Psyllid ID: psy1645

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MLACTEPATHNALAKIYIDSNNNPERFLKFFLVDHLSKTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETSHATESWEDLVRYLQMARKKARESYIESELIYAYARTNRLADLEEFISGEGFFEIL
ccccccHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHccccccccc
ccccccHHHHHHHHHHHHHccccHHHHEEHcccccHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHccccccccc
mlactepathNALAKIYidsnnnpeRFLKFFLVDhlsktpfyvlrcnepgvWSQLAKAQLQKGLVKESIDSfikaddpsaymDVVETSHATESWEDLVRYLQMARKKARESYIESELIYAYARTNRLADLeefisgegffEIL
mlactepathnALAKIYIDSNNNPERFLKFFLVDHLSKTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETshatesweDLVRYLQMARKKARESYIESELIYAYARTNRLADLEEFIsgegffeil
MLACTEPATHNALAKIYIDSNNNPERFLKFFLVDHLSKTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETSHATESWEDLVRYLQMARKKARESYIESELIYAYARTNRLADLeefisgegffeiL
**********NALAKIYIDSNNNPERFLKFFLVDHLSKTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETSHATESWEDLVRYLQMARKKARESYIESELIYAYARTNRLADLEEFISGEGFF***
*LACTEPATHNALAKIYIDSNNNPERFLKFFLVDHLSKTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETSHATESWEDLVRYLQMAR******YIESELIYAYARTNRLADLEEFISGEGFF**L
MLACTEPATHNALAKIYIDSNNNPERFLKFFLVDHLSKTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETSHATESWEDLVRYLQ*********YIESELIYAYARTNRLADLEEFISGEGFFEIL
MLACTEPATHNALAKIYIDSNNNPERFLKFFLVDHLSKTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETSHATESWEDLVRYLQMARKKARESYIESELIYAYARTNRLADLEEFISGEG*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLACTEPATHNALAKIYIDSNNNPERFLKFFLVDHLSKTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETSHATESWEDLVRYLQMARKKARESYIESELIYAYARTNRLADLEEFISGEGFFEIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query143 2.2.26 [Sep-21-2011]
P29742 1678 Clathrin heavy chain OS=D yes N/A 0.769 0.065 0.745 2e-42
Q68FD5 1675 Clathrin heavy chain 1 OS yes N/A 0.727 0.062 0.682 3e-38
P49951 1675 Clathrin heavy chain 1 OS yes N/A 0.727 0.062 0.673 8e-38
P11442 1675 Clathrin heavy chain 1 OS yes N/A 0.727 0.062 0.673 8e-38
Q00610 1675 Clathrin heavy chain 1 OS yes N/A 0.727 0.062 0.673 8e-38
P34574 1681 Probable clathrin heavy c yes N/A 0.769 0.065 0.609 2e-34
P53675 1640 Clathrin heavy chain 2 OS no N/A 0.727 0.063 0.586 4e-33
Q2QYW2 1708 Clathrin heavy chain 2 OS yes N/A 0.594 0.049 0.516 7e-24
Q2RBN7 1708 Clathrin heavy chain 1 OS yes N/A 0.594 0.049 0.516 7e-24
Q0WNJ6 1705 Clathrin heavy chain 1 OS yes N/A 0.650 0.054 0.516 2e-23
>sp|P29742|CLH_DROME Clathrin heavy chain OS=Drosophila melanogaster GN=Chc PE=2 SV=1 Back     alignment and function desciption
 Score =  171 bits (432), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/110 (74%), Positives = 94/110 (85%)

Query: 33   VDHLSKTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETSHATE 92
            V++L +   +  RCNEP VWSQLAKAQLQ+GLVKE+IDS+IKADDPSAY+DVV+ +   E
Sbjct: 1090 VNNLERANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSYIKADDPSAYVDVVDVASKVE 1149

