A Chain A, Engineering The Hydrophobic Pocket Of Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1HED|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1CNI|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|1CNJ|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|1UGC|A Chain A, Human Carbonic Anhydrase Ii [hcaii] (e.c.4.2.1.1) Mutant With Ala 65 Replaced By His (a65h) Length = 258 | Back alignment and structure |
| >pdb|1CAJ|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1FQL|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F95mW97V CARBONIC Anhydrase (Caii) Variant Length = 260 | Back alignment and structure |
| >pdb|1Z97|A Chain A, Human Carbonic Anhydrase Iii: Structural And Kinetic Study Of Catalysis And Proton Transfer Length = 266 | Back alignment and structure |
| >pdb|1CAK|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1ZSA|A Chain A, Carbonic Anhydrase Ii Mutant E117q, Apo Form Length = 259 | Back alignment and structure |
| >pdb|1YDD|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1LG5|A Chain A, Crystal Structure Analysis Of The Hca Ii Mutant T199p In Complex With Beta-Mercaptoethanol Length = 260 | Back alignment and structure |
| >pdb|1CAL|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1YDA|A Chain A, Structural Basis Of Inhibitor Affinity To Variants Of Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1HEA|A Chain A, Carbonic Anhydrase Ii (Carbonate Dehydratase) (Hca Ii) (E.C.4.2.1.1) Mutant With Leu 198 Replaced By Arg (L198r) Length = 260 | Back alignment and structure |
| >pdb|1DCA|A Chain A, Structure Of An Engineered Metal Binding Site In Human Carbonic Anhydrase Ii Reveals The Architecture Of A Regulatory Cysteine Switch Length = 260 | Back alignment and structure |
| >pdb|1CCS|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 | Back alignment and structure |
| >pdb|1HEB|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1FR7|A Chain A, X-Ray Crystal Structure Of Zinc-Bound F93sF95LW97M Carbonic Anhydrase (Caii) Variant Length = 260 | Back alignment and structure |
| >pdb|1CVA|A Chain A, Structural And Functional Importance Of A Conserved Hydrogen Bond Network In Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1Z93|A Chain A, Human Carbonic Anhydrase Iii:structural And Kinetic Study Of Catalysis And Proton Transfer Length = 266 | Back alignment and structure |
| >pdb|1CNK|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|1CCT|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 | Back alignment and structure |
| >pdb|1G0E|A Chain A, Site-Specific Mutant (His64 Replaced With Ala) Of Human Carbonic Anhydrase Ii Complexed With 4-Methylimidazole Length = 260 | Back alignment and structure |
| >pdb|1HEC|A Chain A, Structural Consequences Of Hydrophilic Amino-Acid Substitutions In The Hydrophobic Pocket Of Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|3M1Q|A Chain A, Carbonic Anhydrase Ii Mutant W5c-H64c With Opened Disulfide Bond Length = 265 | Back alignment and structure |
| >pdb|3KIG|A Chain A, Mutant Carbonic Anhydrase Ii In Complex With An Azide And An Alkyne Length = 265 | Back alignment and structure |
| >pdb|1CAI|A Chain A, Structural Analysis Of The Zinc Hydroxide-Thr 199-Glu 106 Hydrogen Bonding Network In Human Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1CNG|A Chain A, X-Ray Crystallographic Studies Of Engineered Hydrogen Bond Networks In A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|3UYN|A Chain A, Hca 3 Length = 260 | Back alignment and structure |
| >pdb|1H4N|A Chain A, H94n Carbonic Anhydrase Ii Complexed With Tris Length = 259 | Back alignment and structure |
| >pdb|1CCU|A Chain A, Structure-Assisted Redesign Of A Protein-Zinc Binding Site With Femtomolar Affinity Length = 259 | Back alignment and structure |
| >pdb|1G3Z|A Chain A, Carbonic Anhydrase Ii (F131v) Length = 259 | Back alignment and structure |
| >pdb|1YO0|A Chain A, Proton Transfer From His200 In Human Carbonic Anhydrase Ii Length = 260 | Back alignment and structure |
| >pdb|1CVC|A Chain A, Redesigning The Zinc Binding Site Of Human Carbonic Anhydrase Ii: Structure Of A His2asp-Zn2+ Metal Coordination Polyhedron Length = 259 | Back alignment and structure |
| >pdb|2FNK|A Chain A, Activation Of Human Carbonic Anhydrase Ii By Exogenous Proton Donors Length = 260 | Back alignment and structure |
| >pdb|2W2J|A Chain A, Crystal Structure Of The Human Carbonic Anhydrase Related Protein Viii Length = 291 | Back alignment and structure |
| >pdb|2FNN|A Chain A, Activation Of Human Carbonic Anhydrase Ii By Exogenous Proton Donors Length = 260 | Back alignment and structure |
| >pdb|1FLJ|A Chain A, Crystal Structure Of S-Glutathiolated Carbonic Anhydrase Iii Length = 260 | Back alignment and structure |
| >pdb|2FNM|A Chain A, Activation Of Human Carbonic Anhdyrase Ii By Exogenous Proton Donors Length = 260 | Back alignment and structure |
| >pdb|1CVF|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 259 | Back alignment and structure |
| >pdb|1CVH|A Chain A, Structural Consequences Of Redesigning A Protein-Zinc Binding Site Length = 255 | Back alignment and structure |
| >pdb|1CNB|A Chain A, Compensatory Plastic Effects In The Redesign Of Protein- Zinc Binding Sites Length = 259 | Back alignment and structure |
| >pdb|1HVA|A Chain A, Engineering The Zinc Binding Site Of Human Carbonic Anhydrase Ii: Structure Of The His-94-> Cys Apoenzyme In A New Crystalline Form Length = 260 | Back alignment and structure |
| >pdb|1J9W|A Chain A, Solution Structure Of The Cai Michigan 1 Variant Length = 260 | Back alignment and structure |
| >pdb|2FOY|A Chain A, Human Carbonic Anhydrase I Complexed With A Two-Prong Inhibitor Length = 260 | Back alignment and structure |
| >pdb|2IT4|A Chain A, X Ray Structure Of The Complex Between Carbonic Anhydrase I And The Phosphonate Antiviral Drug Foscarnet Length = 256 | Back alignment and structure |
| >pdb|1CRM|A Chain A, Structure And Function Of Carbonic Anhydrases Length = 260 | Back alignment and structure |
| >pdb|1RJ5|A Chain A, Crystal Structure Of The Extracellular Domain Of Murine Carbonic Anhydrase Xiv Length = 261 | Back alignment and structure |
| >pdb|1V9E|A Chain A, Crystal Structure Analysis Of Bovine Carbonic Anhydrase Ii Length = 259 | Back alignment and structure |
| >pdb|1V9I|C Chain C, Crystal Structure Analysis Of The Site Specific Mutant (Q253c) Of Bovine Carbonic Anhydrase Ii Length = 261 | Back alignment and structure |
| >pdb|3IAI|A Chain A, Crystal Structure Of The Catalytic Domain Of The Tumor-Associated Human Carbonic Anhydrase Ix Length = 257 | Back alignment and structure |
| >pdb|1JCZ|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Carbonic Anhydrase Xii Length = 263 | Back alignment and structure |
| >pdb|3JXF|A Chain A, Ca-Like Domain Of Human Ptprz Length = 272 | Back alignment and structure |
| >pdb|3S97|A Chain A, Ptprz Cntn1 Complex Length = 273 | Back alignment and structure |
| >pdb|3FE4|A Chain A, Crystal Structure Of Human Carbonic Anhydrase Vi Length = 278 | Back alignment and structure |
| >pdb|3JXH|C Chain C, Ca-Like Domain Of Human Ptprg Length = 265 | Back alignment and structure |
| >pdb|1ZNC|A Chain A, Human Carbonic Anhydrase Iv Length = 266 | Back alignment and structure |
| >pdb|4E9O|X Chain X, Vaccinia D8l Ectodomain Structure Length = 269 | Back alignment and structure |
| >pdb|2ZNC|A Chain A, Murine Carbonic Anhydrase Iv Length = 258 | Back alignment and structure |
| >pdb|1KOP|A Chain A, Neisseria Gonorrhoeae Carbonic Anhydrase Length = 223 | Back alignment and structure |
| >pdb|1Y7W|A Chain A, Crystal Structure Of A Halotolerant Carbonic Anhydrase From Dunaliella Salina Length = 291 | Back alignment and structure |
| >pdb|3Q31|A Chain A, Structure Of Fungal Alpha Carbonic Anhydrase From Aspergillus Oryzae Length = 244 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| 1keq_A | 248 | F65A/Y131C-MI carbonic anhydrase V; proton transfe | 5e-80 | |
| 3ml5_A | 269 | Carbonic anhydrase 7; protein-inhibitor complex, l | 1e-77 | |
| 3d0n_A | 264 | Carbonic anhydrase 13; lyase, metal-binding, metal | 1e-77 | |
| 2foy_A | 260 | Carbonic anhydrase 1; lyase, zinc, inhibitor, copp | 2e-76 | |
| 3k34_A | 260 | Carbonic anhydrase 2; atomic resolution, sulfonami | 3e-76 | |
| 3fw3_A | 266 | Carbonic anhydrase 4; structure-based drug design. | 1e-75 | |
| 2hfx_A | 260 | Carbonic anhydrase 3; proton shuttle, HCA III, pro | 3e-75 | |
| 1rj5_A | 261 | Carbonic anhydrase XIV; beta-sheet, alpha-helix, z | 3e-73 | |
| 3iai_A | 257 | Carbonic anhydrase 9; transmembrane proteins, cell | 3e-73 | |
| 2znc_A | 258 | Carbonic anhydrase IV; lyase, zinc, murine, membra | 5e-73 | |
| 3jxf_A | 272 | Receptor-type tyrosine-protein phosphatase zeta; C | 1e-72 | |
| 2w2j_A | 291 | Carbonic anhydrase-related protein; lyase, metal-b | 4e-72 | |
| 1jd0_A | 263 | Carbonic anhydrase XII; extracellular domain, bito | 1e-71 | |
| 3jxg_A | 269 | Receptor-type tyrosine-protein phosphatase gamma; | 8e-71 | |
| 3fe4_A | 278 | Carbonic anhydrase 6; secretion, metal binding, st | 2e-70 | |
| 4e9o_X | 269 | D8L antigen, IMV membrane protein; CAH alpha fold, | 1e-66 | |
| 1y7w_A | 291 | Halotolerant alpha-type carbonic anhydrase (DCA I; | 4e-59 | |
| 1kop_A | 223 | Carbonic anhydrase; lyase, structural trimming; 1. | 9e-59 | |
| 3q31_A | 244 | Carbonic anhydrase; glysosy secreted, dimeric, lya | 2e-54 | |
| 3b1b_A | 377 | Carbonic anhydrase 1; N-glycosylation, zinc-finger | 3e-51 |
| >1keq_A F65A/Y131C-MI carbonic anhydrase V; proton transfer, engineered residue, lyase; HET: 4MZ; 1.88A {Mus musculus} SCOP: b.74.1.1 PDB: 1dmx_A 1dmy_A* 1urt_A Length = 248 | Back alignment and structure |
|---|
Score = 240 bits (614), Expect = 5e-80
Identities = 72/248 (29%), Positives = 117/248 (47%), Gaps = 18/248 (7%)
Query: 14 CNKGRRQSPVNLEPSKLLYDPNLRPVHIDKIRINGG-LTNTGHSVVFTVENTTRYHINVT 72
C G RQSP+N++ +YDP L P+ + + L NTG++ +++ ++
Sbjct: 1 CATGTRQSPINIQWKDSVYDPQLAPLRVSYDAASCRYLWNTGYAFQVEFDDSCE-DSGIS 59
Query: 73 GGPLSYKYQFHELHIHYGLQDNMGSEHVINEYVFPAEIQIFGFNSQLYTNFSEALYRAQG 132
GGPL Y+ + H H+G D GSEH ++ + +PAE+ + +NS Y N +A G
Sbjct: 60 GGPLGNHYRLKQFHFHWGATDEWGSEHAVDGHTYPAELHLVHWNSTKYENCKKASVGENG 119
Query: 133 VVAISLLLQF--------PL--------SPGGAVEVKHLSIVGLLPETKYYMTYDGSITM 176
+ I + L+ L V + L+P + Y TY GS+T
Sbjct: 120 LAVIGVFLKLGAHHQALQKLVDVLPEVRHKDTQVAMGPFDPSCLMPACRDYWTYPGSLTT 179
Query: 177 PACYETVTWIIFNKPIYITKQQLHGLRKLMQGDMKHPKAPLGNNYRPPQPLHHRPLRTNI 236
P E+VTWI+ P+ ++ QL R L+ + + NNYRP QPL R LR++
Sbjct: 180 PPLAESVTWIVQKTPVEVSPSQLSMFRTLLFSGRGEEEDVMVNNYRPLQPLRDRKLRSSF 239
Query: 237 DFNTKEIN 244
+ ++
Sbjct: 240 RLDRTKMR 247
|
| >3ml5_A Carbonic anhydrase 7; protein-inhibitor complex, lyase; HET: AZM; 2.05A {Homo sapiens} PDB: 3mdz_A* Length = 269 | Back alignment and structure |
|---|
| >3d0n_A Carbonic anhydrase 13; lyase, metal-binding, metal binding PROT; HET: GOL; 1.55A {Homo sapiens} PDB: 3czv_A* 3da2_A* Length = 264 | Back alignment and structure |
|---|
| >2foy_A Carbonic anhydrase 1; lyase, zinc, inhibitor, copper; HET: B30; 1.55A {Homo sapiens} SCOP: b.74.1.1 PDB: 1bzm_A* 1czm_A* 1azm_A 1hug_A 1huh_A 1hcb_A* 2fw4_A* 2nmx_A* 2nn1_A* 2nn7_A* 3lxe_A* 1jv0_A 1j9w_A 1crm_A 2cab_A 2it4_A Length = 260 | Back alignment and structure |
|---|
| >3k34_A Carbonic anhydrase 2; atomic resolution, sulfonamide inhibitor mutation, lyase, metal-binding, lyase-lyase inhibitor compl; HET: HGB SUA; 0.90A {Homo sapiens} PDB: 1ca3_A* 1cnw_A* 1cny_A* 1eou_A* 1g6v_A 1hca_A 1kwq_A* 1kwr_A* 1t9n_A 1tb0_X 1tbt_X 1te3_X 1teq_X 1teu_X 1cnx_A 1xev_A 1xeg_A 2ax2_A* 2eu3_A* 2ez7_A* ... Length = 260 | Back alignment and structure |
|---|
| >3fw3_A Carbonic anhydrase 4; structure-based drug design. small molecule complex. CO-CRYS membrane, disease mutation, glycoprotein, GPI-anchor; HET: ETS GLC; 1.72A {Homo sapiens} PDB: 1znc_A* 3f7b_A* 3f7u_A* Length = 266 | Back alignment and structure |
|---|
| >1rj5_A Carbonic anhydrase XIV; beta-sheet, alpha-helix, zinc enzyme, lyase; HET: NAG BMA; 2.81A {Mus musculus} SCOP: b.74.1.1 PDB: 1rj6_A* Length = 261 | Back alignment and structure |
|---|
| >3iai_A Carbonic anhydrase 9; transmembrane proteins, cell membrane, projection, disulfide bond, glycoprotein, lyase, membrane, binding, nucleus; HET: AZM NAG BMA MAN; 2.20A {Homo sapiens} Length = 257 | Back alignment and structure |
|---|
| >2znc_A Carbonic anhydrase IV; lyase, zinc, murine, membrane; 2.80A {Mus musculus} SCOP: b.74.1.1 PDB: 3znc_A* Length = 258 | Back alignment and structure |
|---|
| >3jxf_A Receptor-type tyrosine-protein phosphatase zeta; Ca-like domain, alternative splicing, glycoprotein, hydrolase, membrane, polymorphism; 2.00A {Homo sapiens} PDB: 3s97_A* Length = 272 | Back alignment and structure |
|---|
| >2w2j_A Carbonic anhydrase-related protein; lyase, metal-binding; 1.60A {Homo sapiens} Length = 291 | Back alignment and structure |
|---|
| >1jd0_A Carbonic anhydrase XII; extracellular domain, bitopic protein, type I membrane protein, lyase; HET: AZM; 1.50A {Homo sapiens} SCOP: b.74.1.1 PDB: 1jcz_A* Length = 263 | Back alignment and structure |
|---|
| >3fe4_A Carbonic anhydrase 6; secretion, metal binding, structural GEN structural genomics consortium, SGC, glycoprotein, lyase, M binding, secreted; 1.90A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >4e9o_X D8L antigen, IMV membrane protein; CAH alpha fold, VP7 motif, beta sheet, cell surface chondroi binding, viral entry, chondroitin sulfate; 1.42A {Vaccinia virus} PDB: 4etq_X Length = 269 | Back alignment and structure |
|---|
| >1y7w_A Halotolerant alpha-type carbonic anhydrase (DCA I; haltolerant protein, algal Ca anhydrase, salt tolerant protein, zinc enzyme; 1.86A {Dunaliella salina} Length = 291 | Back alignment and structure |
|---|
| >1kop_A Carbonic anhydrase; lyase, structural trimming; 1.90A {Neisseria gonorrhoeae} SCOP: b.74.1.1 PDB: 1koq_A Length = 223 | Back alignment and structure |
|---|
| >3q31_A Carbonic anhydrase; glysosy secreted, dimeric, lyase; HET: NAG; 2.70A {Aspergillus oryzae} Length = 244 | Back alignment and structure |
|---|
| >3b1b_A Carbonic anhydrase 1; N-glycosylation, zinc-finger, lyase; HET: NAG; 1.88A {Chlamydomonas reinhardtii} Length = 377 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| 2foy_A | 260 | Carbonic anhydrase 1; lyase, zinc, inhibitor, copp | 100.0 | |
| 3k34_A | 260 | Carbonic anhydrase 2; atomic resolution, sulfonami | 100.0 | |
| 3d0n_A | 264 | Carbonic anhydrase 13; lyase, metal-binding, metal | 100.0 | |
| 2hfx_A | 260 | Carbonic anhydrase 3; proton shuttle, HCA III, pro | 100.0 | |
| 3ml5_A | 269 | Carbonic anhydrase 7; protein-inhibitor complex, l | 100.0 | |
| 1keq_A | 248 | F65A/Y131C-MI carbonic anhydrase V; proton transfe | 100.0 | |
| 1rj5_A | 261 | Carbonic anhydrase XIV; beta-sheet, alpha-helix, z | 100.0 | |
| 3fw3_A | 266 | Carbonic anhydrase 4; structure-based drug design. | 100.0 | |
| 2w2j_A | 291 | Carbonic anhydrase-related protein; lyase, metal-b | 100.0 | |
| 3jxf_A | 272 | Receptor-type tyrosine-protein phosphatase zeta; C | 100.0 | |
| 3jxg_A | 269 | Receptor-type tyrosine-protein phosphatase gamma; | 100.0 | |
| 1jd0_A | 263 | Carbonic anhydrase XII; extracellular domain, bito | 100.0 | |
| 3fe4_A | 278 | Carbonic anhydrase 6; secretion, metal binding, st | 100.0 | |
| 3iai_A | 257 | Carbonic anhydrase 9; transmembrane proteins, cell | 100.0 | |
| 2znc_A | 258 | Carbonic anhydrase IV; lyase, zinc, murine, membra | 100.0 | |
| 4e9o_X | 269 | D8L antigen, IMV membrane protein; CAH alpha fold, | 100.0 | |
| 1kop_A | 223 | Carbonic anhydrase; lyase, structural trimming; 1. | 100.0 | |
| 3b1b_A | 377 | Carbonic anhydrase 1; N-glycosylation, zinc-finger | 100.0 | |
| 3q31_A | 244 | Carbonic anhydrase; glysosy secreted, dimeric, lya | 100.0 | |
| 1y7w_A | 291 | Halotolerant alpha-type carbonic anhydrase (DCA I; | 100.0 |
| >2foy_A Carbonic anhydrase 1; lyase, zinc, inhibitor, copper; HET: B30; 1.55A {Homo sapiens} SCOP: b.74.1.1 PDB: 1bzm_A* 1czm_A* 1azm_A 1hug_A 1huh_A 1hcb_A* 2fw4_A* 2nmx_A* 2nn1_A* 2nn7_A* 3lxe_A* 1jv0_A 1j9w_A 1crm_A 2cab_A 2it4_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-75 Score=518.27 Aligned_cols=231 Identities=31% Similarity=0.595 Sum_probs=208.5
Q ss_pred CCCcCCcCCCCccCCCCCCCCCceecCCCceecCCCCCeeeeccC-ceeEEEecCceeEEEEcCCCceeEEEeCCCccee
Q psy16207 1 PAFWGLINPEWSLCNKGRRQSPVNLEPSKLLYDPNLRPVHIDKIR-INGGLTNTGHSVVFTVENTTRYHINVTGGPLSYK 79 (258)
Q Consensus 1 P~~W~~l~~~~~~C~~G~~QSPInI~~~~~~~~~~l~~l~~~~~~-~~~~i~N~G~tv~v~~~~~~~~~~~l~gg~l~~~ 79 (258)
|++|+.+ |+.|. |++||||||.+..+.+++.|.+|.|.|.. ...+|.|+||||+|.+.++.. .+.+.||+|..+
T Consensus 13 P~~W~~~---~~~c~-G~~QSPInI~~~~~~~~~~l~~l~~~Y~~~~~~~l~N~Ghtv~v~~~~~~~-~~~i~gG~L~~~ 87 (260)
T 2foy_A 13 PEQWSKL---YPIAN-GNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDN-RSVLKGGPFSDS 87 (260)
T ss_dssp GGGGGGT---CGGGG-SSSCSCCEECTTSCEECTTCCCEEEECCGGGEEEEEECSSCEEEEECCSSS-SSEEEETTCSSC
T ss_pred hhhhccc---ccCCC-CCeeCCEeEccCceeEcCCCcCeeeeecCCcceEEEeCCcEEEEEeCCCCc-ceEEeCCCCCce
Confidence 6789885 56795 99999999999888888889899999874 567999999999999976532 357889999999
Q ss_pred eeeEEEEEEecCCCCCCCceeecceecceeEEEEeecccccCCHHHHhhccCceeEEEEEEEcc----------------
Q psy16207 80 YQFHELHIHYGLQDNMGSEHVINEYVFPAEIQIFGFNSQLYTNFSEALYRAQGVVAISLLLQFP---------------- 143 (258)
Q Consensus 80 Y~l~q~HfHwG~~~~~gSEH~i~G~~~~~E~H~Vh~~~~~y~~~~eA~~~~~g~~vlav~~~~~---------------- 143 (258)
|+|.|||||||+.+..||||+|||++|||||||||++.++|.+++||+.+++|+|||||||++|
T Consensus 88 Y~l~Q~HfHWG~~~~~gSEHtidg~~~p~ElHlVH~n~~~y~~~~eA~~~~~glaVlgv~~~~g~~n~~l~~i~~~l~~i 167 (260)
T 2foy_A 88 YRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAI 167 (260)
T ss_dssp EEEEEEEEEECSSTTCCCSSEETTBCCSEEEEEEEEETTTCSSHHHHTTSTTSEEEEEEEEEESSCCGGGHHHHHHGGGS
T ss_pred EEEEEEEEecCCCCCCCCccccccccCCceeEEEEecccccCCHHHHhhCCCceEEEEEEEEccccchhHHHHHHHHHhc
Confidence 9999999999999999999999999999999999999889999999999999999999999998
Q ss_pred CCCCCeeEecccCccccCCCCCCcEEEeccccCCCCccceEEeeeceeeecCHHHHHHHHHhhcCCCCCCCCCCCCCCCC
Q psy16207 144 LSPGGAVEVKHLSIVGLLPETKYYMTYDGSITMPACYETVTWIIFNKPIYITKQQLHGLRKLMQGDMKHPKAPLGNNYRP 223 (258)
Q Consensus 144 ~~~g~~~~~~~~~l~~Llp~~~~yy~Y~GSLTtPPCtE~V~WiV~~~p~~Is~~Ql~~fr~l~~~~~~~~~~~~~~N~Rp 223 (258)
..+|+.+.+..|++.+|||...+||+|.||||||||+|+|+|+||++|+.||.+||++||+++....++...++.+|+||
T Consensus 168 ~~~g~~~~~~~~~l~~Llp~~~~yy~Y~GSLTTPPC~E~V~W~V~~~pi~iS~~Ql~~fr~l~~~~~~~~~~~~~~N~Rp 247 (260)
T 2foy_A 168 KTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRP 247 (260)
T ss_dssp CSTTCEEECCSCCGGGGSCSCCCEEEEEECCSSTTCCSCEEEEEESSCEEECHHHHHHHHTSBSSCTTSCCCBCCCCCCC
T ss_pred cCCCCeeEccccCHHHhCCCCCceEEEecCCCCCCCCCCeeEEEeccceecCHHHHHHHHHhhhccccccccccCCCCCC
Confidence 24567777888999999999999999999999999999999999999999999999999999876555555678999999
Q ss_pred CCCCCCCeEEEee
Q psy16207 224 PQPLHHRPLRTNI 236 (258)
Q Consensus 224 ~Qpln~R~V~~~~ 236 (258)
+||||||.|+.||
T Consensus 248 ~Qpln~R~V~~sf 260 (260)
T 2foy_A 248 TQPLKGRTVRASF 260 (260)
T ss_dssp CCCCTTCCCEECC
T ss_pred CCcCCCceEEeCC
Confidence 9999999999886
|
| >3k34_A Carbonic anhydrase 2; atomic resolution, sulfonamide inhibitor mutation, lyase, metal-binding, lyase-lyase inhibitor compl; HET: HGB SUA; 0.90A {Homo sapiens} SCOP: b.74.1.1 PDB: 1ca3_A* 1cnw_A* 1cny_A* 1eou_A* 1g6v_A 1hca_A 1kwq_A* 1kwr_A* 1t9n_A 1tb0_X 1tbt_X 1te3_X 1teq_X 1teu_X 1cnx_A 1xev_A 1xeg_A 2ax2_A* 2eu3_A* 2ez7_A* ... | Back alignment and structure |
|---|
| >3d0n_A Carbonic anhydrase 13; lyase, metal-binding, metal binding PROT; HET: GOL; 1.55A {Homo sapiens} PDB: 3czv_A* 3da2_A* | Back alignment and structure |
|---|
| >3ml5_A Carbonic anhydrase 7; protein-inhibitor complex, lyase; HET: AZM; 2.05A {Homo sapiens} SCOP: b.74.1.1 PDB: 3mdz_A* | Back alignment and structure |
|---|
| >1keq_A F65A/Y131C-MI carbonic anhydrase V; proton transfer, engineered residue, lyase; HET: 4MZ; 1.88A {Mus musculus} SCOP: b.74.1.1 PDB: 1dmx_A 1dmy_A* 1urt_A | Back alignment and structure |
|---|
| >1rj5_A Carbonic anhydrase XIV; beta-sheet, alpha-helix, zinc enzyme, lyase; HET: NAG BMA; 2.81A {Mus musculus} SCOP: b.74.1.1 PDB: 1rj6_A* | Back alignment and structure |
|---|
| >3fw3_A Carbonic anhydrase 4; structure-based drug design. small molecule complex. CO-CRYS membrane, disease mutation, glycoprotein, GPI-anchor; HET: ETS GLC; 1.72A {Homo sapiens} SCOP: b.74.1.1 PDB: 1znc_A* 3f7b_A* 3f7u_A* | Back alignment and structure |
|---|
| >2w2j_A Carbonic anhydrase-related protein; lyase, metal-binding; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3jxf_A Receptor-type tyrosine-protein phosphatase zeta; Ca-like domain, alternative splicing, glycoprotein, hydrolase, membrane, polymorphism; 2.00A {Homo sapiens} SCOP: b.74.1.0 PDB: 3s97_A* | Back alignment and structure |
|---|
| >1jd0_A Carbonic anhydrase XII; extracellular domain, bitopic protein, type I membrane protein, lyase; HET: AZM; 1.50A {Homo sapiens} SCOP: b.74.1.1 PDB: 1jcz_A* | Back alignment and structure |
|---|
| >3fe4_A Carbonic anhydrase 6; secretion, metal binding, structural GEN structural genomics consortium, SGC, glycoprotein, lyase, M binding, secreted; 1.90A {Homo sapiens} SCOP: b.74.1.0 | Back alignment and structure |
|---|
| >3iai_A Carbonic anhydrase 9; transmembrane proteins, cell membrane, projection, disulfide bond, glycoprotein, lyase, membrane, binding, nucleus; HET: AZM NAG BMA MAN; 2.20A {Homo sapiens} SCOP: b.74.1.0 | Back alignment and structure |
|---|
| >2znc_A Carbonic anhydrase IV; lyase, zinc, murine, membrane; 2.80A {Mus musculus} SCOP: b.74.1.1 PDB: 3znc_A* | Back alignment and structure |
|---|
| >4e9o_X D8L antigen, IMV membrane protein; CAH alpha fold, VP7 motif, beta sheet, cell surface chondroi binding, viral entry, chondroitin sulfate; 1.42A {Vaccinia virus} PDB: 4etq_X | Back alignment and structure |
|---|
| >1kop_A Carbonic anhydrase; lyase, structural trimming; 1.90A {Neisseria gonorrhoeae} SCOP: b.74.1.1 PDB: 1koq_A | Back alignment and structure |
|---|
| >3b1b_A Carbonic anhydrase 1; N-glycosylation, zinc-finger, lyase; HET: NAG; 1.88A {Chlamydomonas reinhardtii} | Back alignment and structure |
|---|
| >3q31_A Carbonic anhydrase; glysosy secreted, dimeric, lyase; HET: NAG; 2.70A {Aspergillus oryzae} | Back alignment and structure |
|---|
| >1y7w_A Halotolerant alpha-type carbonic anhydrase (DCA I; haltolerant protein, algal Ca anhydrase, salt tolerant protein, zinc enzyme; 1.86A {Dunaliella salina} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 258 | ||||
| d1hcba_ | 258 | b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi | 3e-63 | |
| d1flja_ | 259 | b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norv | 2e-61 | |
| d1luga_ | 259 | b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi | 4e-59 | |
| d1keqa_ | 238 | b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu | 2e-58 | |
| d1rj6a_ | 259 | b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu | 5e-58 | |
| d1znca_ | 262 | b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi | 7e-56 | |
| d2znca_ | 258 | b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus muscu | 8e-52 | |
| d1jd0a_ | 260 | b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapi | 3e-51 | |
| d1kopa_ | 223 | b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorr | 3e-42 |
| >d1hcba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Carbonic anhydrase superfamily: Carbonic anhydrase family: Carbonic anhydrase domain: Carbonic anhydrase species: Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]
Score = 196 bits (499), Expect = 3e-63
Identities = 73/252 (28%), Positives = 118/252 (46%), Gaps = 22/252 (8%)
Query: 1 PAFWGLINPEWSLCNKGRRQSPVNLEPSKLLYDPNLRPVHIDKIRINGG-LTNTGHSVVF 59
P W + P G QSPV+++ S+ +D +L+P+ + + N GHS
Sbjct: 11 PEQWSKLYP----IANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHV 66
Query: 60 TVENTTRYHINVTGGPLSYKYQFHELHIHYGLQDNMGSEHVINEYVFPAEIQIFGFNSQL 119
E+ + + GGP S Y+ + H H+G + GSEH ++ + AE+ + +NS
Sbjct: 67 NFEDNDNRSV-LKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAK 125
Query: 120 YTNFSEALYRAQGVVAISLL----------------LQFPLSPGGAVEVKHLSIVGLLPE 163
Y++ +EA +A G+ I +L LQ + G + LLP
Sbjct: 126 YSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPS 185
Query: 164 TKYYMTYDGSITMPACYETVTWIIFNKPIYITKQQLHGLRKLMQGDMKHPKAPLGNNYRP 223
+ + TY GS+T P YE+VTWII + I ++ +QL R L+ P+ +N RP
Sbjct: 186 SLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRP 245
Query: 224 PQPLHHRPLRTN 235
QPL R +R +
Sbjct: 246 TQPLKGRTVRAS 257
|
| >d1flja_ b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norvegicus), isozyme III [TaxId: 10116]} Length = 259 | Back information, alignment and structure |
|---|
| >d1luga_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]} Length = 259 | Back information, alignment and structure |
|---|
| >d1keqa_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]} Length = 238 | Back information, alignment and structure |
|---|
| >d1rj6a_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]} Length = 259 | Back information, alignment and structure |
|---|
| >d1znca_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d2znca_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme IV [TaxId: 10090]} Length = 258 | Back information, alignment and structure |
|---|
| >d1jd0a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme XII [TaxId: 9606]} Length = 260 | Back information, alignment and structure |
|---|
| >d1kopa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]} Length = 223 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| d1flja_ | 259 | Carbonic anhydrase {Rat (Rattus norvegicus), isozy | 100.0 | |
| d1hcba_ | 258 | Carbonic anhydrase {Human (Homo sapiens), erythroc | 100.0 | |
| d1luga_ | 259 | Carbonic anhydrase {Human (Homo sapiens), erythroc | 100.0 | |
| d1rj6a_ | 259 | Carbonic anhydrase {Mouse (Mus musculus), isozyme | 100.0 | |
| d1znca_ | 262 | Carbonic anhydrase {Human (Homo sapiens), isozyme | 100.0 | |
| d1keqa_ | 238 | Carbonic anhydrase {Mouse (Mus musculus), liver, i | 100.0 | |
| d1jd0a_ | 260 | Carbonic anhydrase {Human (Homo sapiens), isozyme | 100.0 | |
| d2znca_ | 258 | Carbonic anhydrase {Mouse (Mus musculus), isozyme | 100.0 | |
| d1kopa_ | 223 | Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: | 100.0 |
| >d1flja_ b.74.1.1 (A:) Carbonic anhydrase {Rat (Rattus norvegicus), isozyme III [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Carbonic anhydrase superfamily: Carbonic anhydrase family: Carbonic anhydrase domain: Carbonic anhydrase species: Rat (Rattus norvegicus), isozyme III [TaxId: 10116]
Probab=100.00 E-value=8.4e-71 Score=485.00 Aligned_cols=230 Identities=30% Similarity=0.630 Sum_probs=205.9
Q ss_pred CCCcCCcCCCCccCCCCCCCCCceecCCCceecCCCCCeeeeccC-ceeEEEecCceeEEEEcCCCceeEEEeCCCccee
Q psy16207 1 PAFWGLINPEWSLCNKGRRQSPVNLEPSKLLYDPNLRPVHIDKIR-INGGLTNTGHSVVFTVENTTRYHINVTGGPLSYK 79 (258)
Q Consensus 1 P~~W~~l~~~~~~C~~G~~QSPInI~~~~~~~~~~l~~l~~~~~~-~~~~i~N~G~tv~v~~~~~~~~~~~l~gg~l~~~ 79 (258)
|++|+.+. + |.+|++||||||.+..+...+.+.++.+.|.. ...++.|+||+++|.+++... .+.+.||++..+
T Consensus 12 P~~W~~~~---~-c~~G~~QSPInI~~~~~~~~~~l~~l~~~y~~~~~~~l~N~G~t~~~~~~~~~~-~~~~~gg~l~~~ 86 (259)
T d1flja_ 12 PEHWHELY---P-IAKGDNQSPIELHTKDIRHDPSLQPWSVSYDPGSAKTILNNGKTCRVVFDDTFD-RSMLRGGPLSGP 86 (259)
T ss_dssp GGGGGGTC---G-GGGSSSCSCCEECGGGEEECTTCCCEEEECCGGGEEEEEECSSCEEEEECCSSS-SSEEEETTCSSC
T ss_pred hhHhcccc---c-CCCCCccCCEeECcCceeECCCCCceeeeccCCCceEEEecCeEEEEEEcCCCC-eeEEecCccccc
Confidence 67888764 3 44499999999999888888888889998865 467899999999999976533 357889999999
Q ss_pred eeeEEEEEEecCCCCCCCceeecceecceeEEEEeecccccCCHHHHhhccCceeEEEEEEEcc----------------
Q psy16207 80 YQFHELHIHYGLQDNMGSEHVINEYVFPAEIQIFGFNSQLYTNFSEALYRAQGVVAISLLLQFP---------------- 143 (258)
Q Consensus 80 Y~l~q~HfHwG~~~~~gSEH~i~G~~~~~E~H~Vh~~~~~y~~~~eA~~~~~g~~vlav~~~~~---------------- 143 (258)
|.|.|||||||+.+..||||+|||++|||||||||++. .|.++.+|++.++++||++|||+++
T Consensus 87 Y~l~q~hfHwG~~~~~gSEH~idG~~~~~E~h~VH~n~-~~~~~~~a~~~~~~lav~~v~~~~~~~n~~~~~i~~~l~~i 165 (259)
T d1flja_ 87 YRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNP-KYNTFGEALKQPDGIAVVGIFLKIGREKGEFQILLDALDKI 165 (259)
T ss_dssp EEEEEEEEEECSSTTCCCSSEETTBCCSEEEEEEEECG-GGSSHHHHTTSTTSEEEEEEEEEESSCCHHHHHHHHHGGGG
T ss_pred eeeEEEEEEeCCCCCCCcceeECCEecCCceEEEEecC-CCCCHHHHhcCCCCcEEEEEEEecCCcchHHHHHHHHHHhh
Confidence 99999999999999999999999999999999999986 7999999999999999999999998
Q ss_pred CCCCCeeEecccCccccCCCCCCcEEEeccccCCCCccceEEeeeceeeecCHHHHHHHHHhhcCCCCCCCCCCCCCCCC
Q psy16207 144 LSPGGAVEVKHLSIVGLLPETKYYMTYDGSITMPACYETVTWIIFNKPIYITKQQLHGLRKLMQGDMKHPKAPLGNNYRP 223 (258)
Q Consensus 144 ~~~g~~~~~~~~~l~~Llp~~~~yy~Y~GSLTtPPCtE~V~WiV~~~p~~Is~~Ql~~fr~l~~~~~~~~~~~~~~N~Rp 223 (258)
..++....+..|+|..|+|...+||+|.||||||||+|+|+|+||++|+.||++||++||+++....+..+.++.+|+||
T Consensus 166 ~~~~~~~~~~~~~l~~llp~~~~yy~Y~GSLTtPPC~E~V~W~V~~~p~~IS~~Ql~~fr~l~~~~~~~~~~~~~~N~Rp 245 (259)
T d1flja_ 166 KTKGKEAPFNHFDPSCLFPACRDYWTYHGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLFASAENEPPVPLVGNWRP 245 (259)
T ss_dssp CSTTCEEECCSCCGGGGCCSCCCEEEEEECCSSTTCCSCEEEEEESSCEEECHHHHHHHTTCBSSCTTSCCCBCCCCCCC
T ss_pred hccCceeccCCCCHHHhCcCCCccEEEeCccCCCCCCCCeEEEEeceeeeeCHHHHHHHHHHhhcccCcccccccCCCcC
Confidence 23456667778999999999999999999999999999999999999999999999999999887666666778999999
Q ss_pred CCCCCCCeEEEee
Q psy16207 224 PQPLHHRPLRTNI 236 (258)
Q Consensus 224 ~Qpln~R~V~~~~ 236 (258)
+||||||.|+.||
T Consensus 246 ~Q~ln~R~V~~sf 258 (259)
T d1flja_ 246 PQPIKGRVVRASF 258 (259)
T ss_dssp CCCCCSCCEEESC
T ss_pred CCCCCCCEEeccc
Confidence 9999999999997
|
| >d1hcba_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme I [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luga_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rj6a_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme XIV [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1znca_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme IV [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1keqa_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), liver, isozyme V [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jd0a_ b.74.1.1 (A:) Carbonic anhydrase {Human (Homo sapiens), isozyme XII [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2znca_ b.74.1.1 (A:) Carbonic anhydrase {Mouse (Mus musculus), isozyme IV [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kopa_ b.74.1.1 (A:) Carbonic anhydrase {Neisseria gonorrhoeae [TaxId: 485]} | Back information, alignment and structure |
|---|