Psyllid ID: psy16513


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MQARIYELEEEVEVERQSRAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAEMSKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLKTKLDEANRTINDLDVARKKLIIENSDLVRQLSKVTADARMWKIKYETNKPKD
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
MQARIYELEEEVEVERQSRAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAEMSKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLKTKLDEANRTINDLDVARKKLIIENSDLVRQLSKVTADARMWKIKYETNKPKD
mqariyeleeeveverqsrakaeKQRADLARELEELGerleeaggatsaqielnKKREAEMSKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLktkldeanrtindldvarkkliiensdlvrqlskvtadarmwkikyetnkpkd
MQARIYeleeeveveRQSRAKAEKQradlareleelgerleeaggaTSAQIELNKKREAEMSKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLKTKLDEANRTINDLDVARKKLIIENSDLVRQLSKVTADARMWKIKYETNKPKD
****************************************************************************************************************TINDLDVARKKLIIENSDLVRQLSKVTADARMWKIKY*******
MQARIYELEEEVE***************LARELEE*************************************************************************************************************************
MQARIYELE******************DLARELEELGERLEEAGGATSAQIELNKKREAEMSKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLKTKLDEANRTINDLDVARKKLIIENSDLVRQLSKVTADARMWKIKYETNKPKD
MQ**IYELEEEVEVERQSRAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAEMSKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLKTKLDEANRTINDLDVARKKLIIENSDLVRQLSKVTADARMWKIKYE******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQARxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTSAQIELxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNSDLVRQLSKVTADARMWKIKYETNKPKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query156 2.2.26 [Sep-21-2011]
P05661 1962 Myosin heavy chain, muscl yes N/A 0.865 0.068 0.651 4e-41
P13535 1937 Myosin-8 OS=Homo sapiens yes N/A 0.660 0.053 0.722 2e-33
Q9TV62 1937 Myosin-4 OS=Sus scrofa GN yes N/A 0.692 0.055 0.731 4e-33
Q9BE40 1938 Myosin-1 OS=Bos taurus GN yes N/A 0.756 0.060 0.506 4e-33
P24733 1938 Myosin heavy chain, stria N/A N/A 0.865 0.069 0.497 7e-33
P02563 1938 Myosin-6 OS=Rattus norveg yes N/A 0.923 0.074 0.479 7e-33
P13533 1939 Myosin-6 OS=Homo sapiens no N/A 0.858 0.069 0.5 1e-32
Q02566 1938 Myosin-6 OS=Mus musculus yes N/A 0.858 0.069 0.5 1e-32
Q9TV61 1939 Myosin-1 OS=Sus scrofa GN yes N/A 0.641 0.051 0.692 1e-32
Q5SX40 1942 Myosin-1 OS=Mus musculus no N/A 0.641 0.051 0.692 2e-32
>sp|P05661|MYSA_DROME Myosin heavy chain, muscle OS=Drosophila melanogaster GN=Mhc PE=1 SV=4 Back     alignment and function desciption
 Score =  166 bits (421), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 128/181 (70%), Gaps = 46/181 (25%)

Query: 1    MQARIYELEEEVEVERQSRAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAE 60
            +QARI ELEEEVE ERQ+RAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAE
Sbjct: 1110 LQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAE 1169

Query: 61   MSKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLK---------------- 104
            +SKLRRDLEEANIQHESTLANLRKKHNDAV+EM EQ+DQLNKLK                
Sbjct: 1170 LSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEHDRQTCHNELNQ 1229

Query: 105  ------------------------------TKLDEANRTINDLDVARKKLIIENSDLVRQ 134
                                          +KLDE NRT+ND D ++KKL IENSDL+RQ
Sbjct: 1230 TRTACDQLGRDKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQ 1289

Query: 135  L 135
            L
Sbjct: 1290 L 1290




Muscle contraction.
Drosophila melanogaster (taxid: 7227)
>sp|P13535|MYH8_HUMAN Myosin-8 OS=Homo sapiens GN=MYH8 PE=1 SV=3 Back     alignment and function description
>sp|Q9TV62|MYH4_PIG Myosin-4 OS=Sus scrofa GN=MYH4 PE=2 SV=1 Back     alignment and function description
>sp|Q9BE40|MYH1_BOVIN Myosin-1 OS=Bos taurus GN=MYH1 PE=2 SV=2 Back     alignment and function description
>sp|P24733|MYS_ARGIR Myosin heavy chain, striated muscle OS=Argopecten irradians PE=1 SV=1 Back     alignment and function description
>sp|P02563|MYH6_RAT Myosin-6 OS=Rattus norvegicus GN=Myh6 PE=2 SV=2 Back     alignment and function description
>sp|P13533|MYH6_HUMAN Myosin-6 OS=Homo sapiens GN=MYH6 PE=1 SV=5 Back     alignment and function description
>sp|Q02566|MYH6_MOUSE Myosin-6 OS=Mus musculus GN=Myh6 PE=1 SV=2 Back     alignment and function description
>sp|Q9TV61|MYH1_PIG Myosin-1 OS=Sus scrofa GN=MYH1 PE=2 SV=1 Back     alignment and function description
>sp|Q5SX40|MYH1_MOUSE Myosin-1 OS=Mus musculus GN=Myh1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
229472621 836 myosin heavy chain [Bombyx mandarina] 0.955 0.178 0.622 1e-47
170029180 1946 myosin-2 heavy chain [Culex quinquefasci 0.865 0.069 0.569 3e-45
328702403 1969 PREDICTED: myosin heavy chain, muscle is 0.865 0.068 0.662 1e-40
189239927 1960 PREDICTED: similar to Myosin heavy chain 0.865 0.068 0.662 2e-40
189239937 1960 PREDICTED: similar to Myosin heavy chain 0.865 0.068 0.662 2e-40
183979376 1965 muscle myosin heavy chain [Papilio xuthu 0.865 0.068 0.668 3e-40
197322818 836 myosin heavy chain [Bombyx mori] 0.955 0.178 0.627 3e-40
189239931 1960 PREDICTED: similar to Myosin heavy chain 0.865 0.068 0.657 7e-40
270011842 2287 hypothetical protein TcasGA2_TC005924 [T 0.865 0.059 0.657 7e-40
189239935 1960 PREDICTED: similar to Myosin heavy chain 0.865 0.068 0.657 8e-40
>gi|229472621|gb|ACQ72825.1| myosin heavy chain [Bombyx mandarina] Back     alignment and taxonomy information
 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 136/196 (69%), Gaps = 47/196 (23%)

Query: 1   MQARIYELEEEVEVERQSRAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAE 60
           +Q RI ELEEEVE ERQ+RAKAEKQRADLARE EELGERLEEAGGATSAQIELNKKREAE
Sbjct: 86  LQGRIEELEEEVESERQARAKAEKQRADLAREPEELGERLEEAGGATSAQIELNKKREAE 145

Query: 61  MSKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLK---------------- 104
           +SKLRRDLEEANIQHE+TLANLRKKHNDAVSEMGEQ+DQLNKLK                
Sbjct: 146 LSKLRRDLEEANIQHEATLANLRKKHNDAVSEMGEQLDQLNKLKAKAEKERAQYFSEVND 205

Query: 105 ------------------------------TKLDEANRTINDLDVARKKLIIENSDLVRQ 134
                                         +K DEANRT+NDLD A+KKL IENSDL+RQ
Sbjct: 206 LRAGLDHLSNEKAAQEKIVKQPQHQLNEVQSKADEANRTLNDLDAAKKKLSIENSDLLRQ 265

Query: 135 LSKVTAD-ARMWKIKY 149
           L +  +  +++ KIK 
Sbjct: 266 LEEAESQVSQLSKIKV 281




Source: Bombyx mandarina

Species: Bombyx mandarina

Genus: Bombyx

Family: Bombycidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170029180|ref|XP_001842471.1| myosin-2 heavy chain [Culex quinquefasciatus] gi|167881574|gb|EDS44957.1| myosin-2 heavy chain [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|328702403|ref|XP_001952092.2| PREDICTED: myosin heavy chain, muscle isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189239927|ref|XP_001814139.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 7 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189239937|ref|XP_001814083.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 6 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|183979376|dbj|BAG30740.1| muscle myosin heavy chain [Papilio xuthus] Back     alignment and taxonomy information
>gi|197322818|gb|ACH69160.1| myosin heavy chain [Bombyx mori] Back     alignment and taxonomy information
>gi|189239931|ref|XP_001813815.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 5 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270011842|gb|EFA08290.1| hypothetical protein TcasGA2_TC005924 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189239935|ref|XP_001813466.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 2 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
FB|FBgn0264695 1962 Mhc "Myosin heavy chain" [Dros 0.775 0.061 0.590 1.2e-27
MGI|MGI:1339711 1942 Myh1 "myosin, heavy polypeptid 0.897 0.072 0.427 2.9e-21
UNIPROTKB|F1LRV9 1942 Myh4 "Myosin-4" [Rattus norveg 0.897 0.072 0.427 2.9e-21
UNIPROTKB|F1SS62 1470 MYH1 "Myosin-1" [Sus scrofa (t 0.75 0.079 0.495 3.3e-21
UNIPROTKB|F1PQU7 1938 MYH13 "Myosin-13" [Canis lupus 0.897 0.072 0.427 3.7e-21
UNIPROTKB|Q076A5 1939 MYH4 "Myosin-4" [Canis lupus f 0.993 0.079 0.425 3.7e-21
UNIPROTKB|Q076A3 1940 MYH13 "Myosin-13" [Canis lupus 0.897 0.072 0.427 3.7e-21
UNIPROTKB|F1PMJ2 1859 MYH2 "Myosin-2" [Canis lupus f 0.75 0.062 0.495 4.5e-21
UNIPROTKB|Q076A4 1939 MYH8 "Myosin-8" [Canis lupus f 0.75 0.060 0.495 4.7e-21
UNIPROTKB|Q076A6 1939 MYH1 "Myosin-1" [Canis lupus f 0.75 0.060 0.495 4.7e-21
FB|FBgn0264695 Mhc "Myosin heavy chain" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 325 (119.5 bits), Expect = 1.2e-27, P = 1.2e-27
 Identities = 72/122 (59%), Positives = 81/122 (66%)

Query:     1 MQARIYXXXXXXXXXRQSRAKAEKQXXXXXXXXXXXXXXXXXXXXXTSAQIELNKKREAE 60
             +QARI          RQ+RAKAEKQ                     TSAQIELNKKREAE
Sbjct:  1110 LQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAE 1169

Query:    61 MSKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLKTKLDEANRTI-NDLDV 119
             +SKLRRDLEEANIQHESTLANLRKKHNDAV+EM EQ+DQLNKLK K +   +T  N+L+ 
Sbjct:  1170 LSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEHDRQTCHNELNQ 1229

Query:   120 AR 121
              R
Sbjct:  1230 TR 1231


GO:0006941 "striated muscle contraction" evidence=TAS
GO:0005863 "striated muscle myosin thick filament" evidence=IDA
GO:0008307 "structural constituent of muscle" evidence=IMP;TAS
GO:0005859 "muscle myosin complex" evidence=ISS;IDA
GO:0030017 "sarcomere" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0006936 "muscle contraction" evidence=IMP
GO:0040011 "locomotion" evidence=IMP
GO:0000146 "microfilament motor activity" evidence=ISS
GO:0005703 "polytene chromosome puff" evidence=IDA
GO:0007517 "muscle organ development" evidence=IMP
GO:0042623 "ATPase activity, coupled" evidence=ISS
GO:0016459 "myosin complex" evidence=ISS
GO:0030241 "skeletal muscle myosin thick filament assembly" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0030239 "myofibril assembly" evidence=IMP
GO:0007527 "adult somatic muscle development" evidence=IMP
GO:0030898 "actin-dependent ATPase activity" evidence=IDA
GO:0042692 "muscle cell differentiation" evidence=IMP
GO:0007298 "border follicle cell migration" evidence=IMP
GO:0060361 "flight" evidence=IMP
GO:0007427 "epithelial cell migration, open tracheal system" evidence=IMP
GO:0031672 "A band" evidence=IDA
GO:0050821 "protein stabilization" evidence=IMP
GO:0045214 "sarcomere organization" evidence=IMP
GO:0031033 "myosin filament organization" evidence=IMP
MGI|MGI:1339711 Myh1 "myosin, heavy polypeptide 1, skeletal muscle, adult" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRV9 Myh4 "Myosin-4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SS62 MYH1 "Myosin-1" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PQU7 MYH13 "Myosin-13" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q076A5 MYH4 "Myosin-4" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q076A3 MYH13 "Myosin-13" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PMJ2 MYH2 "Myosin-2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q076A4 MYH8 "Myosin-8" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q076A6 MYH1 "Myosin-1" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8MJV0MYH1_HORSENo assigned EC number0.69230.64100.0515yesN/A
Q8MJV1MYH2_HORSENo assigned EC number0.69230.64100.0516yesN/A
Q076A6MYH1_CANFANo assigned EC number0.69230.64100.0515yesN/A
Q076A7MYH2_CANFANo assigned EC number0.69230.64100.0515yesN/A
Q9TV61MYH1_PIGNo assigned EC number0.69230.64100.0515yesN/A
Q9TV62MYH4_PIGNo assigned EC number0.73140.69230.0557yesN/A
Q9TV63MYH2_PIGNo assigned EC number0.69230.64100.0515yesN/A
P05661MYSA_DROMENo assigned EC number0.65190.86530.0688yesN/A
Q9BE40MYH1_BOVINNo assigned EC number0.50600.75640.0608yesN/A
P13535MYH8_HUMANNo assigned EC number0.72220.66020.0531yesN/A
P13538MYSS_CHICKNo assigned EC number0.72520.58330.0469yesN/A
P02565MYH3_CHICKNo assigned EC number0.70320.58330.0469yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
pfam01576 859 pfam01576, Myosin_tail_1, Myosin tail 9e-33
pfam04156186 pfam04156, IncA, IncA protein 7e-04
pfam01576 859 pfam01576, Myosin_tail_1, Myosin tail 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.001
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.001
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.002
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.003
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.003
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.004
>gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail Back     alignment and domain information
 Score =  121 bits (306), Expect = 9e-33
 Identities = 79/109 (72%), Positives = 94/109 (86%)

Query: 2   QARIYELEEEVEVERQSRAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAEM 61
           +ARI ELEEE+E ER +RAKAEK RADL+RELEEL ERLEEAGGAT+AQIELNKKREAE+
Sbjct: 45  EARIRELEEELEAERAARAKAEKARADLSRELEELSERLEEAGGATAAQIELNKKREAEL 104

Query: 62  SKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLKTKLDEA 110
           +KLR+DLEEAN+QHE  LA LRKKH DA++E+ EQI+QL K K K ++ 
Sbjct: 105 AKLRKDLEEANLQHEEALATLRKKHQDAINELSEQIEQLQKQKAKAEKE 153


The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament. Length = 859

>gnl|CDD|217933 pfam04156, IncA, IncA protein Back     alignment and domain information
>gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 156
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 99.83
KOG0161|consensus 1930 99.73
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 98.8
KOG0161|consensus 1930 98.54
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 97.28
PF00038 312 Filament: Intermediate filament protein; InterPro: 97.16
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 97.0
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 96.94
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 96.61
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 96.43
PRK02224 880 chromosome segregation protein; Provisional 96.23
PF00038312 Filament: Intermediate filament protein; InterPro: 96.21
PRK11637 428 AmiB activator; Provisional 96.08
PRK04863 1486 mukB cell division protein MukB; Provisional 96.08
PRK09039 343 hypothetical protein; Validated 96.02
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 95.7
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 95.37
KOG0977|consensus 546 95.24
PF13851201 GAS: Growth-arrest specific micro-tubule binding 95.14
PRK02224 880 chromosome segregation protein; Provisional 94.92
PRK04778 569 septation ring formation regulator EzrA; Provision 94.9
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 94.85
KOG0612|consensus 1317 94.82
PHA02562 562 46 endonuclease subunit; Provisional 94.71
KOG0995|consensus 581 94.46
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 94.37
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 94.21
KOG0971|consensus 1243 94.03
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 93.99
PRK11637 428 AmiB activator; Provisional 93.96
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 93.86
PF06428100 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IP 93.79
KOG0996|consensus 1293 93.65
KOG4674|consensus 1822 93.61
PF13851201 GAS: Growth-arrest specific micro-tubule binding 93.61
KOG0977|consensus 546 93.15
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 93.13
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 92.93
KOG0996|consensus 1293 92.74
COG3883265 Uncharacterized protein conserved in bacteria [Fun 92.56
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 92.46
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 92.28
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 91.37
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 90.41
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 90.09
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 89.79
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 89.75
KOG0976|consensus 1265 89.07
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 88.44
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 88.35
KOG0250|consensus 1074 87.57
PRK04778 569 septation ring formation regulator EzrA; Provision 87.38
COG4026290 Uncharacterized protein containing TOPRIM domain, 87.03
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 86.36
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 85.87
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 85.5
PF14662193 CCDC155: Coiled-coil region of CCDC155 85.32
PF07111 739 HCR: Alpha helical coiled-coil rod protein (HCR); 84.81
KOG0964|consensus 1200 84.43
KOG0980|consensus 980 84.16
KOG0250|consensus 1074 84.02
KOG4674|consensus 1822 83.67
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 83.64
KOG4643|consensus 1195 83.59
COG4942 420 Membrane-bound metallopeptidase [Cell division and 82.93
KOG0980|consensus 980 82.64
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 82.55
PF05557 722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 82.39
COG4026290 Uncharacterized protein containing TOPRIM domain, 82.35
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 81.86
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 80.88
KOG1029|consensus 1118 80.76
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
Probab=99.83  E-value=4.6e-22  Score=179.79  Aligned_cols=105  Identities=77%  Similarity=1.008  Sum_probs=0.0

Q ss_pred             ChhHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHhcCccHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHH
Q psy16513          1 MQARIYELEEEVEVERQSRAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAEMSKLRRDLEEANIQHESTLA   80 (156)
Q Consensus         1 l~~~i~EL~e~le~e~~~r~k~EK~k~~l~~Ele~l~~~le~~~~~~~~~~~~~kk~E~el~~l~~~lee~~~~~e~~~~   80 (156)
                      |+++|.+|+++|++++.+|+|+||.|++|..||++|..+|++.+++++++.++++++|.+|..|++.|++....++.++.
T Consensus        44 lq~~i~el~eeLe~Er~~R~kaek~r~dL~~ELe~l~~~Lee~~~~t~aq~E~~kkrE~El~~Lrr~LEe~~~~~e~~~~  123 (859)
T PF01576_consen   44 LQARIEELEEELESERQARAKAEKQRRDLSEELEELKERLEEAGGATQAQIELNKKREAELAKLRRDLEEANLQHEATLA  123 (859)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCcHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhHHHHHHHHHHHHHHHHHHH
Q psy16513         81 NLRKKHNDAVSEMGEQIDQLNKLKT  105 (156)
Q Consensus        81 ~~k~k~~~~~~el~~q~~~l~r~k~  105 (156)
                      .+|+||++.+.+|+.++++++|.++
T Consensus       124 ~lrkkh~~~~~eL~eqle~lqk~k~  148 (859)
T PF01576_consen  124 ELRKKHQDAVAELNEQLEQLQKQKA  148 (859)
T ss_dssp             -------------------------
T ss_pred             HHHHhHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999997



Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular head and the C-terminal coiled-coil rod-like tail, although some forms have a globular region in their C-terminal. There are many cell-specific isoforms of myosin heavy chains, coded for by a multi-gene family []. Myosin interacts with actin to convert chemical energy, in the form of ATP, to mechanical energy []. The 3-D structure of the head portion of myosin has been determined [] and a model for actin-myosin complex has been constructed []. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament []. The coiled-coil region provides the structural backbone of the thick filament [].; GO: 0003774 motor activity, 0016459 myosin complex; PDB: 2LNK_C 3ZWH_Q.

>KOG0161|consensus Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF06428 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IPR009449 In Saccharomyces cerevisiae, Sec2p is a GDP/GTP exchange factor for Sec4p, which is required for vesicular transport at the post-Golgi stage of yeast secretion [] Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>KOG0976|consensus Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins Back     alignment and domain information
>KOG0964|consensus Back     alignment and domain information
>KOG0980|consensus Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>KOG4643|consensus Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0980|consensus Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-14
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-09
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 3e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 7e-07
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 9e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-05
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 5e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
2ycu_A995 Non muscle myosin 2C, alpha-actinin; motor protein 3e-04
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 9e-04
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score = 68.7 bits (168), Expect = 2e-14
 Identities = 23/62 (37%), Positives = 37/62 (59%)

Query: 1    MQARIYELEEEVEVERQSRAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAE 60
            +++ I +L+E++E E+ +R KAEKQ+ DL+ ELE L   LE+    T+ Q EL      +
Sbjct: 1121 LESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELRGSDYKD 1180

Query: 61   MS 62
              
Sbjct: 1181 DD 1182


>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 97.04
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 96.59
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 96.46
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 96.38
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 95.85
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 95.74
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 95.7
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 95.61
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 95.41
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 95.34
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.13
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 95.0
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 94.44
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 94.24
2e7s_A135 RAB guanine nucleotide exchange factor SEC2; coile 93.24
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 91.06
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 90.21
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 89.93
3bas_A89 Myosin heavy chain, striated muscle/general contro 88.73
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 88.31
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 88.27
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 86.78
1deq_A 390 Fibrinogen (alpha chain); coiled-coil, blood clott 85.14
2wt7_B90 Transcription factor MAFB; transcription, transcri 83.98
1m1j_A 491 Fibrinogen alpha subunit; coiled coils, disulfide 82.78
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 82.3
1nfn_A191 Apolipoprotein E3; lipid transport, heparin-bindin 81.67
3trt_A77 Vimentin; cytoskeleton, intermediate filament, alp 80.77
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
Probab=97.04  E-value=0.036  Score=38.63  Aligned_cols=60  Identities=13%  Similarity=0.250  Sum_probs=37.0

Q ss_pred             HHHHHHhhHHHHHHHHHHHHHHHHHHHHhHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy16513         79 LANLRKKHNDAVSEMGEQIDQLNKLKTKLDEANRTINDLDVARKKLIIENSDLVRQLSKVTAD  141 (156)
Q Consensus        79 ~~~~k~k~~~~~~el~~q~~~l~r~k~~lee~~r~~~el~~~~~~l~~E~~el~r~l~e~e~~  141 (156)
                      ....+.++...-.+|...+..+   ..++++......+|...+++++.+|.+|..++++.+..
T Consensus        67 ~EE~~~~L~~~k~eLe~~l~el---~~rleeeee~~~~L~~~kkkle~e~~~Lk~~led~e~~  126 (129)
T 2fxo_A           67 AEERCDQLIKNKIQLEAKVKEM---NKRLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT  126 (129)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            4444444444444444444332   22445555567778888888888888888888887653



>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A Back     alignment and structure
>3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
d1gs9a_144 Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 84.83
>d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Four-helical up-and-down bundle
superfamily: Apolipoprotein
family: Apolipoprotein
domain: Apolipoprotein E
species: Human (Homo sapiens), E4 [TaxId: 9606]
Probab=84.83  E-value=2.1  Score=28.05  Aligned_cols=20  Identities=10%  Similarity=0.204  Sum_probs=8.6

Q ss_pred             HHHHHHHhhHHHHHHHHHHH
Q psy16513         78 TLANLRKKHNDAVSEMGEQI   97 (156)
Q Consensus        78 ~~~~~k~k~~~~~~el~~q~   97 (156)
                      .+.+++.++...++++...+
T Consensus        86 ~lee~r~kl~~~~eel~~~~  105 (144)
T d1gs9a_          86 DMEDVRGRLVQYRGEVQAML  105 (144)
T ss_dssp             HHHHHHHHHHHHHHHHHTST
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            34444444444444444433