Query: 93   SWEDLVRYLQMARKKARESYIESELIYAYARTNRLADLEEFISGEGFFEI 142
            SW+DLVRYLQMARKKARESYIESELIYAYART RLADLEEFISG    +I
Sbjct: 1150 SWDDLVRYLQMARKKARESYIESELIYAYARTGRLADLEEFISGPNHADI 1199
Clathrin is the major protein of the polyhedral coat of coated pits and vesicles.
Drosophila melanogaster (taxid: 7227)
>sp|Q68FD5|CLH1_MOUSE Clathrin heavy chain 1 OS=Mus musculus GN=Cltc PE=1 SV=3 Back     alignment and function description
>sp|P49951|CLH1_BOVIN Clathrin heavy chain 1 OS=Bos taurus GN=CLTC PE=1 SV=1 Back     alignment and function description
>sp|P11442|CLH1_RAT Clathrin heavy chain 1 OS=Rattus norvegicus GN=Cltc PE=1 SV=3 Back     alignment and function description
>sp|Q00610|CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 Back     alignment and function description
>sp|P34574|CLH_CAEEL Probable clathrin heavy chain 1 OS=Caenorhabditis elegans GN=chc-1 PE=3 SV=1 Back     alignment and function description
>sp|P53675|CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens GN=CLTCL1 PE=1 SV=2 Back     alignment and function description
>sp|Q2QYW2|CLH2_ORYSJ Clathrin heavy chain 2 OS=Oryza sativa subsp. japonica GN=Os12g0104800 PE=3 SV=1 Back     alignment and function description
>sp|Q2RBN7|CLH1_ORYSJ Clathrin heavy chain 1 OS=Oryza sativa subsp. japonica GN=Os11g0104900 PE=3 SV=1 Back     alignment and function description
>sp|Q0WNJ6|CLAH1_ARATH Clathrin heavy chain 1 OS=Arabidopsis thaliana GN=CHC1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
262304441 309 clathrin heavy chain [Ephemerella incons 0.776 0.359 0.815 9e-46
262304421 309 clathrin heavy chain [Ctenolepisma linea 0.776 0.359 0.807 3e-45
262304481 309 clathrin heavy chain [Nicoletia meinerti 0.776 0.359 0.807 4e-45
262304483 309 clathrin heavy chain [Periplaneta americ 0.769 0.355 0.809 1e-44
262304407 309 clathrin heavy chain [Acheta domesticus] 0.769 0.355 0.809 2e-44
262304473 309 clathrin heavy chain [Hexagenia limbata] 0.734 0.339 0.824 3e-44
157814282 309 putative clathrin heavy chain [Speleonec 0.769 0.355 0.790 1e-43
262304457 309 clathrin heavy chain [Ischnura verticali 0.727 0.336 0.826 2e-43
262304465 309 clathrin heavy chain [Plathemis lydia] 0.769 0.355 0.790 2e-43
262304491 309 clathrin heavy chain [Pedetontus saltato 0.769 0.355 0.781 5e-43
>gi|262304441|gb|ACY44813.1| clathrin heavy chain [Ephemerella inconstans] Back     alignment and taxonomy information
 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 93/114 (81%), Positives = 100/114 (87%), Gaps = 3/114 (2%)

Query: 32  LVDHLS---KTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETS 88
           L+DH+S   +   +  RCNEP VWSQLAKAQLQ+GLVKE+IDSFIKADDPSAYMDVVETS
Sbjct: 30  LIDHVSNLDRAYEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSFIKADDPSAYMDVVETS 89

Query: 89  HATESWEDLVRYLQMARKKARESYIESELIYAYARTNRLADLEEFISGEGFFEI 142
           H TESWEDLVRYLQMARKKARESYIESELIYAYARTNRLADLEEFISG    +I
Sbjct: 90  HKTESWEDLVRYLQMARKKARESYIESELIYAYARTNRLADLEEFISGPNHADI 143

Source: Ephemerella inconstans

Species: Ephemerella inconstans

Genus: Ephemerella

Family: Ephemerellidae

Order: Ephemeroptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|262304421|gb|ACY44803.1| clathrin heavy chain [Ctenolepisma lineata] Back     alignment and taxonomy information
>gi|262304481|gb|ACY44833.1| clathrin heavy chain [Nicoletia meinerti] Back     alignment and taxonomy information
>gi|262304483|gb|ACY44834.1| clathrin heavy chain [Periplaneta americana] Back     alignment and taxonomy information
>gi|262304407|gb|ACY44796.1| clathrin heavy chain [Acheta domesticus] Back     alignment and taxonomy information
>gi|262304473|gb|ACY44829.1| clathrin heavy chain [Hexagenia limbata] Back     alignment and taxonomy information
>gi|157814282|gb|ABV81886.1| putative clathrin heavy chain [Speleonectes tulumensis] Back     alignment and taxonomy information
>gi|262304457|gb|ACY44821.1| clathrin heavy chain [Ischnura verticalis] Back     alignment and taxonomy information
>gi|262304465|gb|ACY44825.1| clathrin heavy chain [Plathemis lydia] Back     alignment and taxonomy information
>gi|262304491|gb|ACY44838.1| clathrin heavy chain [Pedetontus saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query143
FB|FBgn0000319 1678 Chc "Clathrin heavy chain" [Dr 0.685 0.058 0.765 4.2e-45
UNIPROTKB|K7GQL8 911 CLTC "Uncharacterized protein" 0.692 0.108 0.656 1.4e-42
UNIPROTKB|F6PV15 919 CLTC "Uncharacterized protein" 0.692 0.107 0.656 1.4e-42
ZFIN|ZDB-GENE-030131-2299 1680 cltca "clathrin, heavy polypep 0.692 0.058 0.686 3.1e-42
UNIPROTKB|F1NW23 1662 CLTC "Uncharacterized protein" 0.692 0.059 0.666 3.8e-42
MGI|MGI:2388633 1675 Cltc "clathrin, heavy polypept 0.692 0.059 0.666 3.9e-42
UNIPROTKB|F1MPU0 1661 CLTC "Clathrin heavy chain 1" 0.692 0.059 0.656 1e-41
UNIPROTKB|P49951 1675 CLTC "Clathrin heavy chain 1" 0.692 0.059 0.656 1e-41
UNIPROTKB|F1PHQ0 1675 CLTC "Uncharacterized protein" 0.692 0.059 0.656 1e-41
UNIPROTKB|Q00610 1675 CLTC "Clathrin heavy chain 1" 0.692 0.059 0.656 1e-41
FB|FBgn0000319 Chc "Clathrin heavy chain" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 387 (141.3 bits), Expect = 4.2e-45, Sum P(2) = 4.2e-45
 Identities = 75/98 (76%), Positives = 86/98 (87%)

Query:    33 VDHLSKTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETSHATE 92
             V++L +   +  RCNEP VWSQLAKAQLQ+GLVKE+IDS+IKADDPSAY+DVV+ +   E
Sbjct:  1090 VNNLERANEFAERCNEPAVWSQLAKAQLQQGLVKEAIDSYIKADDPSAYVDVVDVASKVE 1149

Query:    93 SWEDLVRYLQMARKKARESYIESELIYAYARTNRLADL 130
             SW+DLVRYLQMARKKARESYIESELIYAYART RLADL
Sbjct:  1150 SWDDLVRYLQMARKKARESYIESELIYAYARTGRLADL 1187
GO:0007291 "sperm individualization" evidence=IMP
GO:0016183 "synaptic vesicle coating" evidence=NAS;TAS
GO:0008021 "synaptic vesicle" evidence=TAS
GO:0030125 "clathrin vesicle coat" evidence=TAS
GO:0005905 "coated pit" evidence=TAS
GO:0030135 "coated vesicle" evidence=TAS
GO:0007269 "neurotransmitter secretion" evidence=NAS
GO:0030129 "clathrin coat of synaptic vesicle" evidence=NAS
GO:0030132 "clathrin coat of coated pit" evidence=IEA;NAS
GO:0030130 "clathrin coat of trans-Golgi network vesicle" evidence=IEA
GO:0005198 "structural molecule activity" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0033227 "dsRNA transport" evidence=IMP
GO:0005811 "lipid particle" evidence=IDA
GO:0035002 "liquid clearance, open tracheal system" evidence=IMP
GO:0030198 "extracellular matrix organization" evidence=IMP
GO:0035159 "regulation of tube length, open tracheal system" evidence=IMP
GO:0045807 "positive regulation of endocytosis" evidence=IMP
GO:0046667 "compound eye retinal cell programmed cell death" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0031410 "cytoplasmic vesicle" evidence=IDA
GO:0030136 "clathrin-coated vesicle" evidence=IDA
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
GO:0044459 "plasma membrane part" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0006897 "endocytosis" evidence=IMP
GO:0045747 "positive regulation of Notch signaling pathway" evidence=IMP
GO:0040008 "regulation of growth" evidence=IMP
GO:0033363 "secretory granule organization" evidence=IMP
GO:0030141 "secretory granule" evidence=IDA
GO:0007594 "puparial adhesion" evidence=IMP
GO:0048749 "compound eye development" evidence=IMP
UNIPROTKB|K7GQL8 CLTC "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F6PV15 CLTC "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2299 cltca "clathrin, heavy polypeptide a (Hc)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NW23 CLTC "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2388633 Cltc "clathrin, heavy polypeptide (Hc)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MPU0 CLTC "Clathrin heavy chain 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P49951 CLTC "Clathrin heavy chain 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PHQ0 CLTC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q00610 CLTC "Clathrin heavy chain 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P34574CLH_CAEELNo assigned EC number0.60900.76920.0654yesN/A
P11442CLH1_RATNo assigned EC number0.67300.72720.0620yesN/A
Q00610CLH1_HUMANNo assigned EC number0.67300.72720.0620yesN/A
Q2RBN7CLH1_ORYSJNo assigned EC number0.51610.59440.0497yesN/A
P29742CLH_DROMENo assigned EC number0.74540.76920.0655yesN/A
P49951CLH1_BOVINNo assigned EC number0.67300.72720.0620yesN/A
Q0WNJ6CLAH1_ARATHNo assigned EC number0.51610.65030.0545yesN/A
Q0WLB5CLAH2_ARATHNo assigned EC number0.50530.65030.0546yesN/A
Q68FD5CLH1_MOUSENo assigned EC number0.68260.72720.0620yesN/A
Q2QYW2CLH2_ORYSJNo assigned EC number0.51610.59440.0497yesN/A
P25870CLH_DICDINo assigned EC number0.52170.64330.0543yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
pfam00637143 pfam00637, Clathrin, Region in Clathrin and VPS 2e-04
smart00299140 smart00299, CLH, Clathrin heavy chain repeat homol 5e-04
>gnl|CDD|216037 pfam00637, Clathrin, Region in Clathrin and VPS Back     alignment and domain information 
 Score = 38.8 bits (91), Expect = 2e-04
 Identities = 18/66 (27%), Positives = 30/66 (45%), Gaps = 2/66 (3%)

Query: 72  FIKADDPSAYMDVVETSHATESWEDLVRYLQMARKKARESY--IESELIYAYARTNRLAD 129
            I+  DP     VV+        E+L+ YL+ A K+       +++ L+  YA+      
Sbjct: 1   LIELTDPIDISRVVKLFEKRGLLEELIPYLESALKENSRENPALQTALLELYAKYEDPEK 60

Query: 130 LEEFIS 135
           LEEF+ 
Sbjct: 61  LEEFLK 66

Each region is about 140 amino acids long. The regions are composed of multiple alpha helical repeats. They occur in the arm region of the Clathrin heavy chain. Length = 143
>gnl|CDD|128594 smart00299, CLH, Clathrin heavy chain repeat homology Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 143
KOG0985|consensus 1666 100.0
KOG0985|consensus 1666 98.6
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 97.69
PLN03077 857 Protein ECB2; Provisional 96.46
PLN03077 857 Protein ECB2; Provisional 96.4
smart00299140 CLH Clathrin heavy chain repeat homology. 96.19
smart00299140 CLH Clathrin heavy chain repeat homology. 96.14
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.75
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 95.74
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 95.66
PLN03218 1060 maturation of RBCL 1; Provisional 94.71
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 94.24
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 94.2
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 94.06
PRK11788 389 tetratricopeptide repeat protein; Provisional 93.93
PRK11788389 tetratricopeptide repeat protein; Provisional 93.48
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 93.33
PRK12370553 invasion protein regulator; Provisional 93.22
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 93.12
PLN03218 1060 maturation of RBCL 1; Provisional 93.0
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 92.7
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 91.99
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 91.57
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 90.92
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 90.45
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 89.54
PRK11189296 lipoprotein NlpI; Provisional 89.5
PRK15359144 type III secretion system chaperone protein SscB; 88.12
KOG0276|consensus794 87.77
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 84.72
TIGR02552135 LcrH_SycD type III secretion low calcium response 83.11
PRK10370198 formate-dependent nitrite reductase complex subuni 83.01
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 81.35
KOG2114|consensus 933 80.95
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 80.95
>KOG0985|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.4e-51  Score=386.81  Aligned_cols=111  Identities=59%  Similarity=1.003  Sum_probs=108.6

Q ss_pred             HHHhcc---chhHHHHHhcchhHHHHHHHHhhhhhhhHHHHHHHHhCCCcchHHHHHHHHHcCCChHHHHHHHHHHHhhh
Q psy1645          32 LVDHLS---KTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETSHATESWEDLVRYLQMARKKA  108 (143)
Q Consensus        32 Li~~~~---~narYa~k~~~~~vWs~l~raqL~~~~V~eAI~sFIkA~dps~y~eVie~a~~~~~~e~Lv~yL~MaRk~~  108 (143)
                      ||++++   |+++||+||++|+|||++++|||++++|++||+|||||+|||+|++||+.|+++|+||||||||+|||||+
T Consensus      1084 Lie~i~~ldRA~efAe~~n~p~vWsqlakAQL~~~~v~dAieSyikadDps~y~eVi~~a~~~~~~edLv~yL~MaRkk~ 1163 (1666)
T KOG0985|consen 1084 LIENIGSLDRAYEFAERCNEPAVWSQLAKAQLQGGLVKDAIESYIKADDPSNYLEVIDVASRTGKYEDLVKYLLMARKKV 1163 (1666)
T ss_pred             HHHHhhhHHHHHHHHHhhCChHHHHHHHHHHHhcCchHHHHHHHHhcCCcHHHHHHHHHHHhcCcHHHHHHHHHHHHHhh
Confidence            888777   68999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhHHHHHHHHHHhcCChhhHHHHhcCcCCCCC
Q psy1645         109 RESYIESELIYAYARTNRLADLEEFISGEGFFEI  142 (143)
Q Consensus       109 ke~~idt~Li~ayAk~~~l~ele~fl~~~N~a~~  142 (143)
                      |||+||||||||||||||++|||+||.|||+|||
T Consensus      1164 ~E~~id~eLi~AyAkt~rl~elE~fi~gpN~A~i 1197 (1666)
T KOG0985|consen 1164 REPYIDSELIFAYAKTNRLTELEEFIAGPNVANI 1197 (1666)
T ss_pred             cCccchHHHHHHHHHhchHHHHHHHhcCCCchhH
Confidence            9999999999999999999999999999999997

>KOG0985|consensus Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
1xi4_A 1630 Clathrin D6 Coat Length = 1630 1e-35
1b89_A 449 Clathrin Heavy Chain Proximal Leg Segment (Bovine) 1e-35
3lvg_A 624 Crystal Structure Of A Clathrin Heavy Chain And Cla 2e-35
>pdb|1XI4|A Chain A, Clathrin D6 Coat Length = 1630 Back     alignment and structure 
Iteration: 1

 Score =  145 bits (365), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 86/98 (87%)
Query: 33   VDHLSKTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETSHATE 92
            + +L +   +  RCNEP VWSQLAKAQLQKG+VKE+IDS+IKADDPS+YM+VV+ ++ + 
Sbjct: 1089 IGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANTSG 1148
Query: 93   SWEDLVRYLQMARKKARESYIESELIYAYARTNRLADL 130
            +WE+LV+YLQMARKKARESY+E+ELI+A A+TNRLA+L
Sbjct: 1149 NWEELVKYLQMARKKARESYVETELIFALAKTNRLAEL 1186
>pdb|1B89|A Chain A, Clathrin Heavy Chain Proximal Leg Segment (Bovine) Length = 449 Back     alignment and structure
>pdb|3LVG|A Chain A, Crystal Structure Of A Clathrin Heavy Chain And Clathrin Lig Complex Length = 624 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query143
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 9e-43
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 1e-41
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 3e-35
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 3e-07
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Length = 449 Back     alignment and structure
 Score =  145 bits (367), Expect = 9e-43
 Identities = 69/95 (72%), Positives = 88/95 (92%)

Query: 42  YVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETSHATESWEDLVRYL 101
           +  RCNEP VWSQLAKAQLQKG+VKE+IDS+IKADDPS+YM+VV+ ++ + +WE+LV+YL
Sbjct: 25  FAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANTSGNWEELVKYL 84

Query: 102 QMARKKARESYIESELIYAYARTNRLADLEEFISG 136
           QMARKKARESY+E+ELI+A A+TNRLA+LEEFI+G
Sbjct: 85  QMARKKARESYVETELIFALAKTNRLAELEEFING 119
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Length = 624 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Length = 1630 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
3lvg_A 624 Clathrin heavy chain 1; SELF assembly, coated PIT, 100.0
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.98
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.92
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.58
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 97.2
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 97.01
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.99
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.95
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 96.94
4eqf_A365 PEX5-related protein; accessory protein, tetratric 96.91
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 96.88
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 96.88
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.79
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 96.63
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.62
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 96.5
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.5
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.47
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 96.46
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 96.45
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 96.43
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 96.38
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 96.32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 96.31
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 96.29
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 96.26
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 96.25
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.25
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.23
4eqf_A365 PEX5-related protein; accessory protein, tetratric 96.22
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 96.2
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.17
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 96.13
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.13
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 95.99
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 95.99
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 95.97
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 95.96
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 95.88
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 95.74
4i17_A228 Hypothetical protein; TPR repeats protein, structu 95.66
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 95.64
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 95.61
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 95.57
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 95.56
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 95.55
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 95.54
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 95.48
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 95.42
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 95.41
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 95.41
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 95.38
3q49_B137 STIP1 homology and U box-containing protein 1; E3 95.38
2gw1_A514 Mitochondrial precursor proteins import receptor; 95.38
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 95.32
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 95.26
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 95.12
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 95.09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 95.04
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 95.03
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 95.03
3u4t_A 272 TPR repeat-containing protein; structural genomics 95.0
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 94.87
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 94.71
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 94.56
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 94.52
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 94.41
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 94.35
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 94.32
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 94.31
3q49_B137 STIP1 homology and U box-containing protein 1; E3 94.29
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 94.29
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 94.19
2gw1_A 514 Mitochondrial precursor proteins import receptor; 94.12
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 94.11
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 94.05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 93.92
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 93.9
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 93.87
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 93.85
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 93.84
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 93.83
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 93.77
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 93.77
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 93.74
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 93.74
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 93.67
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 93.66
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 93.61
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 93.59
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 93.55
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 93.46
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 93.31
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 93.24
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 93.22
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 93.21
2l6j_A111 TPR repeat-containing protein associated with HSP; 93.21
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 93.16
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 93.12
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 93.07
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 92.98
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 92.97
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 92.83
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 92.49
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 92.39
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 92.37
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 92.34
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 92.33
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 92.3
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 91.96
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 91.84
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 91.66
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 91.56
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 91.44
3u4t_A 272 TPR repeat-containing protein; structural genomics 91.39
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 91.26
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 91.2
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 91.15
3q15_A378 PSP28, response regulator aspartate phosphatase H; 90.43
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 90.39
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 90.27
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 89.58
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 89.27
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 88.74
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 88.69
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 88.56
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 88.51
2kat_A115 Uncharacterized protein; NESG, structure, structur 88.23
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 87.77
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 87.49
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 87.44
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 87.16
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 87.08
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 86.64
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 86.09
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 85.98
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 85.69
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 85.28
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 85.25
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 84.46
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 84.41
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 83.51
3q15_A378 PSP28, response regulator aspartate phosphatase H; 83.5
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 83.29
2kat_A115 Uncharacterized protein; NESG, structure, structur 83.21
3k9i_A117 BH0479 protein; putative protein binding protein, 82.39
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 82.12
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 82.06
2l6j_A111 TPR repeat-containing protein associated with HSP; 82.04
3k9i_A117 BH0479 protein; putative protein binding protein, 80.9
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 80.77
3u3w_A293 Transcriptional activator PLCR protein; ternary co 80.39
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
Probab=100.00  E-value=9.5e-46  Score=331.78  Aligned_cols=128  Identities=57%  Similarity=0.921  Sum_probs=115.5

Q ss_pred             HHHHHHhhCCCHHHHHHHHHHHhcc---chhHHHHHhcchhHHHHHHHHhhhhhhhHHHHHHHHhCCCcchHHHHHHHHH
Q psy1645          13 LAKIYIDSNNNPERFLKFFLVDHLS---KTPFYVLRCNEPGVWSQLAKAQLQKGLVKESIDSFIKADDPSAYMDVVETSH   89 (143)
Q Consensus        13 lakIyi~~~~~~E~fl~~~Li~~~~---~narYa~k~~~~~vWs~l~raqL~~~~V~eAI~sFIkA~dps~y~eVie~a~   89 (143)
                      ++.||-+.+.+.++.  +|||+++.   |+.+||+||++|+|||+||+|||++++|++||+|||||+|||+|.+||++|+
T Consensus        17 AF~iykKf~~~~~A~--~VL~e~i~~ldRa~eyA~~~n~p~VWs~LgkAqL~~~~v~eAIdsyIkA~Dps~y~eVi~~A~   94 (624)
T 3lvg_A           17 RGSHMLKFDVNTSAV--QVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAAN   94 (624)
T ss_dssp             ----------CCSTT--TTCCGGGCCSTTTTTSSSSCCCCCCSSSHHHHTTTSSSCTTTTTSSCCCSCCCSSSHHHHHTT
T ss_pred             HHHHHHhccCcHHHH--HHHHHhccccHHHHHHHHHhCCccHHHHHHHHHHccCchHHHHHHHHhCCChHHHHHHHHHHH
Confidence            567999999999988  89999877   7899999999999999999999999999999999999999999999999999


Q ss_pred             cCCChHHHHHHHHHHHhhhhhhhHHHHHHHHHHhcCChhhHHHHhcCcCCCCC
Q psy1645          90 ATESWEDLVRYLQMARKKARESYIESELIYAYARTNRLADLEEFISGEGFFEI  142 (143)
Q Consensus        90 ~~~~~e~Lv~yL~MaRk~~ke~~idt~Li~ayAk~~~l~ele~fl~~~N~a~~  142 (143)
                      ++|+||||||||+||||++|||+|||+|+|||||+|||+|||+||+|||+|||
T Consensus        95 ~~~~~edLv~yL~MaRk~~ke~~IDteLi~ayAk~~rL~elEefl~~~N~A~i  147 (624)
T 3lvg_A           95 TSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHI  147 (624)
T ss_dssp             TSSCCTTHHHHHHTTSTTCCSTTTTHHHHHHHHTSCSSSTTTSTTSCCSSSCT
T ss_pred             hCCCHHHHHHHHHHHHHHhcccccHHHHHHHHHhhCcHHHHHHHHcCCCcccH
Confidence            99999999999999999999999999999999999999999999999999997
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query143
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.25
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.44
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.49
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 94.45
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 94.44
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 93.29
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 92.4
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 92.37
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 92.3
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 91.91
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 90.13
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 87.5
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 87.3
d2g5ca1110 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 86.4
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 85.63
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 84.6
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 81.69
d2pv7a1128 Prephenate dehydrogenase TyrA {Haemophilus influen 81.36
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 81.04
d2f1ka1114 Prephenate dehydrogenase TyrA {Synechocystis sp. p 80.73
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Clathrin heavy chain proximal leg segment
domain: Clathrin heavy chain proximal leg segment
species: Cow (Bos taurus) [TaxId: 9913]

Probab=98.25  E-value=6.9e-07  Score=73.13  Aligned_cols=134  Identities=13%  Similarity=0.070  Sum_probs=98.3

Q ss_pred             CcchHHHHHHHHHHHhhCCCHHHHHHHHHHHhcc--chhHHHHHhcchhHHHHHHHHhhhhhhhHHH-HHHHHhCCCcch
Q psy1645           4 CTEPATHNALAKIYIDSNNNPERFLKFFLVDHLS--KTPFYVLRCNEPGVWSQLAKAQLQKGLVKES-IDSFIKADDPSA   80 (143)
Q Consensus         4 ~~~~~~~nalakIyi~~~~~~E~fl~~~Li~~~~--~narYa~k~~~~~vWs~l~raqL~~~~V~eA-I~sFIkA~dps~   80 (143)
                      |.+.++|.+++-+|-+.+++....  ..+|+.-+  .+.+++.+.+.+++|.++..+-+.......+ +-....-.+|..
T Consensus        24 c~~~~lye~A~~lY~~~~d~~rl~--~~~v~l~~~~~avd~~~k~~~~~~~k~~~~~l~~~~e~~la~i~~~~~~~~~d~  101 (336)
T d1b89a_          24 CYDEKMYDAAKLLYNNVSNFGRLA--STLVHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLAQMCGLHIVVHADE  101 (336)
T ss_dssp             -----CTTTHHHHHHHTTCHHHHH--HHHHTTTCHHHHHHHHHHHTCHHHHHHHHHHHHHTTCHHHHHHTTTTTTTCHHH
T ss_pred             HHHCCCHHHHHHHHHhCCCHHHHH--HHHHhhccHHHHHHHHHHcCCHHHHHHHHHHHHhCcHHHHHHHHHHHhhcCHHH
Confidence            567888999999998888877666  44555332  4578999999999999998876665433322 334556679999


Q ss_pred             HHHHHHHHHcCCChHHHHHHHHHHHh-hhhhhhHHHHHHHHHHhcCChhhHHHHhcCcCC
Q psy1645          81 YMDVVETSHATESWEDLVRYLQMARK-KARESYIESELIYAYARTNRLADLEEFISGEGF  139 (143)
Q Consensus        81 y~eVie~a~~~~~~e~Lv~yL~MaRk-~~ke~~idt~Li~ayAk~~~l~ele~fl~~~N~  139 (143)
                      +.+++..-+..|.+++|+.||..+=. ...++.+=|+|+.+|||.++-..+|-+-..+|.
T Consensus       102 l~~~v~~ye~~~~~e~Li~~Le~~~~~~~~~~~~~~~L~~lyak~~~~kl~e~l~~~s~~  161 (336)
T d1b89a_         102 LEELINYYQDRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQKMREHLELFWSR  161 (336)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHTTSTTCCHHHHHHHHHHHHTTCHHHHHHHHHHHSTT
T ss_pred             HHHHHHHHHHcCChHHHHHHHHHHHcCCccchHHHHHHHHHHHHhChHHHHHHHHhcccc
Confidence            99999999999999999999996532 356777889999999999986555544433443
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g5ca1 a.100.1.12 (A:201-310) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a1 a.100.1.12 (A:244-371) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f1ka1 a.100.1.12 (A:166-279) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure