Psyllid ID: psy16225


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290
MDSPATMGIKMTPPPTTSPHNHMMPLPGNNIKMINTFMETPTLASMGIKMSPPPPTSPHQLQSGGNHMMPLGGNNENHHNNHYNSYPMPHMQTGYSRDYLLRRDDYANNIHHPPPVPPPPVQPPGNDMFFHHPVDPLSQHSMLYHHHHREPVYSNMDLNAAYPSTNAMQSAGTHGAFFRYMRQPIKQDMTCLWIDTPGPRKTCGKMFNNMHEIVTHLTVEHVGGPECTTHACFWDGCPRNGRPFKAKYKLVNHIRVHTGEKPFPCPFPTCGKVFARSENLKIHKRTHTEV
cccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccc
ccccccccEEccccccccccccccccccccccEccccccccccccccHHcccccccccccccccccEcccccHcccEcccccccccccccccccccccHHHHHHccccccccccccccccccccccccHEEcccccccccccEcccccccccccccEEEEEccccccccccccccccccccccHEEEEEEEccccccccccccccccccccHHHHHHcccccccccccccccccccccccccEEccHHHHHHHHHHccccccEEccccccccEEccHHHHHHHHHHHHcc
mdspatmgikmtpppttsphnhmmplpgnniKMINTFmetptlasmgikmspppptsphqlqsggnhmmplggnnenhhnnhynsypmphmqtgysrdyllrrddyannihhpppvppppvqppgndmffhhpvdplsqhsmlyhhhhrepvysnmdlnaaypstnamqsagthgAFFRYMrqpikqdmtclwidtpgprktcgkMFNNMHEIVTHLTvehvggpectthacfwdgcprngrpfkakYKLVNHIRvhtgekpfpcpfptcgkvfarsenlkihkrthtev
mdspatmgikmtpppttsphnhMMPLPGNNIKMINTFMETPTLASMGIKMSPPPPTSPHQLQSGGNHMMPLGGNNENHHNNHYNSYPMPHMQTGYSRDYLLRRDDYANNIHHPPPVPPPPVQPPGNDMFFHHPVDPLSQHSMLYHHHHREPVYSNMDLNAAYPSTNAMQSAGTHGAFFRYMRQPIKQDMTCLWIDTPGPRKTCGKMFNNMHEIVTHLTVEHVGGPECTTHACFWDGCPRNGRPFKAKYKLVNHIRVHtgekpfpcpfptCGKVfarsenlkihkrthtev
MDSPATMGIKMTPPPTTSPHNHMMPLPGNNIKMINTFMETPTLASMGIKMSPPPPTSPHQLQSGGNHMMPLGGnnenhhnnhynSYPMPHMQTGYSRDYLLRRDDYANNIHHpppvppppvqppGNDMFFHHPVDPLSQHSMLYHHHHREPVYSNMDLNAAYPSTNAMQSAGTHGAFFRYMRQPIKQDMTCLWIDTPGPRKTCGKMFNNMHEIVTHLTVEHVGGPECTTHACFWDGCPRNGRPFKAKYKLVNHIRVHTGEKPFPCPFPTCGKVFARSENLKIHKRTHTEV
*************************************************************************************************DYLLR**********************************************************************THGAFFRYMRQPIKQDMTCLWIDTPGPRKTCGKMFNNMHEIVTHLTVEHVGGPECTTHACFWDGCPRNGRPFKAKYKLVNHIRVHTGEKPFPCPFPTCGKVFARS*************
*****************************************************************************************************************************************************************************************KQDMTCLWIDTPGPRKTCGKMFNNMHEIVTHLTVEHVGGPECTTHACFWDGCPRNGRPFKAKYKLVNHIRVHTGEKPFPCPFPTCGKVFARSENLKIHKRTHT**
********IKMTPPPTTSPHNHMMPLPGNNIKMINTFMETPTLASMGIKM************SGGNHMMPLGGNNENHHNNHYNSYPMPHMQTGYSRDYLLRRDDYANNIHHPPPVPPPPVQPPGNDMFFHHPVDPLSQHSMLYHHHHREPVYSNMDLNAAYPSTNAMQSAGTHGAFFRYMRQPIKQDMTCLWIDTPGPRKTCGKMFNNMHEIVTHLTVEHVGGPECTTHACFWDGCPRNGRPFKAKYKLVNHIRVHTGEKPFPCPFPTCGKVFARSENLKI********
*******GIKMTPPPTTSPHNHMMPLPGNNIKMINTFMET*****************PHQLQSGGNHMMPLGGNNENHHNNHYNSYPMPHMQTGYSRDYLLRRDDYANNIHHPPPVPPPPVQPPGNDMFFHHPVDPLSQHSMLYHHHHREPVYSNMDLNAAYPSTNAMQSAGTHGAFFRYMRQPIKQDMTCLWIDTPGPRKTCGKMFNNMHEIVTHLTVEHVGGPECTTHACFWDGCPRNGRPFKAKYKLVNHIRVHTGEKPFPCPFPTCGKVFARSENLKIHKRTHT**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSPATMGIKMTPPPTTSPHNHMMPLPGNNIKMINTFMETPTLASMGIKMSPPPPTSPHQLQSGGNHMMPLGGNNENHHNNHYNSYPMPHMQTGYSRDYLLRRDDYANNIHHPPPVPPPPVQPPGNDMFFHHPVDPLSQHSMLYHHHHREPVYSNMDLNAAYPSTNAMQSAGTHGAFFRYMRQPIKQDMTCLWIDTPGPRKTCGKMFNNMHEIVTHLTVEHVGGPECTTHACFWDGCPRNGRPFKAKYKLVNHIRVHTGEKPFPCPFPTCGKVFARSENLKIHKRTHTEV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query290 2.2.26 [Sep-21-2011]
P39768 609 Pair-rule protein odd-pai yes N/A 0.427 0.203 0.741 1e-52
Q8JJC0 444 Zinc finger protein ZIC 1 yes N/A 0.393 0.256 0.760 1e-51
P46684 447 Zinc finger protein ZIC 1 yes N/A 0.393 0.255 0.760 4e-51
Q15915 447 Zinc finger protein ZIC 1 yes N/A 0.393 0.255 0.760 4e-51
O73689 443 Zinc finger protein ZIC 1 N/A N/A 0.482 0.316 0.643 1e-50
A0JC51 530 Zinc finger protein ZIC 4 N/A N/A 0.393 0.215 0.765 6e-50
Q91689 503 Zinc finger protein ZIC 2 N/A N/A 0.393 0.226 0.754 1e-49
Q6DJQ6 441 Zinc finger protein ZIC 3 no N/A 0.393 0.258 0.726 1e-49
O57311 441 Zinc finger protein ZIC 3 N/A N/A 0.393 0.258 0.717 3e-49
O95409 532 Zinc finger protein ZIC 2 no N/A 0.393 0.214 0.745 4e-49
>sp|P39768|OPA_DROME Pair-rule protein odd-paired OS=Drosophila melanogaster GN=opa PE=2 SV=2 Back     alignment and function desciption
 Score =  206 bits (524), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 110/139 (79%), Gaps = 15/139 (10%)

Query: 164 STNAMQSAGTHGAFFRYMR-QP------IKQDMTCLWIDT-------PGPRKTCGKMFNN 209
           + +AM  AG  GAF RYMR QP      +KQ+M CLWID        PG RKTC K+F++
Sbjct: 179 AMSAMHPAGA-GAFLRYMRHQPASSASSVKQEMQCLWIDPDQPGLVPPGGRKTCNKVFHS 237

Query: 210 MHEIVTHLTVEHVGGPECTTHACFWDGCPRNGRPFKAKYKLVNHIRVHTGEKPFPCPFPT 269
           MHEIVTHLTVEHVGGPECTTHACFW GC RNGRPFKAKYKLVNHIRVHTGEKPF CP P 
Sbjct: 238 MHEIVTHLTVEHVGGPECTTHACFWVGCSRNGRPFKAKYKLVNHIRVHTGEKPFACPHPG 297

Query: 270 CGKVFARSENLKIHKRTHT 288
           CGKVFARSENLKIHKRTHT
Sbjct: 298 CGKVFARSENLKIHKRTHT 316




Transcription factor essential for parasegmental subdivision of the embryo. It is involved in the activation of wingless (wg) in odd parasegments. It is also required for the timely activation of wg in the remaining parasegments and for the timely activation of engrailed (en) in all parasegments.
Drosophila melanogaster (taxid: 7227)
>sp|Q8JJC0|ZIC1_CHICK Zinc finger protein ZIC 1 OS=Gallus gallus GN=ZIC1 PE=1 SV=1 Back     alignment and function description
>sp|P46684|ZIC1_MOUSE Zinc finger protein ZIC 1 OS=Mus musculus GN=Zic1 PE=1 SV=2 Back     alignment and function description
>sp|Q15915|ZIC1_HUMAN Zinc finger protein ZIC 1 OS=Homo sapiens GN=ZIC1 PE=2 SV=2 Back     alignment and function description
>sp|O73689|ZIC1_XENLA Zinc finger protein ZIC 1 OS=Xenopus laevis GN=zic1 PE=2 SV=1 Back     alignment and function description
>sp|A0JC51|ZIC4_XENLA Zinc finger protein ZIC 4 OS=Xenopus laevis GN=zic4 PE=2 SV=1 Back     alignment and function description
>sp|Q91689|ZIC2A_XENLA Zinc finger protein ZIC 2-A OS=Xenopus laevis GN=zic2-a PE=2 SV=2 Back     alignment and function description
>sp|Q6DJQ6|ZIC3_XENTR Zinc finger protein ZIC 3 OS=Xenopus tropicalis GN=zic3 PE=2 SV=1 Back     alignment and function description
>sp|O57311|ZIC3_XENLA Zinc finger protein ZIC 3 OS=Xenopus laevis GN=zic3 PE=2 SV=3 Back     alignment and function description
>sp|O95409|ZIC2_HUMAN Zinc finger protein ZIC 2 OS=Homo sapiens GN=ZIC2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
189242314 401 PREDICTED: similar to zinc finger protei 0.793 0.573 0.550 1e-62
270015215377 hypothetical protein TcasGA2_TC010234 [T 0.793 0.610 0.550 2e-62
157117837333 pair-rule protein odd-paired [Aedes aegy 0.851 0.741 0.446 7e-57
242013026 473 zinc finger protein ZIC, putative [Pedic 0.396 0.243 0.871 4e-56
170069405340 pair-rule protein odd-paired [Culex quin 0.872 0.744 0.440 1e-55
321458947 496 putative transcription factor odd-paired 0.393 0.229 0.844 1e-54
94966314 451 zinc finger protein Pi-Zic [Pandinus imp 0.393 0.252 0.853 4e-54
94966312331 zinc finger protein Pi-Zic [Pandinus imp 0.393 0.344 0.853 9e-54
260796277 503 zic family member [Branchiostoma florida 0.817 0.471 0.469 6e-53
94966318 460 zinc finger protein Af-Zic [Artemia fran 0.393 0.247 0.827 7e-53
>gi|189242314|ref|XP_968410.2| PREDICTED: similar to zinc finger protein Pi-Zic [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  245 bits (626), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 167/265 (63%), Gaps = 35/265 (13%)

Query: 33  MINTFMETPT---LASMGIKMSPPPPTSPHQLQSGGNHMMPLGGNNENHHNNHYNSYPMP 89
           MIN FM+T     LAS G+KMSP      HQ Q+     MP    ++NHH  +Y    M 
Sbjct: 25  MINAFMDTGHHHHLASYGLKMSPG-----HQAQTPAA-AMP--APDQNHHFQNYGH--MG 74

Query: 90  HMQTGYSRDYLLRRDDYANNIHHPPPVPPPPVQPPGNDMFFHHPVDPLSQHSMLYHHHHR 149
           HM    +RD+LLRR+D+            PP   P   + FHH  D    H   +     
Sbjct: 75  HMGGYAARDFLLRREDF------------PPQTAPSEPVLFHHHGDVPQHHLPHH----H 118

Query: 150 EPVYSNMDL----NAAYPSTNAMQSAGTHGAFFRYMRQPIKQDMTCLWID--TPGPRKTC 203
           + +YS  D        Y +   + +  +HGAFFRYMRQPIKQ+M CLW+D   P PRK C
Sbjct: 119 QMLYSRPDAYHQPQHQYLNPMGVPAHHSHGAFFRYMRQPIKQEMQCLWVDPEQPPPRKIC 178

Query: 204 GKMFNNMHEIVTHLTVEHVGGPECTTHACFWDGCPRNGRPFKAKYKLVNHIRVHTGEKPF 263
            K F +MHEIVTHLTVEHVGGPECTTHACFW  C RNGRPFKAKYKLVNHIRVHTGEKPF
Sbjct: 179 AKHFTSMHEIVTHLTVEHVGGPECTTHACFWQNCSRNGRPFKAKYKLVNHIRVHTGEKPF 238

Query: 264 PCPFPTCGKVFARSENLKIHKRTHT 288
           PCPFP CGKVFARSENLKIHKRTHT
Sbjct: 239 PCPFPGCGKVFARSENLKIHKRTHT 263




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270015215|gb|EFA11663.1| hypothetical protein TcasGA2_TC010234 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157117837|ref|XP_001653060.1| pair-rule protein odd-paired [Aedes aegypti] gi|108883324|gb|EAT47549.1| AAEL001344-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|242013026|ref|XP_002427222.1| zinc finger protein ZIC, putative [Pediculus humanus corporis] gi|212511526|gb|EEB14484.1| zinc finger protein ZIC, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|170069405|ref|XP_001869216.1| pair-rule protein odd-paired [Culex quinquefasciatus] gi|167865284|gb|EDS28667.1| pair-rule protein odd-paired [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|321458947|gb|EFX70006.1| putative transcription factor odd-paired [Daphnia pulex] Back     alignment and taxonomy information
>gi|94966314|dbj|BAE94138.1| zinc finger protein Pi-Zic [Pandinus imperator] Back     alignment and taxonomy information
>gi|94966312|dbj|BAE94137.1| zinc finger protein Pi-Zic [Pandinus imperator] Back     alignment and taxonomy information
>gi|260796277|ref|XP_002593131.1| zic family member [Branchiostoma floridae] gi|94966289|dbj|BAE94124.1| zinc finger protein AmphiZic [Branchiostoma floridae] gi|229278355|gb|EEN49142.1| zic family member [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|94966318|dbj|BAE94140.1| zinc finger protein Af-Zic [Artemia franciscana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
FB|FBgn0003002 609 opa "odd paired" [Drosophila m 0.496 0.236 0.666 2.5e-59
ZFIN|ZDB-GENE-040622-1 497 zic5 "zic family member 5 (odd 0.493 0.287 0.64 2e-55
UNIPROTKB|Q96T25 663 ZIC5 "Zinc finger protein ZIC 0.313 0.137 0.780 9.1e-55
UNIPROTKB|Q9IB89 515 zic5 "Zinc finger protein ZIC 0.465 0.262 0.638 1.1e-54
UNIPROTKB|J9P7C3308 ZIC5 "Uncharacterized protein" 0.320 0.301 0.763 9.7e-53
UNIPROTKB|E2R5V7423 ZIC2 "Uncharacterized protein" 0.520 0.356 0.613 1.4e-52
UNIPROTKB|F1RP23 632 ZIC5 "Uncharacterized protein" 0.489 0.224 0.585 2.5e-52
MGI|MGI:106679 530 Zic2 "zinc finger protein of t 0.520 0.284 0.613 2.9e-52
UNIPROTKB|E2R5V9 669 ZIC5 "Uncharacterized protein" 0.313 0.136 0.780 4e-52
ZFIN|ZDB-GENE-040622-4 530 zic4 "zic family member 4" [Da 0.455 0.249 0.664 7.7e-52
FB|FBgn0003002 opa "odd paired" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 545 (196.9 bits), Expect = 2.5e-59, Sum P(3) = 2.5e-59
 Identities = 108/162 (66%), Positives = 121/162 (74%)

Query:   144 YHHHHREP---VYSNMDLNAAYPSTNAMQSAGTHGAFFRYMR-QP------IKQDMTCLW 193
             Y+HH   P   V+  +  + ++ + +AM  AG  GAF RYMR QP      +KQ+M CLW
Sbjct:   156 YNHHGNFPTAAVHHPVVHHPSHHAMSAMHPAGA-GAFLRYMRHQPASSASSVKQEMQCLW 214

Query:   194 IDT-------PGPRKTCGKMFNNMHEIVTHLTVEHVGGPECTTHACFWDGCPRNGRPFKA 246
             ID        PG RKTC K+F++MHEIVTHLTVEHVGGPECTTHACFW GC RNGRPFKA
Sbjct:   215 IDPDQPGLVPPGGRKTCNKVFHSMHEIVTHLTVEHVGGPECTTHACFWVGCSRNGRPFKA 274

Query:   247 KYKLVNHIRVHTGEKPFPCPFPTCGKVFARSENLKIHKRTHT 288
             KYKLVNHIRVHTGEKPF CP P CGKVFARSENLKIHKRTHT
Sbjct:   275 KYKLVNHIRVHTGEKPFACPHPGCGKVFARSENLKIHKRTHT 316


GO:0005634 "nucleus" evidence=ISS;NAS;IDA
GO:0007494 "midgut development" evidence=IEP;IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0008354 "germ cell migration" evidence=IMP
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=ISS
GO:0007365 "periodic partitioning" evidence=NAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0007455 "eye-antennal disc morphogenesis" evidence=IMP
GO:0008101 "decapentaplegic signaling pathway" evidence=IMP
ZFIN|ZDB-GENE-040622-1 zic5 "zic family member 5 (odd-paired homolog, Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q96T25 ZIC5 "Zinc finger protein ZIC 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9IB89 zic5 "Zinc finger protein ZIC 5" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7C3 ZIC5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5V7 ZIC2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RP23 ZIC5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:106679 Zic2 "zinc finger protein of the cerebellum 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5V9 ZIC5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040622-4 zic4 "zic family member 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P39768OPA_DROMENo assigned EC number0.74100.42750.2036yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 3e-04
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 37.0 bits (86), Expect = 3e-04
 Identities = 15/27 (55%), Positives = 18/27 (66%), Gaps = 2/27 (7%)

Query: 250 LVNHIRVHTGEKPFPCPFPTCGKVFAR 276
           L  H+R HTGEKP+ CP   CGK F+ 
Sbjct: 2   LRRHMRTHTGEKPYKCPV--CGKSFSS 26


Length = 26

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 290
KOG2462|consensus279 99.85
KOG2462|consensus279 99.76
KOG3623|consensus 1007 99.49
KOG1074|consensus 958 99.43
KOG3576|consensus267 99.41
KOG3608|consensus 467 99.32
KOG3623|consensus1007 99.31
KOG1074|consensus958 99.3
KOG3576|consensus267 99.2
KOG3608|consensus467 98.92
PHA00733128 hypothetical protein 98.62
PLN03086567 PRLI-interacting factor K; Provisional 98.6
PHA0276855 hypothetical protein; Provisional 98.5
PHA00733128 hypothetical protein 98.35
PLN03086567 PRLI-interacting factor K; Provisional 98.17
PHA0276855 hypothetical protein; Provisional 98.16
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.15
KOG3993|consensus 500 97.88
KOG3993|consensus500 97.71
PHA0073279 hypothetical protein 97.69
PHA0061644 hypothetical protein 97.53
PHA0073279 hypothetical protein 97.39
PHA0061644 hypothetical protein 97.22
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.11
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.08
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.08
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.98
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.88
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.67
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.6
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.26
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.09
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.01
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 95.96
smart0035526 ZnF_C2H2 zinc finger. 95.57
COG5189423 SFP1 Putative transcriptional repressor regulating 95.31
smart0035526 ZnF_C2H2 zinc finger. 94.71
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 94.1
COG5048467 FOG: Zn-finger [General function prediction only] 94.08
PRK04860160 hypothetical protein; Provisional 94.07
KOG2231|consensus 669 93.19
COG5189423 SFP1 Putative transcriptional repressor regulating 93.13
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 92.59
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 92.58
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 92.55
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 92.09
KOG1146|consensus 1406 91.84
COG5048467 FOG: Zn-finger [General function prediction only] 91.3
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 91.26
KOG2893|consensus 341 90.42
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 89.7
KOG2893|consensus 341 89.09
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 88.48
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 86.27
PRK04860160 hypothetical protein; Provisional 86.14
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 84.77
KOG2231|consensus 669 81.74
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 80.01
>KOG2462|consensus Back     alignment and domain information
Probab=99.85  E-value=7.6e-22  Score=179.21  Aligned_cols=113  Identities=32%  Similarity=0.565  Sum_probs=101.8

Q ss_pred             CCCCcccccccCccccccCchhhHHHHhcCCC--CCCcCCccCcccCChHHHHHhhhhcccCCCcccccCccccCCCCCC
Q psy16225        164 STNAMQSAGTHGAFFRYMRQPIKQDMTCLWID--TPGPRKTCGKMFNNMHEIVTHLTVEHVGGPECTTHACFWDGCPRNG  241 (290)
Q Consensus       164 s~~~~~~C~~Cg~~F~~~~~l~~H~~~~h~~e--~~~~C~~CgKsF~~~~~L~~H~~~~H~g~~~~~~~~C~~~~C~~Cg  241 (290)
                      .....|.|..||+.+.....|.+|...+...+  +.+.|+.|+|.|.++..|+.|+++ |.-  +        .+|.+||
T Consensus       126 ~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirT-H~l--~--------c~C~iCG  194 (279)
T KOG2462|consen  126 AKHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRT-HTL--P--------CECGICG  194 (279)
T ss_pred             ccCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhc-cCC--C--------ccccccc
Confidence            35568999999999999999999998866554  779999999999999999999999 541  2        5899999


Q ss_pred             CCCCcchhhhchhhhcCCCCcccCCCCCCCCccCChHHHHHHhhhcCC
Q psy16225        242 RPFKAKYKLVNHIRVHTGEKPFPCPFPTCGKVFARSENLKIHKRTHTE  289 (290)
Q Consensus       242 ksF~sks~L~~H~rvHtgeKpf~C~~~~CgKsFs~~s~L~~H~rtHTG  289 (290)
                      |.|...+-|+.|+|+|+|||||.|  +.|+|+|+..+||+.|++||++
T Consensus       195 KaFSRPWLLQGHiRTHTGEKPF~C--~hC~kAFADRSNLRAHmQTHS~  240 (279)
T KOG2462|consen  195 KAFSRPWLLQGHIRTHTGEKPFSC--PHCGKAFADRSNLRAHMQTHSD  240 (279)
T ss_pred             ccccchHHhhcccccccCCCCccC--CcccchhcchHHHHHHHHhhcC
Confidence            999999999999999999999999  7899999999999999999986



>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-44
2ej4_A95 Functional And Structural Basis Of Nuclear Localiza 1e-28
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 7e-18
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 3e-10
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-09
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-08
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-08
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-07
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-07
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 4e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 6e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 8e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 8e-07
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 8e-07
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 1e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-06
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 5e-06
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 6e-06
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 9e-06
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-05
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 5e-05
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 7e-05
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-04
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 6e-04
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 6e-04
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 9e-04
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure

Iteration: 1

Score = 175 bits (444), Expect = 3e-44, Method: Compositional matrix adjust. Identities = 77/109 (70%), Positives = 91/109 (83%), Gaps = 3/109 (2%) Query: 183 QPIKQDMTCLWIDTPG---PRKTCGKMFNNMHEIVTHLTVEHVGGPECTTHACFWDGCPR 239 QPIKQ+++C WID P+K+C + F+ MHE+VTH+T+EHVGGPE H C+W+ CPR Sbjct: 8 QPIKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPR 67 Query: 240 NGRPFKAKYKLVNHIRVHTGEKPFPCPFPTCGKVFARSENLKIHKRTHT 288 G+ FKAKYKLVNHIRVHTGEKPFPCPFP CGK+FARSENLKIHKRTHT Sbjct: 68 EGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHT 116
>pdb|2EJ4|A Chain A, Functional And Structural Basis Of Nuclear Localization Signal In Zic3 Zinc Finger Domain: A Role Of Conserved Tryptophan Residue In The Zinc Finger Domain Length = 95 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-50
2rpc_A 155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-37
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-12
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-34
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-17
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-15
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-17
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-13
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-17
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-17
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-17
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 7e-16
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-16
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-16
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-15
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 8e-15
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 2e-12
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-15
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-14
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-14
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-13
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-13
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-12
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-10
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-11
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-11
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 4e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-11
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 4e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-11
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-11
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-11
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-09
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-08
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 6e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 8e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-09
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-10
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-10
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-10
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 8e-10
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 5e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 5e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 4e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 5e-07
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 2e-06
1ard_A29 Yeast transcription factor ADR1; transcription reg 5e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 9e-06
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 3e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-04
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
 Score =  161 bits (409), Expect = 7e-50
 Identities = 77/109 (70%), Positives = 91/109 (83%), Gaps = 3/109 (2%)

Query: 183 QPIKQDMTCLWIDT---PGPRKTCGKMFNNMHEIVTHLTVEHVGGPECTTHACFWDGCPR 239
           QPIKQ+++C WID      P+K+C + F+ MHE+VTH+T+EHVGGPE   H C+W+ CPR
Sbjct: 8   QPIKQELSCKWIDEAQLSRPKKSCDRTFSTMHELVTHVTMEHVGGPEQNNHVCYWEECPR 67

Query: 240 NGRPFKAKYKLVNHIRVHTGEKPFPCPFPTCGKVFARSENLKIHKRTHT 288
            G+ FKAKYKLVNHIRVHTGEKPFPCPFP CGK+FARSENLKIHKRTHT
Sbjct: 68  EGKSFKAKYKLVNHIRVHTGEKPFPCPFPGCGKIFARSENLKIHKRTHT 116


>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 47 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 32 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Length = 64 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.84
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.81
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.81
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.81
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.81
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.79
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.77
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.75
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.75
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.73
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.73
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.72
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.71
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.71
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.7
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.69
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.68
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.66
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.66
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.63
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.63
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.62
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.59
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.58
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.58
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.57
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.57
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.56
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.56
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.52
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.5
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.5
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.49
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.46
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.45
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.44
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.43
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.43
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.41
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.41
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.39
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.38
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.37
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.36
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.36
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.34
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.34
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.33
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.32
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.31
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.3
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.3
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.29
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.28
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.27
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.26
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.24
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.23
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.23
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.21
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.19
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.19
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.19
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.19
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.18
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.12
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.1
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.1
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.06
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.05
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.05
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.03
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.02
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.99
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 98.98
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.95
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.93
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.91
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.8
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.8
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.75
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.75
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.74
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.72
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.72
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.72
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.71
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.71
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.71
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.7
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.7
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.7
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.7
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.7
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.69
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.69
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.69
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.69
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.69
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.69
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.68
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.68
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.68
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.68
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.67
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.67
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.67
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.67
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.67
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.67
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.66
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.66
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.66
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.66
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.66
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.66
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.66
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.65
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.65
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.65
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.65
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.65
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.65
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.65
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.65
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.65
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.65
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.65
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.64
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.64
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.64
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.64
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.64
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.64
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.64
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.64
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.63
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.63
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.63
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.63
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.63
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.63
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.63
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.63
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.63
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.63
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.63
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.63
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.63
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.63
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.63
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.62
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.62
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.62
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.62
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.62
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.62
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.62
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.62
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.62
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.62
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.62
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.62
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.61
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.61
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.61
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.61
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.61
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.61
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.61
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.61
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.61
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.61
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.61
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.61
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.61
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.61
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.61
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.61
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.61
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.61
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.61
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.6
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.6
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.6
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.6
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.6
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.6
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.6
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.6
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.59
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.59
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.59
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.59
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.59
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.59
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.59
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.59
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.59
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.59
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.59
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.59
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.59
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.58
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.58
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.58
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.58
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.58
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.58
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.58
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.57
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.57
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.57
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.57
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.57
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.57
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.57
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.57
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.57
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.57
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.56
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.56
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.56
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.56
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.56
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.56
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.55
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.55
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.55
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.55
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.55
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.55
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.54
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.54
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.54
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.54
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.54
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.54
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.53
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.53
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.53
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.53
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.53
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.53
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.53
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.53
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.52
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.51
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.51
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.51
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.51
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.5
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.5
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.5
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.49
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.49
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.49
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.48
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.48
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.48
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.48
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.47
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.47
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.47
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.46
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.46
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.44
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.44
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.44
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.41
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.41
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.41
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.39
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.39
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.38
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.38
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.36
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.36
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.36
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.35
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.35
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.35
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.34
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.34
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.33
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.32
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.31
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.31
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.3
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.28
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.25
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.21
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.17
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.13
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.12
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.12
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.11
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.11
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.1
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.09
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.05
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.04
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.04
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.02
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.99
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.99
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.98
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.96
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.93
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.14
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.9
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.89
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.11
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.85
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 97.85
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 97.84
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.81
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.81
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.79
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 97.77
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 97.74
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.74
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 97.65
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.82
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.63
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.62
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.62
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.61
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.58
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.55
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.53
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.52
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.52
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.48
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.48
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.48
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.48
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.47
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.6
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.47
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.45
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.45
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.42
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.4
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.39
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.36
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.36
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.35
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.46
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.33
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.24
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.21
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.2
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.18
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.17
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.64
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 93.4
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 93.1
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 92.95
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 90.7
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 89.06
2e72_A49 POGO transposable element with ZNF domain; zinc fi 88.59
2e72_A49 POGO transposable element with ZNF domain; zinc fi 86.33
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
Probab=99.84  E-value=3.5e-21  Score=152.40  Aligned_cols=115  Identities=19%  Similarity=0.279  Sum_probs=103.3

Q ss_pred             CCCcccccccCccccccCchhhHHHHhcCCCCCCcCCccCcccCChHHHHHhhhhcc--cCCCcccccCccccCCCCCCC
Q psy16225        165 TNAMQSAGTHGAFFRYMRQPIKQDMTCLWIDTPGPRKTCGKMFNNMHEIVTHLTVEH--VGGPECTTHACFWDGCPRNGR  242 (290)
Q Consensus       165 ~~~~~~C~~Cg~~F~~~~~l~~H~~~~h~~e~~~~C~~CgKsF~~~~~L~~H~~~~H--~g~~~~~~~~C~~~~C~~Cgk  242 (290)
                      ....|.|..|++.|.....|.+|+++ |..+++|.|++|++.|.+...|.+|++.++  .++.+        +.|.+|++
T Consensus         4 ~~~~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~--------~~C~~C~~   74 (124)
T 2dlq_A            4 GSSGVECPTCHKKFLSKYYLKVHNRK-HTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQV--------FTCSVCQE   74 (124)
T ss_dssp             CCSSCCCTTTCCCCSSHHHHHHHHHH-HSSCCSCBCTTTCCBCSSHHHHHHHHHHCCCCSCCCC--------EECSSSCC
T ss_pred             CCCCCCCCCCCCcCCCHHHHHHHHHh-CCCCCCeECCCCCchhcCHHHHHHHHhhhhcCCCCCC--------eECCCCCC
Confidence            44579999999999999999999887 677899999999999999999999998743  33333        89999999


Q ss_pred             CCCcchhhhchhhhcCCCCcccCCCCCCCCccCChHHHHHHhh-hcCCC
Q psy16225        243 PFKAKYKLVNHIRVHTGEKPFPCPFPTCGKVFARSENLKIHKR-THTEV  290 (290)
Q Consensus       243 sF~sks~L~~H~rvHtgeKpf~C~~~~CgKsFs~~s~L~~H~r-tHTGE  290 (290)
                      .|..+..|..|+++|.++++|+|  +.|++.|.+...|.+|++ .|.|+
T Consensus        75 ~f~~~~~l~~H~~~h~~~~~~~C--~~C~~~f~~~~~l~~H~~~~H~~~  121 (124)
T 2dlq_A           75 TFRRRMELRLHMVSHTGEMPYKC--SSCSQQFMQKKDLQSHMIKLHSGP  121 (124)
T ss_dssp             EESSHHHHHHHHHHHSSSCSEEC--SSSCCEESSHHHHHHHHHHTSSCS
T ss_pred             ccCCHHHHHHHHHHcCCCCCccC--CCccchhCCHHHHHHHHHHHCCCC
Confidence            99999999999999999999999  889999999999999987 68774



>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 290
d2glia233 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo 7e-16
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-11
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 1e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-09
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-09
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-09
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-09
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.003
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 7e-09
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 7e-09
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 2e-08
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 5e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 7e-07
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 6e-05
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 4e-04
d1bhia_38 g.37.1.1 (A:) Transactivation domain of cre-bp1/at 7e-04
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Five-finger GLI1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 67.4 bits (165), Expect = 7e-16
 Identities = 19/31 (61%), Positives = 21/31 (67%)

Query: 230 HACFWDGCPRNGRPFKAKYKLVNHIRVHTGE 260
             C W GC R  RPFKA+Y LV H+R HTGE
Sbjct: 3   FVCHWGGCSRELRPFKAQYMLVVHMRRHTGE 33


>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.4
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.28
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.24
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.18
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.06
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.06
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.03
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.93
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.92
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.91
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.91
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.86
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.82
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.82
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.78
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.72
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.71
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.66
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.6
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.58
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.55
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.53
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.42
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.42
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.4
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.38
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.27
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.27
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.24
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.22
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.2
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.11
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.03
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.9
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.89
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 97.82
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.78
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.71
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.69
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.66
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.63
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.61
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.6
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.5
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 97.49
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.41
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.4
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.4
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.32
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.27
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.25
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.2
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.19
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.09
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.09
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.02
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.89
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.86
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.79
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.65
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.61
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.32
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.31
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.22
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.0
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.99
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.96
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.89
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.78
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.72
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.53
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 95.5
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.98
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.68
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 94.53
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 94.32
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.02
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 93.97
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 93.96
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 93.73
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.7
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.36
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 93.02
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.88
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 92.81
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 91.99
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.87
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.65
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 90.97
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 90.79
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 90.77
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 90.44
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 90.18
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 89.03
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 89.02
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 88.85
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 87.36
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 86.89
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 85.14
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 84.34
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 84.0
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 83.63
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 82.21
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.40  E-value=3.6e-14  Score=97.19  Aligned_cols=50  Identities=32%  Similarity=0.664  Sum_probs=47.5

Q ss_pred             cCCCCCCCCCCcchhhhchhhhcCCCCcccCCCCCCCCccCChHHHHHHhhhc
Q psy16225        235 DGCPRNGRPFKAKYKLVNHIRVHTGEKPFPCPFPTCGKVFARSENLKIHKRTH  287 (290)
Q Consensus       235 ~~C~~CgksF~sks~L~~H~rvHtgeKpf~C~~~~CgKsFs~~s~L~~H~rtH  287 (290)
                      |.| .||+.|..+..|..|+++|++++||.|  .+||++|.+.+.|.+|+++|
T Consensus         4 y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C--~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           4 YPC-QCGKSFTHKSQRDRHMSMHLGLRPYGC--GVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             EEC-TTSCEESSHHHHHHHHHHHSCCCSEEC--TTTSCEESSSHHHHHHHTTT
T ss_pred             CCC-CCCCeECCHHHhHHHhhccccccCCcC--CCcCCEecCHHHHHHHHhcC
Confidence            899 599999999999999999999999999  88999999999999999987



>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure