Psyllid ID: psy16316


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-----
MKLTDNVIRSYKVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSKKYGVDLIRFTHAKQAAIHASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDLRSPNCQGIMHVSGSRPIAAFDPEGLIFGVGVNSDTIKLYDVRSFDKGPFSNFKFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNKGCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMASACTNLAFWIPTYLSNHQEPDTIDNLKIYLGVLCYQ
cEEEEcccEEEEccEEcccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEEcccEEEEEEcccccEEEEEEccccEEEEEccccccccccEEEEcccccccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEEEcccccccccEEEEEcccccEEEEEEccccEEEEEcccccEEEEccccccccEEEEEEcccccEEEEEccccEEEccccccccccccccccccccEEEEEEc
ccccccHEccccHHEEcccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEcccEEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccccEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccccEEEEEEc
MKLTDNVIRSYKVAKLFREntdkitsidysadgllliscseddqiviydcelgtnkrtvfskkygvdlIRFTHAKQAAIHASTKIDDTVRylslhdnkyiryfpghtkkvnslclspiddtfisgsydktvrlwdlrspncqgimhvsgsrpiaafdpeglifgvgvnsdtiklydvrsfdkgpfsnfkfaaekecdwtgikfsadgKYILISTNGSIIRTFDAYNGQCLQTLAGflnnkgcpleasftpdskyvisgstdgrihIWNAEKGFKVcvldadhpspvqtiqfnpkfnMMASACTNLAFWiptylsnhqepdtidnlKIYLGVLCYQ
mkltdnvirSYKVaklfrentdkitsidySADGLLLISCSEDDQIVIYDcelgtnkrtvFSKKYGVDLIRFTHakqaaihastkiddtvRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDLRSPNCQGIMHVSGSRPIAAFDPEGLIFGVGVNSDTIKLYDVRSFDKGPFSNFKFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNKGCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMASACTNLAFWIPTYLSNHQEPDTIDNLKIYLGVLCYQ
MKLTDNVIRSYKVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSKKYGVDLIRFTHAKQAAIHASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDLRSPNCQGIMHVSGSRPIAAFDPEGLIFGVGVNSDTIKLYDVRSFDKGPFSNFKFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNKGCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMASACTNLAFWIPTYLSNHQEPDTIDNLKIYLGVLCYQ
******VIRSYKVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSKKYGVDLIRFTHAKQAAIHASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDLRSPNCQGIMHVSGSRPIAAFDPEGLIFGVGVNSDTIKLYDVRSFDKGPFSNFKFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNKGCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMASACTNLAFWIPTYLSNHQEPDTIDNLKIYLGVLCY*
MKLTDNVIRSYKVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSKKYGVDLIRFTHAKQAAIHASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDLRSPNCQGIMHVSGSRPIAAFDPEGLIFGVGVNSDTIKLYDVRSFDKGPFSNFKFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNKGCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMASACTNLAFWIPTYLSNHQEPDTIDNLKIYLGVLCYQ
MKLTDNVIRSYKVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSKKYGVDLIRFTHAKQAAIHASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDLRSPNCQGIMHVSGSRPIAAFDPEGLIFGVGVNSDTIKLYDVRSFDKGPFSNFKFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNKGCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMASACTNLAFWIPTYLSNHQEPDTIDNLKIYLGVLCYQ
MKLTDNVIRSYKVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSKKYGVDLIRFTHAKQAAIHASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDLRSPNCQGIMHVSGSRPIAAFDPEGLIFGVGVNSDTIKLYDVRSFDKGPFSNFKFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNKGCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMASACTNLAFWIPTYLSNHQEPDTIDNLKIYLGVLCYQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLTDNVIRSYKVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSKKYGVDLIRFTHAKQAAIHASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDLRSPNCQGIMHVSGSRPIAAFDPEGLIFGVGVNSDTIKLYDVRSFDKGPFSNFKFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNKGCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMASACTNLAFWIPTYLSNHQEPDTIDNLKIYLGVLCYQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query335 2.2.26 [Sep-21-2011]
Q5ZMV7313 WD repeat-containing prot yes N/A 0.925 0.990 0.643 1e-125
Q6NV31313 WD repeat-containing prot yes N/A 0.925 0.990 0.636 1e-124
Q8BFQ4313 WD repeat-containing prot yes N/A 0.925 0.990 0.636 1e-124
Q6UXN9313 WD repeat-containing prot yes N/A 0.925 0.990 0.636 1e-124
Q58E77313 WD repeat-containing prot N/A N/A 0.925 0.990 0.627 1e-122
Q6GL39313 WD repeat-containing prot yes N/A 0.925 0.990 0.620 1e-121
Q640J6313 WD repeat-containing prot N/A N/A 0.925 0.990 0.620 1e-121
O60137357 Set1 complex component sw yes N/A 0.850 0.798 0.348 8e-48
P36104329 COMPASS component SWD2 OS yes N/A 0.832 0.848 0.348 6e-44
Q9UT39341 Uncharacterized WD repeat no N/A 0.904 0.888 0.335 7e-43
>sp|Q5ZMV7|WDR82_CHICK WD repeat-containing protein 82 OS=Gallus gallus GN=WDR82 PE=2 SV=1 Back     alignment and function desciption
 Score =  446 bits (1148), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 200/311 (64%), Positives = 250/311 (80%), Gaps = 1/311 (0%)

Query: 1   MKLTDNVIRSYKVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVF 60
           MKLTDNV+RS++VAK+FREN+DKI   D+S +G  +IS S+DD IV+YDC+ G  KRT++
Sbjct: 1   MKLTDNVLRSFRVAKVFRENSDKINCFDFSPNGETVISSSDDDSIVLYDCQEGKPKRTLY 60

Query: 61  SKKYGVDLIRFTHAKQAAIHASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDD 120
           SKKYGVDLIR+THA    +++S KIDDT+RYLSLHDNKYIRYFPGHTK+V +L +SP+DD
Sbjct: 61  SKKYGVDLIRYTHAANTVVYSSNKIDDTIRYLSLHDNKYIRYFPGHTKRVVALSMSPVDD 120

Query: 121 TFISGSYDKTVRLWDLRSPNCQGIMHVSGSRPIAAFDPEGLIFGVGVNSDTIKLYDVRSF 180
           TFISGS DKT+RLWDLRSPNCQG+MH+ G +P+ +FDPEGLIF  GVNS+ +KLYD+RSF
Sbjct: 121 TFISGSLDKTIRLWDLRSPNCQGLMHLQG-KPVCSFDPEGLIFAAGVNSEMVKLYDLRSF 179

Query: 181 DKGPFSNFKFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNK 240
           DKGPF+ FK   ++ C+WTG+KFS DGK ILISTNG  IR  DA+ G  L T  G+ N+K
Sbjct: 180 DKGPFATFKMQYDRTCEWTGLKFSNDGKLILISTNGGFIRLIDAFKGAVLHTFGGYNNSK 239

Query: 241 GCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMAS 300
              LEASFTPDS++++ GS DG+IH+WN E G KV VLD  H  P+  +QFNPKF   AS
Sbjct: 240 AVTLEASFTPDSQFIMIGSEDGKIHVWNGESGMKVAVLDGKHTGPITCLQFNPKFMTFAS 299

Query: 301 ACTNLAFWIPT 311
           AC+N+AFW+PT
Sbjct: 300 ACSNMAFWLPT 310




Component of a chromatin regulatory complex involved in regulating chromatin structure in the nucleus.
Gallus gallus (taxid: 9031)
>sp|Q6NV31|WDR82_DANRE WD repeat-containing protein 82 OS=Danio rerio GN=wdr82 PE=2 SV=1 Back     alignment and function description
>sp|Q8BFQ4|WDR82_MOUSE WD repeat-containing protein 82 OS=Mus musculus GN=Wdr82 PE=1 SV=1 Back     alignment and function description
>sp|Q6UXN9|WDR82_HUMAN WD repeat-containing protein 82 OS=Homo sapiens GN=WDR82 PE=1 SV=1 Back     alignment and function description
>sp|Q58E77|WD82B_XENLA WD repeat-containing protein 82-B OS=Xenopus laevis GN=wdr82-b PE=2 SV=1 Back     alignment and function description
>sp|Q6GL39|WDR82_XENTR WD repeat-containing protein 82 OS=Xenopus tropicalis GN=wdr82 PE=2 SV=1 Back     alignment and function description
>sp|Q640J6|WD82A_XENLA WD repeat-containing protein 82-A OS=Xenopus laevis GN=wdr82-a PE=2 SV=1 Back     alignment and function description
>sp|O60137|SWD2_SCHPO Set1 complex component swd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd2 PE=3 SV=1 Back     alignment and function description
>sp|P36104|SWD2_YEAST COMPASS component SWD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWD2 PE=1 SV=1 Back     alignment and function description
>sp|Q9UT39|YIQ4_SCHPO Uncharacterized WD repeat-containing protein C824.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC824.04 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query335
332373966316 unknown [Dendroctonus ponderosae] 0.925 0.981 0.758 1e-143
91084031316 PREDICTED: similar to WD40 protein [Trib 0.925 0.981 0.752 1e-142
242011252336 COMPASS component SWD2, putative [Pedicu 0.925 0.922 0.752 1e-142
114052198315 WD40 protein [Bombyx mori] gi|87248441|g 0.925 0.984 0.749 1e-142
345488681315 PREDICTED: WD repeat-containing protein 0.925 0.984 0.745 1e-141
322783665315 hypothetical protein SINV_04225 [Solenop 0.937 0.996 0.746 1e-141
357612419314 WD40 protein [Danaus plexippus] 0.925 0.987 0.749 1e-141
307187770315 WD repeat-containing protein 82 [Campono 0.925 0.984 0.745 1e-141
332020818315 WD repeat-containing protein 82 [Acromyr 0.937 0.996 0.742 1e-140
157115819314 COMPASS component SWD2, putative [Aedes 0.925 0.987 0.733 1e-140
>gi|332373966|gb|AEE62124.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 236/311 (75%), Positives = 272/311 (87%), Gaps = 1/311 (0%)

Query: 1   MKLTDNVIRSYKVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVF 60
           MKL D V+RS++VAK+FRENTDKI SID+S  G  LISCSEDDQIVIYDCE GT  RTV 
Sbjct: 3   MKLVDQVVRSFRVAKVFRENTDKINSIDFSTSGDTLISCSEDDQIVIYDCEKGTQVRTVN 62

Query: 61  SKKYGVDLIRFTHAKQAAIHASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDD 120
           SKKYGVDLI FTHAK  AIH+STK+DDT+RYLSLHDNKYIRYFPGHTKKV SLCLSP++D
Sbjct: 63  SKKYGVDLIHFTHAKNTAIHSSTKVDDTIRYLSLHDNKYIRYFPGHTKKVVSLCLSPVED 122

Query: 121 TFISGSYDKTVRLWDLRSPNCQGIMHVSGSRPIAAFDPEGLIFGVGVNSDTIKLYDVRSF 180
           TF+SGS DKT+RLWDLRSPNCQG+MH+SG RP+AA+DPEGLIF  GVNS+ IKLYD+RSF
Sbjct: 123 TFLSGSMDKTLRLWDLRSPNCQGLMHLSG-RPVAAYDPEGLIFAAGVNSECIKLYDLRSF 181

Query: 181 DKGPFSNFKFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNK 240
           DKGPF  FK A EKECDWTG+KFS DGK ILISTNGSIIR  DA++G  LQT  G LNNK
Sbjct: 182 DKGPFVTFKLAQEKECDWTGLKFSRDGKTILISTNGSIIRLIDAFHGTPLQTFTGHLNNK 241

Query: 241 GCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMAS 300
           G P+EASF+PDS+++ SGSTDGR+H+WNA+ G+KVCVL+ADHP PVQ +QFNPK+ M+AS
Sbjct: 242 GIPIEASFSPDSQFIFSGSTDGRVHVWNADTGYKVCVLNADHPGPVQCVQFNPKYMMLAS 301

Query: 301 ACTNLAFWIPT 311
           ACTN+AFWIP+
Sbjct: 302 ACTNMAFWIPS 312




Source: Dendroctonus ponderosae

Species: Dendroctonus ponderosae

Genus: Dendroctonus

Family: Curculionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91084031|ref|XP_966556.1| PREDICTED: similar to WD40 protein [Tribolium castaneum] gi|270008003|gb|EFA04451.1| hypothetical protein TcasGA2_TC014755 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242011252|ref|XP_002426369.1| COMPASS component SWD2, putative [Pediculus humanus corporis] gi|212510446|gb|EEB13631.1| COMPASS component SWD2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|114052198|ref|NP_001040226.1| WD40 protein [Bombyx mori] gi|87248441|gb|ABD36273.1| WD40 protein [Bombyx mori] Back     alignment and taxonomy information
>gi|345488681|ref|XP_001604288.2| PREDICTED: WD repeat-containing protein 82-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|322783665|gb|EFZ11003.1| hypothetical protein SINV_04225 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|357612419|gb|EHJ67988.1| WD40 protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|307187770|gb|EFN72742.1| WD repeat-containing protein 82 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332020818|gb|EGI61216.1| WD repeat-containing protein 82 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157115819|ref|XP_001658297.1| COMPASS component SWD2, putative [Aedes aegypti] gi|108883467|gb|EAT47692.1| AAEL001211-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query335
FB|FBgn0032030317 Wdr82 [Drosophila melanogaster 0.925 0.977 0.733 1.5e-129
UNIPROTKB|Q5ZMV7313 WDR82 "WD repeat-containing pr 0.925 0.990 0.643 9.1e-116
UNIPROTKB|E2RGF2313 WDR82 "Uncharacterized protein 0.925 0.990 0.636 3.9e-115
UNIPROTKB|Q6UXN9313 WDR82 "WD repeat-containing pr 0.925 0.990 0.636 3.9e-115
UNIPROTKB|F2Z5U3313 WDR82 "Uncharacterized protein 0.925 0.990 0.636 3.9e-115
MGI|MGI:1924555313 Wdr82 "WD repeat domain contai 0.925 0.990 0.636 3.9e-115
ZFIN|ZDB-GENE-030131-333 600 wdr82 "WD repeat domain contai 0.982 0.548 0.599 4.6e-112
UNIPROTKB|F1MG94 602 WDR82 "Uncharacterized protein 0.907 0.504 0.632 2e-111
UNIPROTKB|E1BRZ6 601 TWF2 "Twinfilin-2" [Gallus gal 0.907 0.505 0.637 4.2e-111
DICTYBASE|DDB_G0278945319 DDB_G0278945 "WD repeat-contai 0.919 0.965 0.490 2e-81
FB|FBgn0032030 Wdr82 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1271 (452.5 bits), Expect = 1.5e-129, P = 1.5e-129
 Identities = 228/311 (73%), Positives = 270/311 (86%)

Query:     1 MKLTDNVIRSYKVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVF 60
             +KL D+V+RS+KVAK+FRENTDKI +ID++ +G  LISCSEDDQIVIYDCE GT  RTV 
Sbjct:     3 IKLIDSVVRSFKVAKIFRENTDKINAIDFAPNGEHLISCSEDDQIVIYDCEKGTQSRTVN 62

Query:    61 SKKYGVDLIRFTHAKQAAIHASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDD 120
             SKKYGVDLI FTHA   AIH+STK+DDT+RYLSLHDNKY+RYFPGHTKKV SLC+SP++D
Sbjct:    63 SKKYGVDLIHFTHANNTAIHSSTKVDDTIRYLSLHDNKYLRYFPGHTKKVISLCISPVED 122

Query:   121 TFISGSYDKTVRLWDLRSPNCQGIMHVSGSRPIAAFDPEGLIFGVGVNSDTIKLYDVRSF 180
             TF+SGS DKT+RLWDLRSPNCQG+MH+SG RPIAA+DPEGLIF  GVNS++IKLYD+RSF
Sbjct:   123 TFLSGSLDKTLRLWDLRSPNCQGLMHLSG-RPIAAYDPEGLIFAAGVNSESIKLYDLRSF 181

Query:   181 DKGPFSNFKFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNK 240
             DKGPF  FK   EKECDWTG+KFS DGK ILISTNGS+IR  DA++G  LQT  G+ NNK
Sbjct:   182 DKGPFVTFKLNQEKECDWTGLKFSRDGKTILISTNGSVIRLVDAFHGTPLQTFTGYPNNK 241

Query:   241 GCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMAS 300
             G P+EASF+PDS+++ SGSTDGR+HIWNA+ G KV VL+ DHP PVQ +QFNPK+ M+AS
Sbjct:   242 GIPIEASFSPDSQFIFSGSTDGRVHIWNADTGNKVSVLNGDHPGPVQCVQFNPKYMMLAS 301

Query:   301 ACTNLAFWIPT 311
             ACTN+AFW+PT
Sbjct:   302 ACTNMAFWLPT 312




GO:0008352 "katanin complex" evidence=ISS
GO:0051013 "microtubule severing" evidence=ISS
GO:0048188 "Set1C/COMPASS complex" evidence=IDA
GO:0051568 "histone H3-K4 methylation" evidence=IMP;IDA
GO:0080182 "histone H3-K4 trimethylation" evidence=IMP
GO:0035097 "histone methyltransferase complex" evidence=IDA
UNIPROTKB|Q5ZMV7 WDR82 "WD repeat-containing protein 82" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2RGF2 WDR82 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q6UXN9 WDR82 "WD repeat-containing protein 82" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5U3 WDR82 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1924555 Wdr82 "WD repeat domain containing 82" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-333 wdr82 "WD repeat domain containing 82" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MG94 WDR82 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BRZ6 TWF2 "Twinfilin-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0278945 DDB_G0278945 "WD repeat-containing protein 82" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5ZMV7WDR82_CHICKNo assigned EC number0.64300.92530.9904yesN/A
Q6GL39WDR82_XENTRNo assigned EC number0.62050.92530.9904yesN/A
Q6UXN9WDR82_HUMANNo assigned EC number0.63660.92530.9904yesN/A
Q8BFQ4WDR82_MOUSENo assigned EC number0.63660.92530.9904yesN/A
P36104SWD2_YEASTNo assigned EC number0.34860.83280.8480yesN/A
Q6NV31WDR82_DANRENo assigned EC number0.63660.92530.9904yesN/A
Q58E77WD82B_XENLANo assigned EC number0.62700.92530.9904N/AN/A
Q640J6WD82A_XENLANo assigned EC number0.62050.92530.9904N/AN/A
O60137SWD2_SCHPONo assigned EC number0.34840.85070.7983yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query335
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-39
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-26
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-24
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-21
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-20
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 9e-20
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-18
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-12
smart0032040 smart00320, WD40, WD40 repeats 3e-08
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 4e-08
smart0032040 smart00320, WD40, WD40 repeats 4e-04
PLN00181793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 4e-04
smart0032040 smart00320, WD40, WD40 repeats 5e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 6e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.002
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  140 bits (356), Expect = 1e-39
 Identities = 82/293 (27%), Positives = 129/293 (44%), Gaps = 26/293 (8%)

Query: 17  FRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSKKYGVDLIRFTHAKQ 76
            + +T  +T + +S DG LL + S D  I ++D E G   RT+      V  +  +    
Sbjct: 5   LKGHTGGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGT 64

Query: 77  AAIHASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDL 136
               AS   D T+R   L   + +R   GHT  V+S+  SP      S S DKT+++WD+
Sbjct: 65  YL--ASGSSDKTIRLWDLETGECVRTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDV 122

Query: 137 RSPNCQ--------GIMHVSGSRPIAAFDPEGLIFGVGVNSDTIKLYDVRSFDKGPFSNF 188
            +  C          +  V       AF P+G          TIKL+D+R+      +  
Sbjct: 123 ETGKCLTTLRGHTDWVNSV-------AFSPDGTFVASSSQDGTIKLWDLRTG--KCVATL 173

Query: 189 KFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNKGCPLEASF 248
                   +   + FS DG+ +L S++   I+ +D   G+CL TL G  N        +F
Sbjct: 174 TG---HTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCLGTLRGHENG---VNSVAF 227

Query: 249 TPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMASA 301
           +PD   + SGS DG I +W+   G  V  L   H + V ++ ++P    +AS 
Sbjct: 228 SPDGYLLASGSEDGTIRVWDLRTGECVQTLSG-HTNSVTSLAWSPDGKRLASG 279


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 335
KOG1446|consensus311 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0271|consensus480 100.0
KOG0286|consensus343 100.0
KOG0315|consensus311 100.0
KOG0272|consensus459 100.0
KOG0279|consensus315 100.0
KOG0265|consensus338 100.0
KOG0318|consensus603 100.0
KOG0266|consensus456 100.0
KOG0316|consensus307 100.0
KOG0295|consensus406 100.0
KOG0285|consensus460 100.0
KOG0293|consensus519 100.0
KOG0284|consensus464 100.0
KOG0279|consensus315 100.0
KOG0263|consensus707 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0282|consensus503 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0318|consensus603 100.0
KOG0278|consensus334 100.0
KOG0645|consensus312 100.0
KOG0286|consensus343 100.0
KOG0315|consensus311 100.0
KOG0295|consensus406 100.0
KOG0263|consensus707 100.0
KOG0292|consensus 1202 100.0
KOG0273|consensus524 100.0
KOG0291|consensus 893 100.0
KOG0276|consensus 794 100.0
KOG1407|consensus313 100.0
KOG0319|consensus 775 100.0
KOG0283|consensus712 100.0
KOG0266|consensus456 100.0
KOG0647|consensus347 100.0
KOG0288|consensus459 100.0
KOG0772|consensus 641 100.0
KOG0284|consensus464 100.0
KOG0306|consensus 888 100.0
KOG0291|consensus 893 100.0
KOG0273|consensus524 100.0
KOG0319|consensus 775 100.0
KOG0281|consensus499 100.0
KOG0296|consensus399 100.0
KOG0313|consensus423 100.0
KOG0265|consensus338 100.0
KOG0282|consensus503 100.0
KOG0278|consensus334 100.0
KOG0296|consensus399 100.0
KOG0275|consensus508 100.0
KOG1036|consensus323 100.0
KOG0292|consensus 1202 100.0
KOG0640|consensus430 100.0
KOG0281|consensus499 100.0
KOG0285|consensus460 99.98
KOG0268|consensus433 99.97
KOG2096|consensus420 99.97
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.97
KOG0643|consensus327 99.97
KOG0294|consensus362 99.97
PTZ00420 568 coronin; Provisional 99.97
KOG0275|consensus508 99.97
PTZ00421493 coronin; Provisional 99.97
KOG0274|consensus537 99.97
KOG0277|consensus311 99.97
PTZ00421 493 coronin; Provisional 99.97
KOG0973|consensus 942 99.97
KOG0310|consensus 487 99.97
KOG0293|consensus519 99.97
KOG0289|consensus506 99.97
KOG0645|consensus312 99.97
KOG0313|consensus423 99.97
KOG0274|consensus537 99.96
KOG0288|consensus459 99.96
KOG0643|consensus327 99.96
KOG0277|consensus311 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.96
KOG0310|consensus 487 99.96
KOG0305|consensus484 99.96
KOG0276|consensus 794 99.96
KOG0299|consensus479 99.96
KOG0301|consensus 745 99.96
KOG0306|consensus 888 99.96
KOG0300|consensus481 99.96
PTZ00420 568 coronin; Provisional 99.96
KOG1407|consensus313 99.96
KOG0316|consensus307 99.95
KOG0640|consensus430 99.95
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.95
KOG1332|consensus299 99.95
KOG0289|consensus506 99.95
KOG0641|consensus350 99.94
KOG0308|consensus 735 99.94
KOG0305|consensus484 99.94
KOG0639|consensus705 99.94
KOG0973|consensus 942 99.94
KOG0650|consensus733 99.94
KOG0641|consensus350 99.94
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.94
KOG0283|consensus 712 99.94
KOG1408|consensus 1080 99.94
KOG0264|consensus422 99.94
KOG0299|consensus479 99.94
KOG1274|consensus 933 99.94
KOG4328|consensus498 99.93
KOG0268|consensus433 99.93
KOG1273|consensus405 99.93
KOG0647|consensus347 99.93
KOG4283|consensus397 99.93
KOG1539|consensus 910 99.93
KOG2445|consensus361 99.93
KOG0269|consensus 839 99.93
KOG0267|consensus 825 99.93
KOG2106|consensus626 99.93
KOG1408|consensus 1080 99.93
KOG2106|consensus626 99.92
KOG0321|consensus 720 99.92
KOG2055|consensus514 99.92
KOG0294|consensus362 99.92
KOG0300|consensus481 99.92
KOG0264|consensus422 99.92
KOG1063|consensus764 99.91
KOG0772|consensus641 99.91
KOG2919|consensus406 99.91
KOG0321|consensus 720 99.91
KOG1334|consensus559 99.91
KOG1034|consensus385 99.91
KOG0639|consensus705 99.91
KOG4283|consensus397 99.91
KOG0308|consensus 735 99.9
KOG0301|consensus 745 99.9
KOG1274|consensus 933 99.9
KOG0269|consensus 839 99.9
KOG1446|consensus311 99.9
KOG0646|consensus476 99.89
KOG0267|consensus 825 99.89
KOG1036|consensus323 99.89
KOG0644|consensus 1113 99.89
KOG4378|consensus 673 99.89
KOG4227|consensus 609 99.89
KOG1332|consensus299 99.89
KOG0302|consensus440 99.89
KOG1539|consensus 910 99.88
KOG2048|consensus 691 99.87
KOG1273|consensus 405 99.87
KOG0270|consensus463 99.87
KOG0646|consensus 476 99.86
KOG2096|consensus420 99.86
KOG1009|consensus434 99.86
KOG0642|consensus577 99.86
COG2319466 FOG: WD40 repeat [General function prediction only 99.86
KOG2048|consensus 691 99.86
KOG4378|consensus 673 99.85
KOG1034|consensus385 99.85
KOG1063|consensus 764 99.85
KOG1445|consensus 1012 99.85
KOG0307|consensus 1049 99.85
KOG2445|consensus361 99.85
KOG1310|consensus 758 99.84
KOG0303|consensus472 99.84
KOG0302|consensus440 99.84
KOG4328|consensus498 99.83
KOG0270|consensus463 99.82
COG2319466 FOG: WD40 repeat [General function prediction only 99.82
KOG1538|consensus 1081 99.82
KOG2055|consensus514 99.81
KOG0322|consensus323 99.8
KOG1517|consensus1387 99.79
PRK11028330 6-phosphogluconolactonase; Provisional 99.79
KOG1188|consensus376 99.79
KOG0771|consensus398 99.78
PRK11028330 6-phosphogluconolactonase; Provisional 99.78
KOG0307|consensus 1049 99.78
KOG0650|consensus733 99.77
KOG1524|consensus 737 99.77
KOG1524|consensus 737 99.77
KOG2110|consensus391 99.76
PRK01742429 tolB translocation protein TolB; Provisional 99.75
KOG4497|consensus447 99.74
KOG1963|consensus 792 99.74
KOG1009|consensus434 99.74
KOG1188|consensus376 99.73
KOG0771|consensus398 99.72
KOG1587|consensus555 99.72
KOG0649|consensus325 99.72
KOG1538|consensus 1081 99.71
KOG0303|consensus 472 99.71
KOG0642|consensus577 99.7
KOG1354|consensus433 99.7
KOG2919|consensus 406 99.69
KOG1007|consensus370 99.68
PRK01742429 tolB translocation protein TolB; Provisional 99.67
KOG2139|consensus445 99.66
KOG1963|consensus 792 99.66
KOG0290|consensus364 99.66
KOG1445|consensus1012 99.65
KOG1240|consensus1431 99.65
KOG1007|consensus370 99.65
KOG1523|consensus361 99.65
PRK03629429 tolB translocation protein TolB; Provisional 99.64
KOG2111|consensus346 99.64
KOG1517|consensus1387 99.64
KOG2321|consensus 703 99.63
KOG1587|consensus555 99.6
KOG0290|consensus364 99.59
KOG0649|consensus325 99.58
KOG2394|consensus 636 99.58
KOG2110|consensus 391 99.58
PRK04922433 tolB translocation protein TolB; Provisional 99.58
KOG0322|consensus323 99.57
PRK05137435 tolB translocation protein TolB; Provisional 99.56
PRK02889427 tolB translocation protein TolB; Provisional 99.56
PRK02889427 tolB translocation protein TolB; Provisional 99.56
PRK03629429 tolB translocation protein TolB; Provisional 99.55
KOG4497|consensus447 99.55
PRK05137435 tolB translocation protein TolB; Provisional 99.54
PRK04922433 tolB translocation protein TolB; Provisional 99.53
KOG3881|consensus412 99.53
KOG4227|consensus 609 99.53
KOG1272|consensus 545 99.53
KOG1310|consensus 758 99.48
KOG1523|consensus 361 99.48
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.47
KOG1240|consensus 1431 99.47
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.47
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.46
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.46
KOG2139|consensus445 99.44
KOG2394|consensus 636 99.43
KOG3881|consensus412 99.42
KOG2111|consensus346 99.42
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.42
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.41
KOG0644|consensus 1113 99.41
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.41
KOG4190|consensus1034 99.4
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.4
PRK00178430 tolB translocation protein TolB; Provisional 99.39
KOG1272|consensus545 99.38
PRK00178430 tolB translocation protein TolB; Provisional 99.36
KOG0974|consensus 967 99.35
PRK04792448 tolB translocation protein TolB; Provisional 99.35
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.34
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.32
KOG0974|consensus 967 99.3
PRK04792448 tolB translocation protein TolB; Provisional 99.3
KOG4547|consensus 541 99.28
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.28
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.28
PRK01029428 tolB translocation protein TolB; Provisional 99.26
PRK01029428 tolB translocation protein TolB; Provisional 99.25
KOG2315|consensus 566 99.22
KOG1409|consensus404 99.22
KOG2041|consensus 1189 99.22
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.21
KOG4547|consensus 541 99.18
KOG2314|consensus 698 99.18
KOG2315|consensus 566 99.17
KOG1409|consensus404 99.16
KOG4532|consensus344 99.15
KOG2321|consensus 703 99.11
KOG1334|consensus559 99.1
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.09
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.09
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.05
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.05
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.04
KOG0280|consensus339 99.03
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.01
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.0
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.0
PRK04043419 tolB translocation protein TolB; Provisional 98.98
KOG1064|consensus2439 98.98
KOG1354|consensus 433 98.94
KOG0280|consensus339 98.91
KOG1064|consensus2439 98.9
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.9
KOG1912|consensus 1062 98.88
PRK04043419 tolB translocation protein TolB; Provisional 98.86
KOG3914|consensus 390 98.86
KOG0309|consensus 1081 98.85
KOG1832|consensus 1516 98.84
KOG3914|consensus 390 98.82
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.81
KOG4532|consensus344 98.8
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.79
KOG2695|consensus425 98.78
KOG4190|consensus1034 98.76
KOG2041|consensus 1189 98.76
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.74
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.71
KOG0882|consensus 558 98.7
KOG1275|consensus 1118 98.69
COG4946668 Uncharacterized protein related to the periplasmic 98.68
KOG2695|consensus425 98.67
COG4946668 Uncharacterized protein related to the periplasmic 98.67
KOG2314|consensus 698 98.66
KOG0309|consensus 1081 98.64
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.62
KOG2114|consensus 933 98.59
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.58
KOG0882|consensus 558 98.49
KOG1832|consensus 1516 98.48
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.48
KOG1920|consensus 1265 98.47
KOG1275|consensus 1118 98.41
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.4
KOG1912|consensus 1062 98.4
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.37
KOG2114|consensus 933 98.36
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.33
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.31
KOG4714|consensus319 98.28
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.25
KOG1645|consensus463 98.24
KOG4714|consensus319 98.24
COG3391381 Uncharacterized conserved protein [Function unknow 98.23
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.2
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.18
KOG2066|consensus 846 98.17
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.13
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.05
smart0032040 WD40 WD40 repeats. Note that these repeats are per 98.05
KOG3617|consensus 1416 98.04
KOG2066|consensus 846 98.03
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.02
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.98
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.94
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.94
KOG1920|consensus 1265 97.92
PRK02888 635 nitrous-oxide reductase; Validated 97.92
KOG1008|consensus 783 97.9
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.9
KOG3617|consensus 1416 97.88
PRK02888 635 nitrous-oxide reductase; Validated 97.79
KOG3621|consensus 726 97.73
KOG1008|consensus 783 97.7
COG3391381 Uncharacterized conserved protein [Function unknow 97.64
KOG1645|consensus463 97.61
KOG4649|consensus354 97.6
COG0823425 TolB Periplasmic component of the Tol biopolymer t 97.57
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.54
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.53
KOG3621|consensus 726 97.49
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.48
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.47
KOG4640|consensus 665 97.41
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.33
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.32
KOG2444|consensus238 97.25
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.25
KOG2395|consensus 644 97.04
PRK13616591 lipoprotein LpqB; Provisional 97.03
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.01
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.95
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.88
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.86
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.74
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.72
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.69
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.69
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.63
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.56
KOG2079|consensus 1206 96.56
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.53
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.42
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 96.35
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.22
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 96.19
KOG2444|consensus238 96.17
KOG2395|consensus644 96.16
KOG2079|consensus 1206 96.11
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.04
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.0
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.93
KOG4640|consensus 665 95.83
PHA02713557 hypothetical protein; Provisional 95.81
KOG1897|consensus 1096 95.81
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.67
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 95.66
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 95.59
COG3386307 Gluconolactonase [Carbohydrate transport and metab 95.56
PRK13616591 lipoprotein LpqB; Provisional 95.5
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.43
KOG4441|consensus571 95.39
PHA02713557 hypothetical protein; Provisional 95.35
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.24
KOG2280|consensus 829 95.22
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.12
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.06
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 94.98
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 94.98
KOG4441|consensus571 94.85
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 94.77
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.41
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 94.35
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 93.63
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 93.33
COG3490366 Uncharacterized protein conserved in bacteria [Fun 93.26
PHA03098534 kelch-like protein; Provisional 92.98
KOG1897|consensus 1096 92.78
PHA03098534 kelch-like protein; Provisional 92.77
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 92.76
PF07995 331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 92.3
KOG3630|consensus 1405 92.0
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 91.74
PHA02790480 Kelch-like protein; Provisional 91.5
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 91.1
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 91.1
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 90.98
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 90.81
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 90.74
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 90.72
KOG2377|consensus 657 90.58
KOG3630|consensus 1405 90.53
PHA02790480 Kelch-like protein; Provisional 89.97
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 89.73
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 89.41
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 89.18
KOG4649|consensus354 88.94
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 88.62
PRK10115 686 protease 2; Provisional 88.52
COG3490366 Uncharacterized protein conserved in bacteria [Fun 88.09
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 87.87
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 87.78
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 87.49
PRK13684334 Ycf48-like protein; Provisional 87.4
KOG1520|consensus 376 86.86
KOG2377|consensus 657 86.78
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 86.77
COG5167 776 VID27 Protein involved in vacuole import and degra 86.57
KOG4460|consensus 741 86.37
KOG4659|consensus 1899 84.72
KOG1916|consensus 1283 84.66
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 84.4
KOG2247|consensus 615 83.98
COG4590 733 ABC-type uncharacterized transport system, permeas 83.8
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 83.27
KOG4460|consensus 741 83.04
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 82.99
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 82.56
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 82.0
PLN00033398 photosystem II stability/assembly factor; Provisio 81.33
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 80.83
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 80.66
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 80.59
>KOG1446|consensus Back     alignment and domain information
Probab=100.00  E-value=4.4e-50  Score=327.18  Aligned_cols=304  Identities=58%  Similarity=1.011  Sum_probs=285.9

Q ss_pred             HhcccceeeeccCCccEEEEEECCCCCEEEEecCCCeEEEEEccCCcceeeeecccccceEEEEecCCCeeEEeecCCCC
Q psy16316          8 IRSYKVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSKKYGVDLIRFTHAKQAAIHASTKIDD   87 (335)
Q Consensus         8 ~~~~~~~~~~~~h~~~V~~v~~s~~g~~lasgs~Dg~i~lwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~   87 (335)
                      +++|++.++|+.-.+.|.++.|+++|.+|++++.|.+++|||...+++.+++..+++++..++|.+.....+.++...|.
T Consensus         1 l~s~~~ak~f~~~~~~i~sl~fs~~G~~litss~dDsl~LYd~~~g~~~~ti~skkyG~~~~~Fth~~~~~i~sStk~d~   80 (311)
T KOG1446|consen    1 LRSFRPAKVFRETNGKINSLDFSDDGLLLITSSEDDSLRLYDSLSGKQVKTINSKKYGVDLACFTHHSNTVIHSSTKEDD   80 (311)
T ss_pred             CcccccccccccCCCceeEEEecCCCCEEEEecCCCeEEEEEcCCCceeeEeecccccccEEEEecCCceEEEccCCCCC
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEEEcCCCceEeeecCCCCCeEEEEECCCCCEEEEeeCCCcEEEeecCCCCceeEEEecCCcceEEECCCCCEEEEEE
Q psy16316         88 TVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDLRSPNCQGIMHVSGSRPIAAFDPEGLIFGVGV  167 (335)
Q Consensus        88 ~i~~~~~~~~~~~~~~~~H~~~V~~~~~~~~~~~l~s~s~D~~i~vWd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  167 (335)
                      +||+.++.+++.++.+.||...|++++.+|-+..++|+|.|++||+||++..+|+..+...+ .++.+++|+|.++|++.
T Consensus        81 tIryLsl~dNkylRYF~GH~~~V~sL~~sP~~d~FlS~S~D~tvrLWDlR~~~cqg~l~~~~-~pi~AfDp~GLifA~~~  159 (311)
T KOG1446|consen   81 TIRYLSLHDNKYLRYFPGHKKRVNSLSVSPKDDTFLSSSLDKTVRLWDLRVKKCQGLLNLSG-RPIAAFDPEGLIFALAN  159 (311)
T ss_pred             ceEEEEeecCceEEEcCCCCceEEEEEecCCCCeEEecccCCeEEeeEecCCCCceEEecCC-CcceeECCCCcEEEEec
Confidence            99999999999999999999999999999999999999999999999999999988776544 67899999999999999


Q ss_pred             cCCeEEEEEccCCCCCceeeEEeccCCCccceEEEEccCCCEEEEEeCCCeEEEEECCCCeeeeeecccccCCCCceEEE
Q psy16316        168 NSDTIKLYDVRSFDKGPFSNFKFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNKGCPLEAS  247 (335)
Q Consensus       168 ~d~~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~l~~~~~~~~i~i~d~~~~~~~~~~~~~~~~~~~v~~~~  247 (335)
                      ..+.|++||+|+.+++|...+....+...+|+.+.|||+|++++.++..+.+++.|..+|....++.++.+....+.+.+
T Consensus       160 ~~~~IkLyD~Rs~dkgPF~tf~i~~~~~~ew~~l~FS~dGK~iLlsT~~s~~~~lDAf~G~~~~tfs~~~~~~~~~~~a~  239 (311)
T KOG1446|consen  160 GSELIKLYDLRSFDKGPFTTFSITDNDEAEWTDLEFSPDGKSILLSTNASFIYLLDAFDGTVKSTFSGYPNAGNLPLSAT  239 (311)
T ss_pred             CCCeEEEEEecccCCCCceeEccCCCCccceeeeEEcCCCCEEEEEeCCCcEEEEEccCCcEeeeEeeccCCCCcceeEE
Confidence            88899999999999999998888777788999999999999999999999999999999999899988877776778899


Q ss_pred             EcCCCcEEEEEeCCCcEEEEECCCCeeEEEeCCCCCCCeEEEEeCCCCcEEEeeeceeEEecccc
Q psy16316        248 FTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMASACTNLAFWIPTY  312 (335)
Q Consensus       248 ~sp~~~~l~tgs~dg~v~iwd~~~~~~~~~~~~~h~~~v~~v~~sp~~~~~~s~~~~~~~w~~~~  312 (335)
                      |+||++++++|+.||+|.+|+++++.+.......+.+++.++.|+|...++++++..+.+|.++.
T Consensus       240 ftPds~Fvl~gs~dg~i~vw~~~tg~~v~~~~~~~~~~~~~~~fnP~~~mf~sa~s~l~fw~p~~  304 (311)
T KOG1446|consen  240 FTPDSKFVLSGSDDGTIHVWNLETGKKVAVLRGPNGGPVSCVRFNPRYAMFVSASSNLVFWLPDE  304 (311)
T ss_pred             ECCCCcEEEEecCCCcEEEEEcCCCcEeeEecCCCCCCccccccCCceeeeeecCceEEEEeccc
Confidence            99999999999999999999999999998887668999999999999999999999999998753



>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG1520|consensus Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query335
2h9l_A329 Wdr5delta23 Length = 329 8e-23
2h9l_A329 Wdr5delta23 Length = 329 1e-09
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 8e-23
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 1e-09
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 8e-23
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 1e-09
2g9a_A311 Structural Basis For The Specific Recognition Of Me 9e-23
2g9a_A311 Structural Basis For The Specific Recognition Of Me 1e-09
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 9e-23
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 1e-09
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 9e-23
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 1e-09
2g99_A308 Structural Basis For The Specific Recognition Of Me 9e-23
2g99_A308 Structural Basis For The Specific Recognition Of Me 1e-09
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 9e-23
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 2e-09
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 1e-22
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 2e-09
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 1e-22
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 1e-09
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 1e-22
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 2e-09
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-22
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-09
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 1e-22
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 1e-22
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 2e-09
2gnq_A336 Structure Of Wdr5 Length = 336 1e-22
2gnq_A336 Structure Of Wdr5 Length = 336 2e-09
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 2e-22
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 3e-09
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 2e-22
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 1e-09
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 2e-18
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 3e-14
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 2e-05
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 1e-12
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 6e-12
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 8e-12
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 8e-12
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 8e-12
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 1e-11
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 1e-11
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 4e-11
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 4e-11
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 1e-10
2ynp_A 604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 1e-10
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 4e-10
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 6e-10
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 2e-08
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 2e-04
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 2e-08
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 2e-08
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 2e-04
3zey_7318 High-resolution Cryo-electron Microscopy Structure 3e-08
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 1e-07
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 3e-05
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 1e-07
1gxr_A337 Wd40 Region Of Human Groucho/tle1 Length = 337 3e-07
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 4e-07
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 8e-06
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 4e-07
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 9e-06
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 5e-07
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 1e-06
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 2e-06
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 6e-06
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 6e-06
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 2e-05
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 2e-05
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 2e-05
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-05
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 2e-05
4ggc_A318 Structural Analysis Of Human Cdc20 Supports Multi-S 4e-05
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 5e-05
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 6e-05
1nex_B464 Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Comp 6e-05
3mks_B464 Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH 7e-05
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 1e-04
1nr0_A611 Two Seven-Bladed Beta-Propeller Domains Revealed By 2e-04
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 5e-04
4e54_B435 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 9e-04
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure

Iteration: 1

Score = 104 bits (259), Expect = 8e-23, Method: Compositional matrix adjust. Identities = 79/305 (25%), Positives = 141/305 (46%), Gaps = 26/305 (8%) Query: 7 VIRSYKVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSKKYGV 66 V +Y + +T ++S+ +S +G L S S D I I+ G ++T+ K G+ Sbjct: 26 VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGI 85 Query: 67 DLIRFTHAKQAAIHASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGS 126 + ++ + AS D T++ + K ++ GH+ V +P + +SGS Sbjct: 86 SDVAWSSDSNLLVSASD--DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGS 143 Query: 127 YDKTVRLWDLRSPNCQGIMHVSGSRPIAA--FDPEGLIFGVGVNSDTIKLYDVRSF---- 180 +D++VR+WD+++ C + S P++A F+ +G + +++D S Sbjct: 144 FDESVRIWDVKTGKCLKTLPAH-SDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLK 202 Query: 181 ----DKGPFSNFKFAAEKECDWTGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGF 236 D P +F +KFS +GKYIL +T + ++ +D G+CL+T G Sbjct: 203 TLIDDDNPPVSF------------VKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGH 250 Query: 237 LNNKGCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFN 296 N K C K+++SGS D ++IWN + V L H V + +P N Sbjct: 251 KNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQG-HTDVVISTACHPTEN 309 Query: 297 MMASA 301 ++ASA Sbjct: 310 IIASA 314
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|4GGC|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 318 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure
>pdb|1NEX|B Chain B, Crystal Structure Of Scskp1-Sccdc4-Cpd Peptide Complex Length = 464 Back     alignment and structure
>pdb|3MKS|B Chain B, Crystal Structure Of Yeast Cdc4SKP1 IN COMPLEX WITH AN ALLOSTERIC Inhibitor Scf-I2 Length = 464 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|1NR0|A Chain A, Two Seven-Bladed Beta-Propeller Domains Revealed By The Structure Of A C. Elegans Homologue Of Yeast Actin Interacting Protein 1 (Aip1). Length = 611 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|4E54|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 435 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query335
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 1e-39
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 1e-35
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 2e-35
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 8e-27
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 2e-26
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 2e-25
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 1e-14
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 1e-09
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 4e-39
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 7e-37
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 2e-36
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 5e-30
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 3e-28
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 8e-17
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 4e-34
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 1e-12
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 2e-33
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 2e-25
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 5e-24
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 1e-12
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 5e-10
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 4e-33
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 7e-20
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 8e-12
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 5e-33
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 2e-25
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 1e-18
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 1e-16
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 4e-12
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 1e-30
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 1e-17
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 3e-09
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 6e-06
4e54_B435 DNA damage-binding protein 2; beta barrel, double 5e-30
4e54_B435 DNA damage-binding protein 2; beta barrel, double 4e-24
4e54_B435 DNA damage-binding protein 2; beta barrel, double 5e-22
4e54_B435 DNA damage-binding protein 2; beta barrel, double 2e-10
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 1e-08
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 4e-29
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 1e-21
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 2e-20
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 3e-20
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 3e-16
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 1e-15
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 1e-07
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 4e-05
3ow8_A321 WD repeat-containing protein 61; structural genomi 1e-28
3ow8_A321 WD repeat-containing protein 61; structural genomi 9e-28
3ow8_A321 WD repeat-containing protein 61; structural genomi 3e-26
3ow8_A 321 WD repeat-containing protein 61; structural genomi 3e-06
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 3e-28
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 2e-18
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 4e-18
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 3e-13
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 5e-28
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 3e-26
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 5e-24
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 4e-23
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 2e-22
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 1e-16
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 2e-14
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 8e-28
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 8e-26
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 1e-23
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 2e-16
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 3e-15
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 1e-06
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 1e-27
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 1e-25
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 3e-23
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 8e-16
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 8e-15
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 1e-27
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 5e-17
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 3e-14
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 1e-13
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 9e-06
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 1e-27
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 4e-24
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 4e-18
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 1e-17
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 3e-16
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 2e-27
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 4e-25
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 3e-21
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 2e-17
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 2e-17
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 1e-12
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 2e-12
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 5e-27
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 2e-26
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 1e-24
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 1e-26
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 6e-21
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 3e-17
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 1e-09
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 3e-26
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 5e-26
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 4e-13
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 8e-26
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 2e-24
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 9e-13
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 9e-26
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 2e-22
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 2e-22
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 5e-21
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 1e-11
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 1e-25
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 5e-22
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 3e-18
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 3e-16
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 2e-15
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 3e-08
3iz6_A305 40S ribosomal protein SA (S2P); eukaryotic ribosom 2e-25
3iz6_A305 40S ribosomal protein SA (S2P); eukaryotic ribosom 3e-22
3iz6_A305 40S ribosomal protein SA (S2P); eukaryotic ribosom 4e-17
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 3e-25
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 3e-20
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 1e-09
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 7e-07
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 2e-04
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 7e-25
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 5e-24
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 4e-17
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 2e-15
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 1e-06
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 1e-24
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 8e-23
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 7e-18
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 1e-24
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 7e-22
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 2e-21
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 5e-14
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 7e-11
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 3e-24
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 8e-23
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 2e-17
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 2e-14
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 4e-24
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 7e-17
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 3e-13
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 3e-09
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 1e-07
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 1e-23
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 1e-23
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 2e-17
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 5e-13
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 6e-09
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 3e-23
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 4e-19
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 2e-13
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 8e-23
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 6e-22
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 1e-20
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 3e-17
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 6e-13
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 1e-22
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 4e-22
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 4e-21
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 2e-20
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 2e-22
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 5e-21
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 9e-15
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 2e-14
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 4e-22
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 2e-21
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 2e-17
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 3e-14
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 2e-06
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 1e-21
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 7e-18
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 3e-13
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 5e-04
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 1e-21
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 5e-21
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 1e-18
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 2e-14
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 1e-07
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 1e-21
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 5e-20
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 2e-17
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 2e-05
2xyi_A430 Probable histone-binding protein CAF1; transcripti 3e-21
2xyi_A430 Probable histone-binding protein CAF1; transcripti 3e-14
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 4e-21
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 1e-16
2pm7_B297 Protein transport protein SEC13, protein transport 5e-21
2pm7_B297 Protein transport protein SEC13, protein transport 1e-11
2pm7_B297 Protein transport protein SEC13, protein transport 7e-08
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 5e-20
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 5e-19
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 1e-15
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 2e-10
3jrp_A379 Fusion protein of protein transport protein SEC13 5e-20
3jrp_A379 Fusion protein of protein transport protein SEC13 5e-13
3jrp_A 379 Fusion protein of protein transport protein SEC13 1e-11
3jrp_A379 Fusion protein of protein transport protein SEC13 1e-06
3jrp_A 379 Fusion protein of protein transport protein SEC13 7e-05
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 6e-20
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 5e-13
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 6e-10
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 7e-08
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 4e-05
3jro_A 753 Fusion protein of protein transport protein SEC13 9e-19
3jro_A 753 Fusion protein of protein transport protein SEC13 9e-12
3jro_A 753 Fusion protein of protein transport protein SEC13 1e-11
3jro_A 753 Fusion protein of protein transport protein SEC13 6e-11
3jro_A 753 Fusion protein of protein transport protein SEC13 6e-08
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 2e-18
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 3e-17
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 2e-17
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 4e-11
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 4e-07
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 1e-16
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 2e-13
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 1e-12
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 1e-08
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 2e-16
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 1e-15
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 3e-15
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 4e-15
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 4e-04
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 4e-12
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 1e-08
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 2e-08
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 3e-05
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 9e-08
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 2e-05
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 1e-07
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 1e-05
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 4e-04
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 5e-04
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
 Score =  146 bits (370), Expect = 1e-39
 Identities = 47/288 (16%), Positives = 105/288 (36%), Gaps = 18/288 (6%)

Query: 21  TDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSK-KYGVDLIRFTHAKQAAI 79
           +  +  + +S DG  + S S D  I I++      ++T+    +     +     KQA +
Sbjct: 239 SGSVFGLTWSPDGTKIASASADKTIKIWNVATLKVEKTIPVGTRIEDQQLGIIWTKQALV 298

Query: 80  HASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDLRSP 139
             S   +  + +++       +   GH K + +L  S    T  S   +  +  WD+ + 
Sbjct: 299 SIS--ANGFINFVNPELGSIDQVRYGHNKAITALSSSADGKTLFSADAEGHINSWDISTG 356

Query: 140 NCQGIMHVSGSRPI--AAFDPEGLIFGVGVNSDTIKLYDVRSFDKGPFSNFKFAAEKECD 197
               +     +  I       +G +F V    D +K+            + K  A K   
Sbjct: 357 ISNRVFPDVHATMITGIKTTSKGDLFTVS-WDDHLKVVPA---GGSGVDSSKAVANKLSS 412

Query: 198 W-TGIKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNKGCPLEASFTPDSKYVI 256
              G+  SADG   + +     I  +   +G+  +    + ++       + + D ++V 
Sbjct: 413 QPLGLAVSADGDIAVAACYKH-IAIYS--HGKLTEVPISYNSSC-----VALSNDKQFVA 464

Query: 257 SGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMASACTN 304
            G  D ++H++         V    HP+ + ++ F+     + +   +
Sbjct: 465 VGGQDSKVHVYKLSGASVSEVKTIVHPAEITSVAFSNNGAFLVATDQS 512


>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Length = 611 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Length = 1249 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Length = 342 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Length = 340 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A 2h13_A 3p4f_A 4a7j_A* 2h9l_A ... Length = 312 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Length = 410 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Length = 447 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Length = 435 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Length = 814 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Length = 321 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Length = 416 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Length = 615 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Length = 408 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Length = 369 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Length = 368 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Length = 425 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Length = 383 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Length = 401 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Length = 354 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Length = 340 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Length = 337 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Length = 420 Back     alignment and structure
>3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 Back     alignment and structure
>3iz6_A 40S ribosomal protein SA (S2P); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Length = 305 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Length = 437 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Length = 319 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Length = 372 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Length = 402 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Length = 694 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 377 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Length = 343 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Length = 393 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Length = 351 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Length = 313 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Length = 345 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Length = 330 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Length = 430 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Length = 450 Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Length = 450 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Length = 297 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Length = 357 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Length = 379 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Length = 902 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 and nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, ER-golgi transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Length = 753 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 343 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Length = 316 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Length = 524 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Length = 397 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Length = 355 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Length = 391 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Length = 391 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Length = 434 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Length = 433 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Length = 356 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Length = 337 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Length = 741 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query335
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.98
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.98
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.97
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.97
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
3jro_A 753 Fusion protein of protein transport protein SEC13 99.97
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.97
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.97
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.96
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.96
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.96
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.96
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.95
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.95
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.94
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.94
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.94
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.94
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.94
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.93
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.93
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.92
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.92
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.91
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.91
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.91
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.91
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.91
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.91
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.91
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.91
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.9
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.9
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.9
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.89
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.89
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.88
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.88
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.87
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.87
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.85
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.85
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.85
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.84
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.84
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.83
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.83
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.82
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.81
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.8
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.8
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.79
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.79
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.77
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.76
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.73
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.73
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.73
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.72
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.71
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.71
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.71
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.7
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.7
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.7
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.69
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.68
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.68
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.66
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.66
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.66
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.65
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.63
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.61
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.61
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.61
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.6
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.59
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.58
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.58
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.57
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.57
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.55
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.54
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.54
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.53
2qe8_A343 Uncharacterized protein; structural genomics, join 99.53
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.47
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.47
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.47
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.47
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.43
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.43
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.41
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.41
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.4
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.4
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.38
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.37
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.36
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.35
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.34
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.32
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.26
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.26
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.26
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.25
2qe8_A343 Uncharacterized protein; structural genomics, join 99.24
2ece_A462 462AA long hypothetical selenium-binding protein; 99.18
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.12
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.08
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.04
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.03
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.02
2ece_A462 462AA long hypothetical selenium-binding protein; 99.01
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.01
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.01
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.01
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.98
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.96
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.96
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.95
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.94
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.9
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.89
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.87
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.87
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.86
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.84
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.81
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.79
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.78
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.76
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.74
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.73
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.72
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.69
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.69
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.64
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.59
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.57
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.57
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.54
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.53
3v65_B386 Low-density lipoprotein receptor-related protein; 98.5
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.45
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.44
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.42
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.4
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.37
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.33
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.31
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.31
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.26
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.26
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.24
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.23
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.19
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.11
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 98.08
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.05
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.0
3v65_B386 Low-density lipoprotein receptor-related protein; 97.94
3kya_A496 Putative phosphatase; structural genomics, joint c 97.94
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.92
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.92
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.9
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.9
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.9
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.9
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.85
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.82
3kya_A496 Putative phosphatase; structural genomics, joint c 97.72
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.66
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.6
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.59
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.58
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.53
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.51
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.48
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.44
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 97.43
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.42
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.32
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.09
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.02
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.96
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.88
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 96.87
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 96.81
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 96.67
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 96.62
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.58
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 96.33
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.27
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 96.12
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.05
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 96.03
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 95.95
2g8s_A 353 Glucose/sorbosone dehydrogenases; bladed beta-prop 95.9
2ism_A 352 Putative oxidoreductase; BL41XU spring-8, bladed b 95.87
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 95.82
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 95.72
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.63
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 95.56
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 95.26
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 94.93
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 94.9
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 94.85
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 94.84
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 94.78
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 94.75
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 93.96
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 93.91
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 93.76
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 93.68
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 93.46
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 92.21
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 90.39
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 89.88
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 89.76
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 89.75
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 88.51
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 88.41
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 88.12
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 87.16
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 86.44
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 82.61
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 80.84
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
Probab=100.00  E-value=1.1e-46  Score=329.49  Aligned_cols=291  Identities=20%  Similarity=0.308  Sum_probs=247.0

Q ss_pred             cccceeeeccCCccEEEEEECCCCCEEEEecCCCeEEEEEccCCcceeeeecccccceEEEEecCCCeeEEeecCCCCeE
Q psy16316         10 SYKVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSKKYGVDLIRFTHAKQAAIHASTKIDDTV   89 (335)
Q Consensus        10 ~~~~~~~~~~h~~~V~~v~~s~~g~~lasgs~Dg~i~lwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~i   89 (335)
                      ++++.++|++|.+.|++++|+|+|++|++|+.||+|+|||++++.....+..+...+..++|.+++.  .+++++.|++|
T Consensus         2 ~l~~~~~~~~h~~~V~~~~fsp~~~~l~s~~~dg~v~lWd~~~~~~~~~~~~~~~~v~~~~~~~~~~--~l~s~s~d~~i   79 (304)
T 2ynn_A            2 KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVELWNYETQVEVRSIQVTETPVRAGKFIARKN--WIIVGSDDFRI   79 (304)
T ss_dssp             CCCCEEEEEEECSCEEEEEECSSSSEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEEEGGGT--EEEEEETTSEE
T ss_pred             cceeEEeecCCCCceEEEEECCCCCEEEEEcCCCcEEEEECCCCceeEEeeccCCcEEEEEEeCCCC--EEEEECCCCEE
Confidence            3678899999999999999999999999999999999999999999888888889999999998765  45667789999


Q ss_pred             EEEEcCCCceEeeecCCCCCeEEEEECCCCCEEEEeeCCCcEEEeecCCCCcee-EE-EecCCcceEEECC-CCCEEEEE
Q psy16316         90 RYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDLRSPNCQG-IM-HVSGSRPIAAFDP-EGLIFGVG  166 (335)
Q Consensus        90 ~~~~~~~~~~~~~~~~H~~~V~~~~~~~~~~~l~s~s~D~~i~vWd~~~~~~~~-~~-~~~~~~~~~~~~~-~~~~~~~~  166 (335)
                      ++||+.+++.+..+++|.+.|++++|+|++++|+||+.|++|++||++++.... .+ .+...+..++|+| ++.++++|
T Consensus        80 ~vwd~~~~~~~~~~~~h~~~v~~~~~~~~~~~l~sgs~D~~v~lWd~~~~~~~~~~~~~h~~~v~~v~~~p~~~~~l~sg  159 (304)
T 2ynn_A           80 RVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASG  159 (304)
T ss_dssp             EEEETTTCCEEEEEECCSSCEEEEEECSSSSEEEEEETTSCEEEEEGGGTTEEEEEECCCCSCEEEEEECTTCTTEEEEE
T ss_pred             EEEECCCCcEEEEEeCCCCcEEEEEEcCCCCEEEEECCCCeEEEEECCCCcchhhhhcccCCcEEEEEECCCCCCEEEEE
Confidence            999999999999999999999999999999999999999999999998764432 22 2344566788998 67899999


Q ss_pred             EcCCeEEEEEccCCCCCceeeEEeccCCCccceEEEEcc--CCCEEEEEeCCCeEEEEECCCCeeeeeecccccCCCCce
Q psy16316        167 VNSDTIKLYDVRSFDKGPFSNFKFAAEKECDWTGIKFSA--DGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNKGCPL  244 (335)
Q Consensus       167 ~~d~~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~s~--~~~~l~~~~~~~~i~i~d~~~~~~~~~~~~~~~~~~~v~  244 (335)
                      +.|++|++||++...  +...  ....+...+..++|+|  ++.+|++++.|+.|++||+++++++..+.+|   ...+.
T Consensus       160 s~D~~v~iwd~~~~~--~~~~--~~~~~~~~v~~~~~~~~~~~~~l~s~s~D~~i~iWd~~~~~~~~~~~~h---~~~v~  232 (304)
T 2ynn_A          160 CLDRTVKVWSLGQST--PNFT--LTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGH---MSNVS  232 (304)
T ss_dssp             ETTSEEEEEETTCSS--CSEE--EECCCTTCEEEEEECCSTTCCEEEEEETTSEEEEEETTTTEEEEEEECC---SSCEE
T ss_pred             eCCCeEEEEECCCCC--ccce--eccCCcCcEEEEEEEEcCCCCEEEEEcCCCeEEEEeCCCCccceeeCCC---CCCEE
Confidence            999999999997532  2222  2223334567788876  7789999999999999999999998888764   45678


Q ss_pred             EEEEcCCCcEEEEEeCCCcEEEEECCCCeeEEEeCCCCCCCeEEEEeCCCCc--EEEeeece-eEEecc
Q psy16316        245 EASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFN--MMASACTN-LAFWIP  310 (335)
Q Consensus       245 ~~~~sp~~~~l~tgs~dg~v~iwd~~~~~~~~~~~~~h~~~v~~v~~sp~~~--~~~s~~~~-~~~w~~  310 (335)
                      .++|+|++++|++|+.||+|++||..++.....+. .|...+++++|+|++.  ++|+|+.+ +.+|..
T Consensus       233 ~~~~~p~~~~l~s~s~Dg~i~iWd~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~asg~~~g~~~~~~  300 (304)
T 2ynn_A          233 FAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLN-VGLERSWCIATHPTGRKNYIASGFDNGFTVLSL  300 (304)
T ss_dssp             EEEECSSSSEEEEEETTSCEEEEETTTCCEEEEEC-CSSSSEEEEEECTTCGGGCEEEEETTEEEEEEC
T ss_pred             EEEECCCCCEEEEEcCCCeEEEEECCCCceeeecc-CCCccEEEEEECCCCCceEEEEecCCceEEEEe
Confidence            89999999999999999999999999988887775 5888999999999875  58888644 566653



>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 335
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-28
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 6e-15
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 9e-15
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-24
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 1e-17
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-11
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-20
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-18
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 7e-14
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-09
d1erja_ 388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.001
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-15
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-14
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-15
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-12
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-08
d1gxra_ 337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-05
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 2e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-15
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 4e-13
d1k32a3 360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-04
d1k32a3 360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 6e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-12
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-11
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 6e-12
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-09
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-07
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 4e-11
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-10
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 1e-07
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-10
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 6e-09
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 7e-06
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-10
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 5e-10
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 8e-08
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-06
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-10
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 7e-09
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-05
d1pbyb_ 337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-09
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-08
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 5e-06
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-05
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-08
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-08
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-06
d1jmxb_ 346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-04
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 5e-08
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 6e-05
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.002
d1mdah_368 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.002
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 6e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-07
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 7e-07
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.001
d1pgua2 287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.002
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-07
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-07
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 7e-07
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 8e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 4e-04
d1qksa2 432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 1e-06
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 6e-05
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 3e-06
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 7e-06
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 8e-05
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 3e-05
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 3e-05
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 0.001
d1hzua2 426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 0.004
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 2e-04
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 7e-04
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 0.004
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 4e-04
d1ri6a_ 333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 0.003
d1xfda1 465 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-lik 0.002
d1qnia2441 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-ter 0.003
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  109 bits (272), Expect = 3e-28
 Identities = 59/304 (19%), Positives = 119/304 (39%), Gaps = 22/304 (7%)

Query: 17  FRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSKKYGVDLIRFTHAKQ 76
              +   +T + +     +++S SED  I ++D E G  +RT+      V  I F H+ +
Sbjct: 13  LSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGK 72

Query: 77  AAIHASTKIDDTVRYLSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDL 136
                S  +   +        + IR   GH   V+S+ + P  D  +S S DKT+++W++
Sbjct: 73  LLASCSADMTIKLWDF--QGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEV 130

Query: 137 RSPNCQGIMHV-SGSRPIAAFDPEGLIFGVGVNSDTIKLYDVRSFD--------KGPFSN 187
           ++  C            +   + +G +     N  T++++ V + +        +     
Sbjct: 131 QTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHRHVVEC 190

Query: 188 FKFAAEKECDWTG-------IKFSADGKYILISTNGSIIRTFDAYNGQCLQTLAGFLNNK 240
             +A E               K    G ++L  +    I+ +D   G CL TL G  N  
Sbjct: 191 ISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWV 250

Query: 241 GCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMAS 300
                  F    K+++S + D  + +W+ +    +  L+A H   V ++ F+     + +
Sbjct: 251 RG---VLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNA-HEHFVTSLDFHKTAPYVVT 306

Query: 301 ACTN 304
              +
Sbjct: 307 GSVD 310


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 368 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 465 Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Length = 441 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query335
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.97
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.95
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.95
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.94
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.94
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.92
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.92
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.91
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.9
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.88
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.87
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.86
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.84
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.83
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.83
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.83
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.82
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.8
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.8
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.79
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.73
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.58
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.58
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.56
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.42
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.36
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.36
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.27
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.24
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.16
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.16
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.13
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.11
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.1
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.08
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.96
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.95
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.9
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.83
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.8
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.79
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.56
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.42
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.26
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.18
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.99
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.74
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.48
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.3
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.25
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.02
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.92
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.85
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.83
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.65
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.33
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 96.31
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 95.79
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 95.41
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 95.19
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 94.06
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 93.44
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 91.83
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 89.79
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 89.49
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 88.12
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 87.31
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 86.63
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 84.23
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 84.01
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 83.37
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 82.42
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=1.7e-41  Score=292.18  Aligned_cols=287  Identities=21%  Similarity=0.377  Sum_probs=243.6

Q ss_pred             cceeeeccCCccEEEEEECCCCCEEEEecCCCeEEEEEccCCcceeeeecccccceEEEEecCCCeeEEeecCCCCeEEE
Q psy16316         12 KVAKLFRENTDKITSIDYSADGLLLISCSEDDQIVIYDCELGTNKRTVFSKKYGVDLIRFTHAKQAAIHASTKIDDTVRY   91 (335)
Q Consensus        12 ~~~~~~~~h~~~V~~v~~s~~g~~lasgs~Dg~i~lwd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~i~~   91 (335)
                      +...+|+||+++|++|+|+|++++|||||.||+|+|||+++++....+..|...|..+++.++...  ++.+..++.+.+
T Consensus         8 ~~~~~L~GH~~~I~~l~~sp~~~~l~s~s~Dg~i~iWd~~~~~~~~~~~~h~~~V~~~~~~~~~~~--~~~~~~~~~~~~   85 (317)
T d1vyhc1           8 PEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKL--LASCSADMTIKL   85 (317)
T ss_dssp             SCSCEEECCSSCEEEEEECSSSSEEEEEESSSCEEEEETTTCCCCEEECCCSSCEEEEEECTTSSE--EEEEETTSCCCE
T ss_pred             CccEEEcCCCCCeEEEEEcCCCCEEEEEeCCCeEEEEECCCCCEEEEEeCCCCcEEEEeeeccccc--cccccccccccc
Confidence            345679999999999999999999999999999999999999999999889999999999886654  445557889999


Q ss_pred             EEcCCCceEeeecCCCCCeEEEEECCCCCEEEEeeCCCcEEEeecCCCCceeEEE-ecCCcceEEECCCCCEEEEEEcCC
Q psy16316         92 LSLHDNKYIRYFPGHTKKVNSLCLSPIDDTFISGSYDKTVRLWDLRSPNCQGIMH-VSGSRPIAAFDPEGLIFGVGVNSD  170 (335)
Q Consensus        92 ~~~~~~~~~~~~~~H~~~V~~~~~~~~~~~l~s~s~D~~i~vWd~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~d~  170 (335)
                      |+....+....+.+|...+.++.++|+++.+++++.|+.+++||+++++....+. +......+.+++++.++++++.|+
T Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~d~  165 (317)
T d1vyhc1          86 WDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQ  165 (317)
T ss_dssp             EETTSSCEEECCCCCSSCEEEEEECSSSSEEEEEETTSEEEEEETTTCCEEEEEECCSSCEEEEEECTTSSEEEEEETTS
T ss_pred             ccccccccccccccccccceeeeccCCCceEEeeccCcceeEeecccceeeeEEccCCCcceeeecccCCCEEEEEeCCC
Confidence            9999999899999999999999999999999999999999999999988766553 344456778999999999999999


Q ss_pred             eEEEEEccCCCCCceeeEEeccCCCccceEEEEccC--------------------CCEEEEEeCCCeEEEEECCCCeee
Q psy16316        171 TIKLYDVRSFDKGPFSNFKFAAEKECDWTGIKFSAD--------------------GKYILISTNGSIIRTFDAYNGQCL  230 (335)
Q Consensus       171 ~v~iwd~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~--------------------~~~l~~~~~~~~i~i~d~~~~~~~  230 (335)
                      .+++|+++...  ....   ...+...+..++++|+                    +.++++++.|+.|++||..+++++
T Consensus       166 ~v~~~~~~~~~--~~~~---~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~i~~~~~~~~~~~  240 (317)
T d1vyhc1         166 TVRVWVVATKE--CKAE---LREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCL  240 (317)
T ss_dssp             CEEEEETTTCC--EEEE---ECCCSSCEEEEEECCSCGGGGGGGCCSCC-------CCEEEEEETTSEEEEEETTTTEEE
T ss_pred             eEEEEeeccce--eeEE---EecCCCCceEEEEeeccccceeeccccceeeeeccCCceeEeccCCCEEEEEECCCCcEE
Confidence            99999997632  1111   1222333445555544                    567899999999999999999998


Q ss_pred             eeecccccCCCCceEEEEcCCCcEEEEEeCCCcEEEEECCCCeeEEEeCCCCCCCeEEEEeCCCCcEEEeee--ceeEEe
Q psy16316        231 QTLAGFLNNKGCPLEASFTPDSKYVISGSTDGRIHIWNAEKGFKVCVLDADHPSPVQTIQFNPKFNMMASAC--TNLAFW  308 (335)
Q Consensus       231 ~~~~~~~~~~~~v~~~~~sp~~~~l~tgs~dg~v~iwd~~~~~~~~~~~~~h~~~v~~v~~sp~~~~~~s~~--~~~~~w  308 (335)
                      .++.+   +...+.+++|+|++++|++|+.||.|++||+.++..+..+. +|.++|++++|+|++++|++|+  +.|++|
T Consensus       241 ~~~~~---~~~~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~-~h~~~V~~~~~s~~~~~l~s~s~Dg~i~iW  316 (317)
T d1vyhc1         241 MTLVG---HDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLN-AHEHFVTSLDFHKTAPYVVTGSVDQTVKVW  316 (317)
T ss_dssp             EEEEC---CSSCEEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEEE-CCSSCEEEEEECSSSSCEEEEETTSEEEEE
T ss_pred             EEEeC---CCCCEEEEEECCCCCEEEEEECCCeEEEEECCCCcEEEEEc-CCCCCEEEEEEcCCCCEEEEEeCCCeEEEe
Confidence            88765   45678899999999999999999999999999988877775 5999999999999999999986  568888


Q ss_pred             c
Q psy16316        309 I  309 (335)
Q Consensus       309 ~  309 (335)
                      .
T Consensus       317 d  317 (317)
T d1vyhc1         317 E  317 (317)
T ss_dssp             C
T ss_pred             C
Confidence            4



>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure