Psyllid ID: psy16403

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MPPEAKQGENEAPRIKKSSQQLGPRNLILRRSAALNGFGFTLRHFIVYPPESYTVLAGDRRLGLRSRCMDEPMDTIFIKHVRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVVPKENDLLQLYFGDTAHNPETNQRPPCPIYQNVWEAEQDQLYARRASE
cccccccccccccccccccccccccEEEEEEccccccccEEEEEEEEccccccEEEccccccccccccccccccccEEEEEccccHHHHcccccccEEEEEccEEcccccHHHHHHHHHccccEEEEEEEcccccHHHHccccccccccccccccccccccccccHHHHHHHHHccc
ccccccccccccccccccccccccEEEEEEEcccccccEEEEEEEEEcccccccEcccccccccccccccccccEEEEEccccccHHHHcccccccEEEEEccEEcccccHHHHHHHHHccccEEEEEEEcccccccHHHccccccccccccccccccccccccccccHcccccccc
mppeakqgeneaprikkssqqlgprnlILRRSAALNGFGFTLrhfivyppesytvlagdrrlglrsrcmdepmdtifikhvrphspaaaaglvpgdrvvavnnqtiadlpYAEVVQLIQNSPAYLHLlvvpkendllqlyfgdtahnpetnqrppcpiyqnVWEAEQDQLYARRASE
mppeakqgeneaprikkssqqlgprNLILRRSAALNGFGFTLRHFIVYPPESYTVLAGDRRLGLRSRCMDEPMDTIFIKHVRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVVPKENDLLQLYFGDtahnpetnqrppcPIYQNVWEAEQDQLYARRASE
MPPEAKQGENEAPRIKKSSQQLGPRNLILRRSAALNGFGFTLRHFIVYPPESYTVLAGDRRLGLRSRCMDEPMDTIFIKHVRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVVPKENDLLQLYFGDTAHNPETNQRPPCPIYQNVWEAEQDQLYARRASE
*************************NLILRRSAALNGFGFTLRHFIVYPPESYTVLAGDRRLGLRSRCMDEPMDTIFIKHVRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVVPKENDLLQLYFGDTAH*********CPIYQNVWEA************
**************************LILRRSAALNGFGFTLRHFIVYPPE****************CMDEPMDTIFIKHVRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVVPKEND******************************************
*******************QQLGPRNLILRRSAALNGFGFTLRHFIVYPPESYTVLAGDRRLGLRSRCMDEPMDTIFIKHVRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVVPKENDLLQLYFGDTAHNPETNQRPPCPIYQNVWEAEQDQLYARRASE
*********************LGPRNLILRRSAALNGFGFTLRHFIVYPPESYTVLA***********MDEPMDTIFIKHVRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVVPKENDLLQLYFGDT*********************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPEAKQGENEAPRIKKSSQQLGPRNLILRRSAALNGFGFTLRHFIVYPPESYTVLAGDRRLGLRSRCMDEPMDTIFIKHVRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVVPKENDLLQLYFGDTAHNPETNQRPPCPIYQNVWEAEQDQLYARRASE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query177 2.2.26 [Sep-21-2011]
Q6DFG0 1926 Rho GTPase-activating pro N/A N/A 0.689 0.063 0.473 7e-27
A2RUV4 1935 Rho GTPase-activating pro no N/A 0.689 0.063 0.480 1e-26
Q6DFV3 1944 Rho GTPase-activating pro yes N/A 0.768 0.069 0.431 1e-26
Q71M21 1902 Rho GTPase-activating pro N/A N/A 0.689 0.064 0.473 2e-26
Q69ZH9 1483 Rho GTPase-activating pro no N/A 0.694 0.082 0.484 2e-24
Q9P227 1491 Rho GTPase-activating pro yes N/A 0.694 0.082 0.453 4e-23
Q5T5U3 1957 Rho GTPase-activating pro no N/A 0.734 0.066 0.423 3e-22
Q9JJ40 523 Na(+)/H(+) exchange regul no N/A 0.480 0.162 0.339 6e-07
Q3T0X8 520 Na(+)/H(+) exchange regul no N/A 0.480 0.163 0.321 4e-06
Q91YE8 1087 Synaptopodin-2 OS=Mus mus no N/A 0.418 0.068 0.351 4e-06
>sp|Q6DFG0|RH21A_XENLA Rho GTPase-activating protein 21-A OS=Xenopus laevis GN=arhgap21-a PE=2 SV=1 Back     alignment and function desciption
 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 88/131 (67%), Gaps = 9/131 (6%)

Query: 23  GPRNLILRRSAALNGFGFTLRHFIVYPPES--YTVLA----GDRRLGL-RSRCMDEPMDT 75
           GP+++ LRR++  +GFGFTLRHFIVYPPES  +T +     G+R +   R R   EPMDT
Sbjct: 47  GPKSVALRRTS--DGFGFTLRHFIVYPPESAVHTSIKDEENGNRGVNTGRPRNKLEPMDT 104

Query: 76  IFIKHVRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVVPKEND 135
           IF+K V+   PA  AGL  GDR++ VN +++    Y++V+ LIQNS + L L V+PK+ D
Sbjct: 105 IFVKQVKEGGPAHEAGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDSTLELSVMPKDED 164

Query: 136 LLQLYFGDTAH 146
           +LQL +   A+
Sbjct: 165 ILQLAYSQDAY 175
GTPase-activating protein (GAP) for rhoa and cdc42.
Xenopus laevis (taxid: 8355)
>sp|A2RUV4|RHG21_XENTR Rho GTPase-activating protein 21 OS=Xenopus tropicalis GN=arhgap21 PE=2 SV=1 Back     alignment and function description
>sp|Q6DFV3|RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus GN=Arhgap21 PE=1 SV=1 Back     alignment and function description
>sp|Q71M21|RH21B_XENLA Rho GTPase-activating protein 21-B OS=Xenopus laevis GN=arhgap21-b PE=2 SV=1 Back     alignment and function description
>sp|Q69ZH9|RHG23_MOUSE Rho GTPase-activating protein 23 OS=Mus musculus GN=Arhgap23 PE=1 SV=2 Back     alignment and function description
>sp|Q9P227|RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens GN=ARHGAP23 PE=1 SV=2 Back     alignment and function description
>sp|Q5T5U3|RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 Back     alignment and function description
>sp|Q9JJ40|NHRF3_RAT Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Rattus norvegicus GN=Pdzk1 PE=1 SV=2 Back     alignment and function description
>sp|Q3T0X8|NHRF3_BOVIN Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Bos taurus GN=PDZK1 PE=2 SV=1 Back     alignment and function description
>sp|Q91YE8|SYNP2_MOUSE Synaptopodin-2 OS=Mus musculus GN=Synpo2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
328723159 1658 PREDICTED: hypothetical protein LOC10057 0.807 0.086 0.564 2e-46
328723163 1671 PREDICTED: hypothetical protein LOC10057 0.807 0.085 0.564 2e-46
328723165 1421 PREDICTED: hypothetical protein LOC10057 0.807 0.100 0.564 4e-46
328723167 1434 PREDICTED: hypothetical protein LOC10057 0.807 0.099 0.564 4e-46
307177152 2144 Rho GTPase-activating protein 21 [Campon 0.751 0.062 0.587 3e-39
332021331 2100 Rho GTPase-activating protein 21 [Acromy 0.774 0.065 0.585 4e-39
383847432 2296 PREDICTED: uncharacterized protein LOC10 0.706 0.054 0.613 3e-38
340720520 1887 PREDICTED: hypothetical protein LOC10064 0.706 0.066 0.621 9e-38
350412652 1882 PREDICTED: hypothetical protein LOC10074 0.706 0.066 0.621 1e-37
307205543 2231 Rho GTPase-activating protein 21 [Harpeg 0.751 0.059 0.574 5e-37
>gi|328723159|ref|XP_003247774.1| PREDICTED: hypothetical protein LOC100574987 isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 113/170 (66%), Gaps = 27/170 (15%)

Query: 23  GPRNLILRRSAALNGFGFTLRHFIVYPPESYTVLAGDRRLGLRSRC---MDEPMDTIFIK 79
           GPR+L +RRS   NGFGFTLRHFIVYPPESY VLA D RLGLR       DEPMDTIF+K
Sbjct: 27  GPRSLFIRRSE--NGFGFTLRHFIVYPPESYLVLARDERLGLRQGAGAYSDEPMDTIFVK 84

Query: 80  HVRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVVPKENDLLQL 139
           HVR   PA+ AGL  GDR+++VN +T+A   YA VVQ+IQ +  +L+LLVVP END+LQL
Sbjct: 85  HVREFGPASVAGLSTGDRIISVNGETVAGKSYAHVVQVIQQTQCHLYLLVVPMENDILQL 144

Query: 140 YFGDTAHNPETNQRP----------------------PCPIYQNVWEAEQ 167
           YF +TAHNPETNQRP                        PIYQ +W+  Q
Sbjct: 145 YFSETAHNPETNQRPGRLKAAMTSGSELRFHHHRGRDSSPIYQTIWDHPQ 194

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328723163|ref|XP_003247776.1| PREDICTED: hypothetical protein LOC100574987 isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328723165|ref|XP_003247777.1| PREDICTED: hypothetical protein LOC100574987 isoform 5 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328723167|ref|XP_003247778.1| PREDICTED: hypothetical protein LOC100574987 isoform 6 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307177152|gb|EFN66385.1| Rho GTPase-activating protein 21 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332021331|gb|EGI61705.1| Rho GTPase-activating protein 21 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383847432|ref|XP_003699358.1| PREDICTED: uncharacterized protein LOC100876381 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340720520|ref|XP_003398684.1| PREDICTED: hypothetical protein LOC100645999 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350412652|ref|XP_003489718.1| PREDICTED: hypothetical protein LOC100748012 [Bombus impatiens] Back     alignment and taxonomy information
>gi|307205543|gb|EFN83848.1| Rho GTPase-activating protein 21 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
MGI|MGI:3697726 1483 Arhgap23 "Rho GTPase activatin 0.813 0.097 0.450 3.5e-24
UNIPROTKB|F1NS04 1955 ARHGAP21 "Uncharacterized prot 0.774 0.070 0.427 3.9e-24
RGD|1311028 1915 Arhgap21 "Rho GTPase activatin 0.785 0.072 0.441 6.3e-24
UNIPROTKB|Q9P227 1491 ARHGAP23 "Rho GTPase-activatin 0.813 0.096 0.430 1.5e-23
UNIPROTKB|I3LTT6 1917 ARHGAP21 "Uncharacterized prot 0.785 0.072 0.425 2.7e-23
UNIPROTKB|F1LXQ7 1925 Arhgap21 "Protein Arhgap21" [R 0.745 0.068 0.456 2.7e-23
UNIPROTKB|F1RVJ3 1928 ARHGAP21 "Uncharacterized prot 0.785 0.072 0.425 2.7e-23
MGI|MGI:1918685 1944 Arhgap21 "Rho GTPase activatin 0.779 0.070 0.437 2.8e-23
UNIPROTKB|J9P9F1 1881 ARHGAP21 "Uncharacterized prot 0.785 0.073 0.427 3.4e-23
ZFIN|ZDB-GENE-030131-4944 1793 arhgap21b "Rho GTPase activati 0.689 0.068 0.496 5.2e-23
MGI|MGI:3697726 Arhgap23 "Rho GTPase activating protein 23" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 291 (107.5 bits), Expect = 3.5e-24, P = 3.5e-24
 Identities = 68/151 (45%), Positives = 91/151 (60%)

Query:     2 PPEAKQGENEAPRIKKSSQQLGPRNLILRRSAALNGFGFTLRHFIVYPPES--YTVLA-- 57
             PP+   G  +     +     GPR L+LR+S   +GFGFTLRHFIVYPPES  + +L   
Sbjct:    19 PPQLPLGPRDGCSSGRPLPWPGPRTLLLRKSLQ-DGFGFTLRHFIVYPPESAVHCILKEE 77

Query:    58 --GDRRLGLRSRCMDEPMDTIFIKHVRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVV 115
               G R  G   R   EPMDTIF+K+V+   PA  AGL  GDR+V VN ++I    Y++V+
Sbjct:    78 ENGGRGGGPSPRHRLEPMDTIFVKNVKDGGPAHRAGLRTGDRLVKVNGESIIGKTYSQVI 137

Query:   116 QLIQNSPAYLHLLVVPKENDLLQLYFGDTAH 146
              LIQNS   L L ++PK+ D+LQL +   A+
Sbjct:   138 GLIQNSDDTLELSIMPKDEDILQLAYSQDAY 168
GO:0003674 "molecular_function" evidence=ND
GO:0005096 "GTPase activator activity" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
UNIPROTKB|F1NS04 ARHGAP21 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1311028 Arhgap21 "Rho GTPase activating protein 21" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9P227 ARHGAP23 "Rho GTPase-activating protein 23" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LTT6 ARHGAP21 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1LXQ7 Arhgap21 "Protein Arhgap21" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RVJ3 ARHGAP21 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1918685 Arhgap21 "Rho GTPase activating protein 21" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9F1 ARHGAP21 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-4944 arhgap21b "Rho GTPase activating protein 21b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 2e-18
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 5e-16
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 6e-13
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 2e-11
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 3e-10
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 9e-10
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 3e-06
pfam1318081 pfam13180, PDZ_2, PDZ domain 4e-05
cd0099080 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain ass 1e-04
COG3975558 COG3975, COG3975, Predicted protease with the C-te 2e-04
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 2e-04
COG0793 406 COG0793, Prc, Periplasmic protease [Cell envelope 3e-04
TIGR00225 334 TIGR00225, prc, C-terminal peptidase (prc) 3e-04
COG0750 375 COG0750, COG0750, Predicted membrane-associated Zn 0.001
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 0.002
PRK10942473 PRK10942, PRK10942, serine endoprotease; Provision 0.002
PLN00049 389 PLN00049, PLN00049, carboxyl-terminal processing p 0.004
TIGR03900 973 TIGR03900, prc_long_Delta, putative carboxyl-termi 0.004
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information 
 Score = 74.9 bits (185), Expect = 2e-18
 Identities = 29/107 (27%), Positives = 42/107 (39%), Gaps = 25/107 (23%)

Query: 24  PRNLILRRSAALNGFGFTLRHFIVYPPESYTVLAGDRRLGLRSRCMDEPMDTIFIKHVRP 83
            R + LR+     G GF+LR                                IF+  V P
Sbjct: 1   VRTVTLRKDPG-GGLGFSLRGGKDSGG------------------------GIFVSRVEP 35

Query: 84  HSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVV 130
             PA   GL  GDR++ VN  ++  L + E V+L++NS   + L V 
Sbjct: 36  GGPAERGGLRVGDRILEVNGVSVEGLTHEEAVELLKNSGDEVTLTVR 82

May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases. Length = 82
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|238490 cd00990, PDZ_glycyl_aminopeptidase, PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>gnl|CDD|226483 COG3975, COG3975, Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|232883 TIGR00225, prc, C-terminal peptidase (prc) Back     alignment and domain information
>gnl|CDD|223821 COG0750, COG0750, Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|236802 PRK10942, PRK10942, serine endoprotease; Provisional Back     alignment and domain information
>gnl|CDD|177681 PLN00049, PLN00049, carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>gnl|CDD|234386 TIGR03900, prc_long_Delta, putative carboxyl-terminal-processing protease, deltaproteobacterial Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 177
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.49
KOG3550|consensus207 99.31
KOG3209|consensus 984 99.27
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 99.26
KOG3209|consensus984 99.18
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 99.18
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 99.16
KOG3549|consensus 505 99.03
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 99.02
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 99.01
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.95
KOG3606|consensus358 98.9
KOG3551|consensus 506 98.89
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 98.88
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 98.82
PLN00049 389 carboxyl-terminal processing protease; Provisional 98.78
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 98.78
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 98.76
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 98.73
PRK10139455 serine endoprotease; Provisional 98.72
KOG3553|consensus124 98.69
KOG3651|consensus 429 98.6
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.59
KOG3552|consensus 1298 98.58
KOG3580|consensus 1027 98.57
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 98.57
TIGR00225 334 prc C-terminal peptidase (prc). A C-terminal pepti 98.56
TIGR01713259 typeII_sec_gspC general secretion pathway protein 98.56
PRK10942473 serine endoprotease; Provisional 98.54
KOG4407|consensus 1973 98.52
KOG3580|consensus 1027 98.5
PRK10139455 serine endoprotease; Provisional 98.48
PRK11186 667 carboxy-terminal protease; Provisional 98.42
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 98.4
PRK10942473 serine endoprotease; Provisional 98.39
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 98.38
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 98.38
KOG0606|consensus 1205 98.37
KOG3542|consensus 1283 98.37
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.35
PRK10898353 serine endoprotease; Provisional 98.34
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.34
PRK10779 449 zinc metallopeptidase RseP; Provisional 98.31
KOG1892|consensus 1629 98.22
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 98.07
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 98.04
KOG0609|consensus 542 97.92
KOG3571|consensus 626 97.86
KOG3605|consensus829 97.85
KOG3605|consensus829 97.79
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 97.61
COG0265347 DegQ Trypsin-like serine proteases, typically peri 97.54
KOG3129|consensus231 97.46
KOG3938|consensus334 97.32
KOG3532|consensus 1051 97.27
PRK09681276 putative type II secretion protein GspC; Provision 97.07
COG3975558 Predicted protease with the C-terminal PDZ domain 97.02
KOG1320|consensus473 96.44
KOG1421|consensus 955 96.32
COG3031275 PulC Type II secretory pathway, component PulC [In 96.29
PF1281278 PDZ_1: PDZ-like domain 96.25
COG3480 342 SdrC Predicted secreted protein containing a PDZ d 96.18
KOG1738|consensus 638 94.4
KOG3834|consensus 462 93.98
COG0750 375 Predicted membrane-associated Zn-dependent proteas 93.17
KOG3834|consensus 462 92.54
KOG0792|consensus 1144 87.74
KOG1421|consensus955 87.14
KOG2921|consensus 484 83.53
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information 
Probab=99.49  E-value=4.3e-13  Score=88.32  Aligned_cols=81  Identities=35%  Similarity=0.518  Sum_probs=68.6

Q ss_pred             EEEEecCCCCCceeEEEeceeecCchhhhhhcCCcccceeeeeccCCCCceEEEeeCCCCHHhHcCCCCCCEEEEECCEE
Q psy16403         26 NLILRRSAALNGFGFTLRHFIVYPPESYTVLAGDRRLGLRSRCMDEPMDTIFIKHVRPHSPAAAAGLVPGDRVVAVNNQT  105 (177)
Q Consensus        26 ~v~l~r~~~~~~~Gf~l~~~~~~~~~~~~~~~g~~~~g~~~~~~~~~~~~~~V~~V~~gs~A~~aGl~~GD~I~~Ing~~  105 (177)
                      +|+|.|.. ..+|||.+...             ....          ..+++|..|.++|+|+++||+.||+|++|||.+
T Consensus         1 ~v~l~k~~-~~~lG~~l~~~-------------~~~~----------~~~~~V~~v~~~~~a~~~gl~~GD~Il~INg~~   56 (81)
T PF00595_consen    1 QVTLEKSG-NGPLGFTLRGG-------------SDND----------EKGVFVSSVVPGSPAERAGLKVGDRILEINGQS   56 (81)
T ss_dssp             EEEEEEST-TSBSSEEEEEE-------------STSS----------SEEEEEEEECTTSHHHHHTSSTTEEEEEETTEE
T ss_pred             CEEEEeCC-CCCcCEEEEec-------------CCCC----------cCCEEEEEEeCCChHHhcccchhhhhheeCCEe
Confidence            47888853 59999999873             1110          136899999999999999999999999999999


Q ss_pred             cCCCCHHHHHHHHHcCCCeEEEEEE
Q psy16403        106 IADLPYAEVVQLIQNSPAYLHLLVV  130 (177)
Q Consensus       106 v~~~~~~~~~~~l~~~~~~v~l~v~  130 (177)
                      +.++++.+++.+++.+.+.+.|+|.
T Consensus        57 v~~~~~~~~~~~l~~~~~~v~L~V~   81 (81)
T PF00595_consen   57 VRGMSHDEVVQLLKSASNPVTLTVQ   81 (81)
T ss_dssp             STTSBHHHHHHHHHHSTSEEEEEEE
T ss_pred             CCCCCHHHHHHHHHCCCCcEEEEEC
Confidence            9999999999999999888888763

PDZ domains can occur in one or multiple copies and are nearly always found in cytoplasmic proteins. They bind either the carboxyl-terminal sequences of proteins or internal peptide sequences []. In most cases, interaction between a PDZ domain and its target is constitutive, with a binding affinity of 1 to 10 microns. However, agonist-dependent activation of cell surface receptors is sometimes required to promote interaction with a PDZ protein. PDZ domain proteins are frequently associated with the plasma membrane, a compartment where high concentrations of phosphatidylinositol 4,5-bisphosphate (PIP2) are found. Direct interaction between PIP2 and a subset of class II PDZ domains (syntenin, CASK, Tiam-1) has been demonstrated. PDZ domains consist of 80 to 90 amino acids comprising six beta-strands (beta-A to beta-F) and two alpha-helices, A and B, compactly arranged in a globular structure. Peptide binding of the ligand takes place in an elongated surface groove as an anti-parallel beta-strand interacts with the beta-B strand and the B helix. The structure of PDZ domains allows binding to a free carboxylate group at the end of a peptide through a carboxylate-binding loop between the beta-A and beta-B strands.; GO: 0005515 protein binding; PDB: 3AXA_A 1WF8_A 1QAV_B 1QAU_A 1B8Q_A 1MC7_A 2KAW_A 1I16_A 1VB7_A 1WI4_A ....
>KOG3550|consensus Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG4407|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>COG0750 Predicted membrane-associated Zn-dependent proteases 1 [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3834|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>KOG2921|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
2yuy_A126 Solution Structure Of Pdz Domain Of Rho Gtpase Acti 9e-24
3r68_A95 Molecular Analysis Of The Pdz3 Domain Of Pdzk1 Leng 2e-06
1gq4_A90 Structural Determinants Of The Nherf Interaction Wi 3e-06
3r69_A89 Molecular Analysis Of The Interaction Of The Hdl-Re 4e-06
2d90_A102 Solution Structure Of The Third Pdz Domain Of Pdz D 5e-06
2ocs_A88 The Crystal Structure Of The First Pdz Domain Of Hu 7e-06
1uew_A114 Solution Structure Of The Forth Pdz Domain Of Human 1e-05
1g9o_A91 First Pdz Domain Of The Human Na+H+ EXCHANGER REGUL 1e-05
1i92_A91 Structural Basis Of The Nherf Pdz1-Cftr Interaction 2e-05
2jxo_A98 Structure Of The Second Pdz Domain Of Nherf-1 Lengt 2e-05
2eej_A96 Solution Structure Of Fourth Pdz Domain Of Pdz Doma 2e-05
1gq5_A91 Structural Determinants Of The Nherf Interaction Wi 2e-05
1x5n_A114 Solution Structure Of The Second Pdz Domain Of Harm 2e-05
2krg_A216 Solution Structure Of Human Sodium HYDROGEN EXCHANG 2e-05
2v90_A96 Crystal Structure Of The 3rd Pdz Domain Of Intestin 2e-05
1uf1_A128 Solution Structure Of The Second Pdz Domain Of Huma 3e-05
2kjd_A128 Solution Structure Of Extended Pdz2 Domain From Nhe 3e-05
2kbs_A92 Solution Structure Of Harmonin Pdz2 In Complex With 3e-05
2vsp_A91 Crystal Structure Of The Fourth Pdz Domain Of Pdz D 3e-05
3tmh_A87 Crystal Structure Of Dual-Specific A-Kinase Anchori 3e-05
2he4_A90 The Crystal Structure Of The Second Pdz Domain Of H 4e-05
2iwq_A123 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz 6e-05
2fcf_A103 The Crystal Structure Of The 7th Pdz Domain Of Mpdz 6e-05
2ozf_A92 The Crystal Structure Of The 2nd Pdz Domain Of The 6e-05
3ngh_A106 Molecular Analysis Of The Interaction Of The Hdl Re 7e-05
4f8k_A109 Molecular Analysis Of The Interaction Between The P 8e-05
2dls_A93 Solution Structure Of The Pdz Domain Of Human Rho G 8e-05
2edz_A114 Solution Structures Of The Pdz Domain Of Mus Muscul 8e-05
2eei_A106 Solution Structure Of Second Pdz Domain Of Pdz Doma 1e-04
2egk_A101 Crystal Structure Of Tamalin Pdz-Intrinsic Ligand F 2e-04
2kqf_A96 Solution Structure Of Mast205-Pdz Complexed With Th 2e-04
2ego_A96 Crystal Structure Of Tamalin Pdz Domain Length = 96 3e-04
2pnt_A98 Crystal Structure Of The Pdz Domain Of Human Grasp 6e-04
2eeh_A100 Solution Structure Of First Pdz Domain Of Pdz Domai 6e-04
1wi2_A104 Solution Structure Of The Pdz Domain From Riken Cdn 7e-04
>pdb|2YUY|A Chain A, Solution Structure Of Pdz Domain Of Rho Gtpase Activating Protein 21 Length = 126 Back     alignment and structure 
Iteration: 1

 Score =  105 bits (263), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 75/117 (64%), Gaps = 10/117 (8%)
Query: 24  PRNLILRRSAALNGFGFTLRHFIVYPPESYTVLA------GDRRLGLRSRCMDEPMDTIF 77
           P+ + L+R++   GFGFTLRHFIVYPPES    +      G+R  G + R   EPMDTIF
Sbjct: 9   PKTVTLKRTS--QGFGFTLRHFIVYPPESAIQFSYKDEENGNR--GGKQRNRLEPMDTIF 64
Query: 78  IKHVRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVVPKEN 134
           +K V+   PA  AGL  GDR++ VN +++    Y++V+ LIQNS   L L V+PK++
Sbjct: 65  VKQVKEGGPAFEAGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDS 121
>pdb|3R68|A Chain A, Molecular Analysis Of The Pdz3 Domain Of Pdzk1 Length = 95 Back     alignment and structure
>pdb|1GQ4|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2ar And Pdgfr Length = 90 Back     alignment and structure
>pdb|3R69|A Chain A, Molecular Analysis Of The Interaction Of The Hdl-Receptor Sr-Bi With The Pdz3 Domain Of Its Adaptor Protein Pdzk1 Length = 89 Back     alignment and structure
>pdb|2D90|A Chain A, Solution Structure Of The Third Pdz Domain Of Pdz Domain Containing Protein 1 Length = 102 Back     alignment and structure
>pdb|2OCS|A Chain A, The Crystal Structure Of The First Pdz Domain Of Human Nherf-2 (slc9a3r2) Length = 88 Back     alignment and structure
>pdb|1UEW|A Chain A, Solution Structure Of The Forth Pdz Domain Of Human Atrophin-1 Interacting Protein 1 (Kiaa0705 Protein) Length = 114 Back     alignment and structure
>pdb|1G9O|A Chain A, First Pdz Domain Of The Human Na+H+ EXCHANGER REGULATORY Factor Length = 91 Back     alignment and structure
>pdb|1I92|A Chain A, Structural Basis Of The Nherf Pdz1-Cftr Interaction Length = 91 Back     alignment and structure
>pdb|2JXO|A Chain A, Structure Of The Second Pdz Domain Of Nherf-1 Length = 98 Back     alignment and structure
>pdb|2EEJ|A Chain A, Solution Structure Of Fourth Pdz Domain Of Pdz Domain Containing Protein 1 Length = 96 Back     alignment and structure
>pdb|1GQ5|A Chain A, Structural Determinants Of The Nherf Interaction With Beta2- Ar And Pdgfr Length = 91 Back     alignment and structure
>pdb|1X5N|A Chain A, Solution Structure Of The Second Pdz Domain Of Harmonin Protein Length = 114 Back     alignment and structure
>pdb|2KRG|A Chain A, Solution Structure Of Human Sodium HYDROGEN EXCHANGE Regulatory Factor 1(150-358) Length = 216 Back     alignment and structure
>pdb|2V90|A Chain A, Crystal Structure Of The 3rd Pdz Domain Of Intestine- And Kidney-enriched Pdz Domain Ikepp (pdzd3) Length = 96 Back     alignment and structure
>pdb|1UF1|A Chain A, Solution Structure Of The Second Pdz Domain Of Human Kiaa1526 Protein Length = 128 Back     alignment and structure
>pdb|2KJD|A Chain A, Solution Structure Of Extended Pdz2 Domain From Nherf1 (150- 270) Length = 128 Back     alignment and structure
>pdb|2KBS|A Chain A, Solution Structure Of Harmonin Pdz2 In Complex With The Carboxyl Tail Peptide Of Cadherin23 Length = 92 Back     alignment and structure
>pdb|2VSP|A Chain A, Crystal Structure Of The Fourth Pdz Domain Of Pdz Domain- Containing Protein 1 Length = 91 Back     alignment and structure
>pdb|3TMH|A Chain A, Crystal Structure Of Dual-Specific A-Kinase Anchoring Protein 2 In Complex With Camp-Dependent Protein Kinase A Type Ii Alpha And Pdzk1 Length = 87 Back     alignment and structure
>pdb|2HE4|A Chain A, The Crystal Structure Of The Second Pdz Domain Of Human Nherf-2 (Slc9a3r2) Interacting With A Mode 1 Pdz Binding Motif Length = 90 Back     alignment and structure
>pdb|2IWQ|A Chain A, 7th Pdz Domain Of Multiple Pdz Domain Protein Mpdz Length = 123 Back     alignment and structure
>pdb|2FCF|A Chain A, The Crystal Structure Of The 7th Pdz Domain Of Mpdz (Mupp-1) Length = 103 Back     alignment and structure
>pdb|2OZF|A Chain A, The Crystal Structure Of The 2nd Pdz Domain Of The Human Nherf-1 (Slc9a3r1) Length = 92 Back     alignment and structure
>pdb|3NGH|A Chain A, Molecular Analysis Of The Interaction Of The Hdl Receptor Sr-Bi With The Adaptor Protein Pdzk1 Length = 106 Back     alignment and structure
>pdb|4F8K|A Chain A, Molecular Analysis Of The Interaction Between The Prostacyclin Receptor And The First Pdz Domain Of Pdzk1 Length = 109 Back     alignment and structure
>pdb|2DLS|A Chain A, Solution Structure Of The Pdz Domain Of Human Rho Guanine Nucleotide Exchange Factor 11 Length = 93 Back     alignment and structure
>pdb|2EDZ|A Chain A, Solution Structures Of The Pdz Domain Of Mus Musculus Pdz Domain-Containing Protein 1 Length = 114 Back     alignment and structure
>pdb|2EEI|A Chain A, Solution Structure Of Second Pdz Domain Of Pdz Domain Containing Protein 1 Length = 106 Back     alignment and structure
>pdb|2EGK|A Chain A, Crystal Structure Of Tamalin Pdz-Intrinsic Ligand Fusion Protein Length = 101 Back     alignment and structure
>pdb|2KQF|A Chain A, Solution Structure Of Mast205-Pdz Complexed With The C-Terminus Of A Rabies Virus G Protein Length = 96 Back     alignment and structure
>pdb|2EGO|A Chain A, Crystal Structure Of Tamalin Pdz Domain Length = 96 Back     alignment and structure
>pdb|2PNT|A Chain A, Crystal Structure Of The Pdz Domain Of Human Grasp (Grp1) In Complex With The C-Terminal Peptide Of The Metabotropic Glutamate Receptor Type 1 Length = 98 Back     alignment and structure
>pdb|2EEH|A Chain A, Solution Structure Of First Pdz Domain Of Pdz Domain Containing Protein 7 Length = 100 Back     alignment and structure
>pdb|1WI2|A Chain A, Solution Structure Of The Pdz Domain From Riken Cdna 2700099c19 Length = 104 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 1e-34
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 1e-26
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 3e-26
2v90_A96 PDZ domain-containing protein 3; membrane, protein 2e-25
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 2e-25
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 6e-25
2d90_A102 PDZ domain containing protein 1; structural genomi 6e-25
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 7e-25
3khf_A99 Microtubule-associated serine/threonine-protein ki 1e-24
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 1e-24
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 8e-24
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 1e-23
2ego_A96 General receptor for phosphoinositides 1- associat 5e-23
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 2e-22
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 2e-22
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 2e-21
2eei_A106 PDZ domain-containing protein 1; regulatory factor 3e-21
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 6e-20
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 9e-20
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 2e-19
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 1e-18
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 4e-18
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 5e-18
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 8e-18
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-17
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 1e-16
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 2e-16
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 5e-16
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 5e-16
2eaq_A90 LIM domain only protein 7; conserved hypothetical 1e-15
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 1e-15
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 1e-15
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 1e-15
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 2e-15
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 5e-15
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 8e-15
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 8e-15
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 1e-14
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 3e-14
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 6e-14
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 9e-14
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 1e-13
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 2e-13
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 2e-13
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-13
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 2e-13
2eeh_A100 PDZ domain-containing protein 7; structural genomi 3e-13
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 3e-13
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 4e-13
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-11
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 4e-13
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 5e-13
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-12
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 5e-13
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 6e-13
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 6e-13
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-12
2djt_A104 Unnamed protein product; PDZ domain, structural ge 7e-13
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 8e-13
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 9e-13
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 9e-13
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 1e-10
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 1e-12
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 2e-12
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 2e-12
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 3e-12
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 3e-12
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 3e-12
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 3e-12
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 3e-12
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 3e-12
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 3e-12
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 3e-12
2opg_A98 Multiple PDZ domain protein; structural protein, s 4e-12
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 4e-12
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 4e-12
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 4e-12
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 2e-09
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 4e-12
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 4e-12
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 4e-12
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 4e-12
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 5e-12
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-06
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 5e-12
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 6e-12
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 6e-12
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 7e-12
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 7e-12
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 8e-12
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 9e-12
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 1e-11
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 1e-11
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 1e-11
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 1e-11
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 2e-11
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 2e-11
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 2e-11
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 2e-11
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 2e-11
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 2e-11
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 3e-11
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 3e-11
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 3e-11
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 3e-11
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 4e-11
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 4e-11
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 4e-11
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 5e-11
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 5e-11
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 5e-11
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 5e-11
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 5e-11
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 6e-11
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 6e-11
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 7e-11
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 7e-11
2fne_A117 Multiple PDZ domain protein; structural protein, s 7e-11
3k1r_A192 Harmonin; protein-protein complex, alternative spl 8e-11
2awx_A105 Synapse associated protein 97; membrane protein, s 9e-11
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 1e-10
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 1e-10
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 1e-10
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 2e-10
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 2e-10
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 2e-10
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 2e-10
2byg_A117 Channel associated protein of synapse-110; DLG2, P 2e-10
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 2e-10
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 2e-10
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-10
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-10
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 3e-10
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 4e-10
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 4e-10
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 4e-10
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 5e-10
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 5e-10
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-07
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-05
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 7e-10
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 9e-10
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 1e-09
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 1e-09
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 1e-09
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 1e-09
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 1e-09
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 2e-09
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 2e-09
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 2e-09
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 2e-09
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 2e-09
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 3e-09
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 3e-09
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 4e-09
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 5e-09
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 1e-08
2o2t_A117 Multiple PDZ domain protein; structural protein, s 1e-08
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 2e-08
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 5e-08
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 2e-07
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 1e-04
3k50_A 403 Putative S41 protease; structural genomics, joint 2e-07
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 2e-07
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 3e-07
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 3e-07
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 4e-07
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 4e-07
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 6e-07
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 9e-05
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 8e-07
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 9e-06
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 1e-06
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 1e-06
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 2e-06
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 4e-06
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 4e-06
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 7e-06
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 7e-06
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 1e-05
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 2e-05
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 2e-05
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 3e-05
2kl1_A94 YLBL protein; structure genomics, structural genom 6e-05
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 1e-04
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 2e-04
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 2e-04
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 3e-04
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 3e-04
4fgm_A597 Aminopeptidase N family protein; structural genomi 4e-04
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 6e-04
2hga_A125 Conserved protein MTH1368; GFT structural genomics 7e-04
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
 Score =  117 bits (294), Expect = 1e-34
 Identities = 53/117 (45%), Positives = 73/117 (62%), Gaps = 6/117 (5%)

Query: 23  GPRNLILRRSAALNGFGFTLRHFIVYPPESYTVLAGDR----RLGLRSRCMDEPMDTIFI 78
           GP+ + L+R++   GFGFTLRHFIVYPPES    +         G + R   EPMDTIF+
Sbjct: 8   GPKTVTLKRTS--QGFGFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFV 65

Query: 79  KHVRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVVPKEND 135
           K V+   PA  AGL  GDR++ VN +++    Y++V+ LIQNS   L L V+PK++ 
Sbjct: 66  KQVKEGGPAFEAGLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDSG 122
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Length = 109 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Length = 139 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Length = 388 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 96 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Length = 95 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Length = 403 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Length = 113 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Length = 195 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Length = 388 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} Length = 209 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Length = 597 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.73
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.7
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.68
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.68
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.67
2ego_A96 General receptor for phosphoinositides 1- associat 99.66
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.66
2d90_A102 PDZ domain containing protein 1; structural genomi 99.65
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.65
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 99.65
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.64
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.63
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.62
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.62
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.62
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.61
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.61
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.61
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.6
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.6
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.6
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.6
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.59
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.59
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.59
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.58
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.58
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.58
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.58
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.58
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.58
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.58
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.57
2awx_A105 Synapse associated protein 97; membrane protein, s 99.57
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.57
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.57
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.57
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.57
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.57
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.56
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.56
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.56
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.56
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.56
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.56
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.56
3khf_A99 Microtubule-associated serine/threonine-protein ki 99.56
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.56
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.56
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.55
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.55
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.55
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.55
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.55
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.55
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.55
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.55
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.55
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.55
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.55
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.55
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.54
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.54
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.54
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.53
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.53
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.53
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.53
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.53
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.53
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.53
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.53
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.53
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.53
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.52
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.52
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.52
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.52
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.52
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.52
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.52
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 99.51
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.51
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.51
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.51
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.51
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.51
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.51
2eeh_A100 PDZ domain-containing protein 7; structural genomi 99.51
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.5
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.5
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.49
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.49
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.49
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.49
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.49
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 99.49
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 99.49
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 99.48
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.48
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.48
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 99.48
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 99.48
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.47
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 99.47
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 99.47
3k1r_A192 Harmonin; protein-protein complex, alternative spl 99.47
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 99.47
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 99.46
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.46
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.46
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 99.46
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 99.46
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.45
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 99.45
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 99.45
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.45
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.45
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 99.45
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 99.44
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 99.44
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.44
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 99.44
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 99.44
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.43
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 99.43
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.42
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.42
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 99.41
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.41
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.41
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.4
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.4
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 99.39
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.39
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 99.38
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 99.38
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.38
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.38
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.38
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 99.38
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 99.38
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 99.07
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 99.37
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 99.35
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 99.35
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 99.35
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 99.35
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 99.34
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 99.33
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 99.32
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 99.32
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.32
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 99.32
2eaq_A90 LIM domain only protein 7; conserved hypothetical 99.32
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.29
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 99.28
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 99.25
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 99.24
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 99.22
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 99.19
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 99.19
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.15
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 99.14
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 99.12
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 99.1
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 99.06
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 99.01
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 99.01
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.97
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.97
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.96
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.96
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.92
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 98.91
2kl1_A94 YLBL protein; structure genomics, structural genom 98.9
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 98.89
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 98.89
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 98.8
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 98.76
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 98.72
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.72
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.72
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.7
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 98.66
2hga_A125 Conserved protein MTH1368; GFT structural genomics 98.66
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.63
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 98.63
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 98.62
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 98.61
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.59
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 98.57
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 98.55
3k50_A 403 Putative S41 protease; structural genomics, joint 98.43
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 98.3
4fgm_A597 Aminopeptidase N family protein; structural genomi 98.25
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.17
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 98.07
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 98.06
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.88
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 97.4
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
Probab=99.73  E-value=5.2e-17  Score=106.60  Aligned_cols=80  Identities=19%  Similarity=0.443  Sum_probs=72.0

Q ss_pred             CCCceEEEEecCCCCCceeEEEeceeecCchhhhhhcCCcccceeeeeccCCCCceEEEeeCCCCHHhHcCCCCCCEEEE
Q psy16403         21 QLGPRNLILRRSAALNGFGFTLRHFIVYPPESYTVLAGDRRLGLRSRCMDEPMDTIFIKHVRPHSPAAAAGLVPGDRVVA  100 (177)
Q Consensus        21 ~~~~r~v~l~r~~~~~~~Gf~l~~~~~~~~~~~~~~~g~~~~g~~~~~~~~~~~~~~V~~V~~gs~A~~aGl~~GD~I~~  100 (177)
                      +..||+|+|+|.. ..+|||++..                              + .|..+.+++||+++||+.||+|++
T Consensus         2 ~~~~r~v~l~k~~-~g~~Gf~i~~------------------------------g-~I~~v~~gspA~~aGl~~GD~Il~   49 (82)
T 1r6j_A            2 AMDPRTITMHKDS-TGHVGFIFKN------------------------------G-KITSIVKDSSAARNGLLTEHNICE   49 (82)
T ss_dssp             TTCCEEEEEECCT-TSCCCEEEET------------------------------T-EEEEECTTSHHHHHTCCSSEEEEE
T ss_pred             CCceEEEEEEECC-CCCeEEEEEC------------------------------C-EEEEecCCCHHHHcCCCCCCEEEE
Confidence            4678999999987 4579999875                              1 478899999999999999999999


Q ss_pred             ECCEEcCCCCHHHHHHHHHcCCCeEEEEEEeC
Q psy16403        101 VNNQTIADLPYAEVVQLIQNSPAYLHLLVVPK  132 (177)
Q Consensus       101 Ing~~v~~~~~~~~~~~l~~~~~~v~l~v~~~  132 (177)
                      |||+++.++++++++++|+..+.++.|++++.
T Consensus        50 VNG~~v~~~~~~evv~llr~~g~~V~L~v~p~   81 (82)
T 1r6j_A           50 INGQNVIGLKDSQIADILSTSGTVVTITIMPA   81 (82)
T ss_dssp             ETTEECTTCCHHHHHHHHHHSCSEEEEEEEEC
T ss_pred             ECCEEcCCCCHHHHHHHHhcCCCEEEEEEEeC
Confidence            99999999999999999998899999998763
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 177
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 4e-19
d1q3oa_104 b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norv 5e-19
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 7e-16
d1uewa_114 b.36.1.1 (A:) Membrane associated guanylate kinase 1e-14
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 1e-14
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 1e-14
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 2e-14
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-14
d1rgwa_85 b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo 3e-14
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 4e-14
d1x5na1101 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) 5e-14
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 5e-14
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 5e-14
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 7e-14
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 8e-14
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 3e-13
d1ueza_101 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 5e-13
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 5e-13
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 6e-13
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 6e-13
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 6e-13
d1x5qa197 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Hom 8e-13
d2csja1104 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj 8e-13
d1ujua_111 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 9e-13
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 1e-12
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 2e-12
d1uhpa_107 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 2e-12
d1wf7a_103 b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu 3e-12
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 3e-12
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-12
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 4e-12
d1um1a_110 b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human 4e-12
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 5e-12
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 5e-12
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 6e-12
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 9e-12
d1vaea_111 b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T 1e-11
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 1e-11
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 1e-11
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 1e-11
d2h3la1103 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) 2e-11
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 2e-11
d1w9ea185 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie 2e-11
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 2e-11
d1uf1a_128 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 2e-11
d2cs5a1106 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no 4e-11
d1x6da1107 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap 1e-10
d1ozia_99 b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu 2e-10
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 2e-10
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 2e-10
d1tp5a1102 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat 2e-10
d1wi2a_104 b.36.1.1 (A:) PDZ domain containing protein 11, Pd 3e-10
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 6e-10
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 8e-10
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 1e-09
d1i16a_130 b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) 2e-09
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 1e-08
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 3e-08
d2f0aa192 b.36.1.1 (A:251-342) Segment polarity protein dish 4e-08
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 5e-08
d1qaua_112 b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS 2e-07
d1fc6a392 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal 6e-07
d1ujva_96 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-07
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 2e-06
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 5e-06
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 3e-04
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Na+/H+ exchanger regulatory factor, NHERF
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 75.6 bits (186), Expect = 4e-19
 Identities = 32/115 (27%), Positives = 49/115 (42%), Gaps = 27/115 (23%)

Query: 21  QLGPRNLILRRSAALNGFGFTLRHFIVYPPESYTVLAGDRRLGLRSRCMDEPMDTIFIKH 80
           ++ PR   L +    NG+GF L                           ++     +I+ 
Sbjct: 1   RMLPRLCCLEKGP--NGYGFHLHG-------------------------EKGKLGQYIRL 33

Query: 81  VRPHSPAAAAGLVPGDRVVAVNNQTIADLPYAEVVQLIQNSPAYLHLLVVPKEND 135
           V P SPA  AGL+ GDR+V VN + +    + +VV  I+ +   + LLVV  E D
Sbjct: 34  VEPGSPAEKAGLLAGDRLVEVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETD 88
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 104 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Length = 92 Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.79
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.75
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.73
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.73
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.73
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.72
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.71
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.71
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.7
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.7
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.7
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.7
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.69
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.69
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.68
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.68
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.67
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.67
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.67
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.66
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.66
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.66
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.65
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.64
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.64
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.64
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.63
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.63
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.62
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.62
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.61
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.6
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.59
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.59
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.59
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.58
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.58
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.57
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.57
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.57
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.56
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.55
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.54
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.53
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.52
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.51
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.51
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.51
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.49
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.48
d1fc6a392 Photosystem II D1 C-terminal processing protease { 99.48
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.45
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.45
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.44
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.41
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 99.39
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.36
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 99.29
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 99.2
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 99.17
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 98.99
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.98
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.94
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.9
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.86
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Na+/H+ exchanger regulatory factor, NHERF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.79  E-value=1.2e-18  Score=115.18  Aligned_cols=87  Identities=37%  Similarity=0.551  Sum_probs=77.0

Q ss_pred             CCceEEEEecCCCCCceeEEEeceeecCchhhhhhcCCcccceeeeeccCCCCceEEEeeCCCCHHhHcCCCCCCEEEEE
Q psy16403         22 LGPRNLILRRSAALNGFGFTLRHFIVYPPESYTVLAGDRRLGLRSRCMDEPMDTIFIKHVRPHSPAAAAGLVPGDRVVAV  101 (177)
Q Consensus        22 ~~~r~v~l~r~~~~~~~Gf~l~~~~~~~~~~~~~~~g~~~~g~~~~~~~~~~~~~~V~~V~~gs~A~~aGl~~GD~I~~I  101 (177)
                      ..||+|+|.|+.  .+|||++.+             +.            ...+++|..|.++|+|+++||++||+|++|
T Consensus         2 ~~Pr~v~l~k~~--~g~Gf~i~~-------------~~------------~~~~~~V~~V~~g~~A~~aGl~~GD~Il~V   54 (91)
T d1g9oa_           2 MLPRLCCLEKGP--NGYGFHLHG-------------EK------------GKLGQYIRLVEPGSPAEKAGLLAGDRLVEV   54 (91)
T ss_dssp             CCCEEEEEECBT--TBCCEEEEE-------------CT------------TCSSEEEEEECTTSHHHHTTCCTTCEEEEE
T ss_pred             CCCEEEEEEECC--CeeeEEEEe-------------cC------------CCCCEEEEEEcCCCHHHHcCCCCCCEEEEE
Confidence            468999999998  889999986             21            224689999999999999999999999999


Q ss_pred             CCEEcCCCCHHHHHHHHHcCCCeEEEEEEeCCcc
Q psy16403        102 NNQTIADLPYAEVVQLIQNSPAYLHLLVVPKEND  135 (177)
Q Consensus       102 ng~~v~~~~~~~~~~~l~~~~~~v~l~v~~~~~~  135 (177)
                      ||.++.++++++++.+++..++.+.|++++.+.+
T Consensus        55 Ng~~v~~~t~~e~~~ll~~~~~~v~L~v~~~~~~   88 (91)
T d1g9oa_          55 NGENVEKETHQQVVSRIRAALNAVRLLVVDPETD   88 (91)
T ss_dssp             TTEECTTCCHHHHHHHHHTCSSEEEEEEECCCCS
T ss_pred             CCEECCCCCHHHHHHHHHcCCCeEEEEEECCCCC
Confidence            9999999999999999999999999999876543
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure