Psyllid ID: psy16513
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 156 | ||||||
| 229472621 | 836 | myosin heavy chain [Bombyx mandarina] | 0.955 | 0.178 | 0.622 | 1e-47 | |
| 170029180 | 1946 | myosin-2 heavy chain [Culex quinquefasci | 0.865 | 0.069 | 0.569 | 3e-45 | |
| 328702403 | 1969 | PREDICTED: myosin heavy chain, muscle is | 0.865 | 0.068 | 0.662 | 1e-40 | |
| 189239927 | 1960 | PREDICTED: similar to Myosin heavy chain | 0.865 | 0.068 | 0.662 | 2e-40 | |
| 189239937 | 1960 | PREDICTED: similar to Myosin heavy chain | 0.865 | 0.068 | 0.662 | 2e-40 | |
| 183979376 | 1965 | muscle myosin heavy chain [Papilio xuthu | 0.865 | 0.068 | 0.668 | 3e-40 | |
| 197322818 | 836 | myosin heavy chain [Bombyx mori] | 0.955 | 0.178 | 0.627 | 3e-40 | |
| 189239931 | 1960 | PREDICTED: similar to Myosin heavy chain | 0.865 | 0.068 | 0.657 | 7e-40 | |
| 270011842 | 2287 | hypothetical protein TcasGA2_TC005924 [T | 0.865 | 0.059 | 0.657 | 7e-40 | |
| 189239935 | 1960 | PREDICTED: similar to Myosin heavy chain | 0.865 | 0.068 | 0.657 | 8e-40 |
| >gi|229472621|gb|ACQ72825.1| myosin heavy chain [Bombyx mandarina] | Back alignment and taxonomy information |
|---|
Score = 194 bits (493), Expect = 1e-47, Method: Compositional matrix adjust.
Identities = 122/196 (62%), Positives = 136/196 (69%), Gaps = 47/196 (23%)
Query: 1 MQARIYELEEEVEVERQSRAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAE 60
+Q RI ELEEEVE ERQ+RAKAEKQRADLARE EELGERLEEAGGATSAQIELNKKREAE
Sbjct: 86 LQGRIEELEEEVESERQARAKAEKQRADLAREPEELGERLEEAGGATSAQIELNKKREAE 145
Query: 61 MSKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLK---------------- 104
+SKLRRDLEEANIQHE+TLANLRKKHNDAVSEMGEQ+DQLNKLK
Sbjct: 146 LSKLRRDLEEANIQHEATLANLRKKHNDAVSEMGEQLDQLNKLKAKAEKERAQYFSEVND 205
Query: 105 ------------------------------TKLDEANRTINDLDVARKKLIIENSDLVRQ 134
+K DEANRT+NDLD A+KKL IENSDL+RQ
Sbjct: 206 LRAGLDHLSNEKAAQEKIVKQPQHQLNEVQSKADEANRTLNDLDAAKKKLSIENSDLLRQ 265
Query: 135 LSKVTAD-ARMWKIKY 149
L + + +++ KIK
Sbjct: 266 LEEAESQVSQLSKIKV 281
|
Source: Bombyx mandarina Species: Bombyx mandarina Genus: Bombyx Family: Bombycidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|170029180|ref|XP_001842471.1| myosin-2 heavy chain [Culex quinquefasciatus] gi|167881574|gb|EDS44957.1| myosin-2 heavy chain [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|328702403|ref|XP_001952092.2| PREDICTED: myosin heavy chain, muscle isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|189239927|ref|XP_001814139.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 7 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189239937|ref|XP_001814083.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 6 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|183979376|dbj|BAG30740.1| muscle myosin heavy chain [Papilio xuthus] | Back alignment and taxonomy information |
|---|
| >gi|197322818|gb|ACH69160.1| myosin heavy chain [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|189239931|ref|XP_001813815.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 5 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270011842|gb|EFA08290.1| hypothetical protein TcasGA2_TC005924 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189239935|ref|XP_001813466.1| PREDICTED: similar to Myosin heavy chain CG17927-PF isoform 2 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 156 | ||||||
| FB|FBgn0264695 | 1962 | Mhc "Myosin heavy chain" [Dros | 0.775 | 0.061 | 0.590 | 1.2e-27 | |
| MGI|MGI:1339711 | 1942 | Myh1 "myosin, heavy polypeptid | 0.897 | 0.072 | 0.427 | 2.9e-21 | |
| UNIPROTKB|F1LRV9 | 1942 | Myh4 "Myosin-4" [Rattus norveg | 0.897 | 0.072 | 0.427 | 2.9e-21 | |
| UNIPROTKB|F1SS62 | 1470 | MYH1 "Myosin-1" [Sus scrofa (t | 0.75 | 0.079 | 0.495 | 3.3e-21 | |
| UNIPROTKB|F1PQU7 | 1938 | MYH13 "Myosin-13" [Canis lupus | 0.897 | 0.072 | 0.427 | 3.7e-21 | |
| UNIPROTKB|Q076A5 | 1939 | MYH4 "Myosin-4" [Canis lupus f | 0.993 | 0.079 | 0.425 | 3.7e-21 | |
| UNIPROTKB|Q076A3 | 1940 | MYH13 "Myosin-13" [Canis lupus | 0.897 | 0.072 | 0.427 | 3.7e-21 | |
| UNIPROTKB|F1PMJ2 | 1859 | MYH2 "Myosin-2" [Canis lupus f | 0.75 | 0.062 | 0.495 | 4.5e-21 | |
| UNIPROTKB|Q076A4 | 1939 | MYH8 "Myosin-8" [Canis lupus f | 0.75 | 0.060 | 0.495 | 4.7e-21 | |
| UNIPROTKB|Q076A6 | 1939 | MYH1 "Myosin-1" [Canis lupus f | 0.75 | 0.060 | 0.495 | 4.7e-21 |
| FB|FBgn0264695 Mhc "Myosin heavy chain" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 325 (119.5 bits), Expect = 1.2e-27, P = 1.2e-27
Identities = 72/122 (59%), Positives = 81/122 (66%)
Query: 1 MQARIYXXXXXXXXXRQSRAKAEKQXXXXXXXXXXXXXXXXXXXXXTSAQIELNKKREAE 60
+QARI RQ+RAKAEKQ TSAQIELNKKREAE
Sbjct: 1110 LQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAE 1169
Query: 61 MSKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLKTKLDEANRTI-NDLDV 119
+SKLRRDLEEANIQHESTLANLRKKHNDAV+EM EQ+DQLNKLK K + +T N+L+
Sbjct: 1170 LSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEHDRQTCHNELNQ 1229
Query: 120 AR 121
R
Sbjct: 1230 TR 1231
|
|
| MGI|MGI:1339711 Myh1 "myosin, heavy polypeptide 1, skeletal muscle, adult" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LRV9 Myh4 "Myosin-4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SS62 MYH1 "Myosin-1" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PQU7 MYH13 "Myosin-13" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q076A5 MYH4 "Myosin-4" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q076A3 MYH13 "Myosin-13" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PMJ2 MYH2 "Myosin-2" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q076A4 MYH8 "Myosin-8" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q076A6 MYH1 "Myosin-1" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 156 | |||
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 9e-33 | |
| pfam04156 | 186 | pfam04156, IncA, IncA protein | 7e-04 | |
| pfam01576 | 859 | pfam01576, Myosin_tail_1, Myosin tail | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.001 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.001 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.004 |
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
Score = 121 bits (306), Expect = 9e-33
Identities = 79/109 (72%), Positives = 94/109 (86%)
Query: 2 QARIYELEEEVEVERQSRAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAEM 61
+ARI ELEEE+E ER +RAKAEK RADL+RELEEL ERLEEAGGAT+AQIELNKKREAE+
Sbjct: 45 EARIRELEEELEAERAARAKAEKARADLSRELEELSERLEEAGGATAAQIELNKKREAEL 104
Query: 62 SKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLKTKLDEA 110
+KLR+DLEEAN+QHE LA LRKKH DA++E+ EQI+QL K K K ++
Sbjct: 105 AKLRKDLEEANLQHEEALATLRKKHQDAINELSEQIEQLQKQKAKAEKE 153
|
The myosin molecule is a multi-subunit complex made up of two heavy chains and four light chains it is a fundamental contractile protein found in all eukaryote cell types. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament. The coiled-coil region provides the structural backbone the thick filament. Length = 859 |
| >gnl|CDD|217933 pfam04156, IncA, IncA protein | Back alignment and domain information |
|---|
| >gnl|CDD|144972 pfam01576, Myosin_tail_1, Myosin tail | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 156 | |||
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 99.83 | |
| KOG0161|consensus | 1930 | 99.73 | ||
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 98.8 | |
| KOG0161|consensus | 1930 | 98.54 | ||
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.28 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 97.16 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.0 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 96.94 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 96.61 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 96.43 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 96.23 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.21 | |
| PRK11637 | 428 | AmiB activator; Provisional | 96.08 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.08 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.02 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.7 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 95.37 | |
| KOG0977|consensus | 546 | 95.24 | ||
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 95.14 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 94.92 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 94.9 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 94.85 | |
| KOG0612|consensus | 1317 | 94.82 | ||
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 94.71 | |
| KOG0995|consensus | 581 | 94.46 | ||
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 94.37 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 94.21 | |
| KOG0971|consensus | 1243 | 94.03 | ||
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 93.99 | |
| PRK11637 | 428 | AmiB activator; Provisional | 93.96 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 93.86 | |
| PF06428 | 100 | Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IP | 93.79 | |
| KOG0996|consensus | 1293 | 93.65 | ||
| KOG4674|consensus | 1822 | 93.61 | ||
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 93.61 | |
| KOG0977|consensus | 546 | 93.15 | ||
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 93.13 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 92.93 | |
| KOG0996|consensus | 1293 | 92.74 | ||
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 92.56 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 92.46 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 92.28 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 91.37 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 90.41 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 90.09 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 89.79 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 89.75 | |
| KOG0976|consensus | 1265 | 89.07 | ||
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 88.44 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 88.35 | |
| KOG0250|consensus | 1074 | 87.57 | ||
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 87.38 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 87.03 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 86.36 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 85.87 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 85.5 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 85.32 | |
| PF07111 | 739 | HCR: Alpha helical coiled-coil rod protein (HCR); | 84.81 | |
| KOG0964|consensus | 1200 | 84.43 | ||
| KOG0980|consensus | 980 | 84.16 | ||
| KOG0250|consensus | 1074 | 84.02 | ||
| KOG4674|consensus | 1822 | 83.67 | ||
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 83.64 | |
| KOG4643|consensus | 1195 | 83.59 | ||
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 82.93 | |
| KOG0980|consensus | 980 | 82.64 | ||
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 82.55 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 82.39 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 82.35 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 81.86 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 80.88 | |
| KOG1029|consensus | 1118 | 80.76 |
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
Probab=99.83 E-value=4.6e-22 Score=179.79 Aligned_cols=105 Identities=77% Similarity=1.008 Sum_probs=0.0
Q ss_pred ChhHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHhcCccHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHH
Q psy16513 1 MQARIYELEEEVEVERQSRAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAEMSKLRRDLEEANIQHESTLA 80 (156)
Q Consensus 1 l~~~i~EL~e~le~e~~~r~k~EK~k~~l~~Ele~l~~~le~~~~~~~~~~~~~kk~E~el~~l~~~lee~~~~~e~~~~ 80 (156)
|+++|.+|+++|++++.+|+|+||.|++|..||++|..+|++.+++++++.++++++|.+|..|++.|++....++.++.
T Consensus 44 lq~~i~el~eeLe~Er~~R~kaek~r~dL~~ELe~l~~~Lee~~~~t~aq~E~~kkrE~El~~Lrr~LEe~~~~~e~~~~ 123 (859)
T PF01576_consen 44 LQARIEELEEELESERQARAKAEKQRRDLSEELEELKERLEEAGGATQAQIELNKKREAELAKLRRDLEEANLQHEATLA 123 (859)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCcHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 57899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhhHHHHHHHHHHHHHHHHHHH
Q psy16513 81 NLRKKHNDAVSEMGEQIDQLNKLKT 105 (156)
Q Consensus 81 ~~k~k~~~~~~el~~q~~~l~r~k~ 105 (156)
.+|+||++.+.+|+.++++++|.++
T Consensus 124 ~lrkkh~~~~~eL~eqle~lqk~k~ 148 (859)
T PF01576_consen 124 ELRKKHQDAVAELNEQLEQLQKQKA 148 (859)
T ss_dssp -------------------------
T ss_pred HHHHhHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999999999997
|
Myosin is a major component of thick filaments and exists as a hexamer of 2 heavy chains [], 2 alkali light chains, and 2 regulatory light chains. The heavy chain can be subdivided into the N-terminal globular head and the C-terminal coiled-coil rod-like tail, although some forms have a globular region in their C-terminal. There are many cell-specific isoforms of myosin heavy chains, coded for by a multi-gene family []. Myosin interacts with actin to convert chemical energy, in the form of ATP, to mechanical energy []. The 3-D structure of the head portion of myosin has been determined [] and a model for actin-myosin complex has been constructed []. This family consists of the coiled-coil myosin heavy chain tail region. The coiled-coil is composed of the tail from two molecules of myosin. These can then assemble into the macromolecular thick filament []. The coiled-coil region provides the structural backbone of the thick filament [].; GO: 0003774 motor activity, 0016459 myosin complex; PDB: 2LNK_C 3ZWH_Q. |
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0995|consensus | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0971|consensus | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF06428 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IPR009449 In Saccharomyces cerevisiae, Sec2p is a GDP/GTP exchange factor for Sec4p, which is required for vesicular transport at the post-Golgi stage of yeast secretion [] | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG0977|consensus | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG0996|consensus | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0976|consensus | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins | Back alignment and domain information |
|---|
| >KOG0964|consensus | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >KOG0250|consensus | Back alignment and domain information |
|---|
| >KOG4674|consensus | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG4643|consensus | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0980|consensus | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >KOG1029|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 156 | |||
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-14 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 1e-09 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 9e-07 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-05 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-04 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 8e-08 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 3e-04 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 9e-04 |
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
Score = 68.7 bits (168), Expect = 2e-14
Identities = 23/62 (37%), Positives = 37/62 (59%)
Query: 1 MQARIYELEEEVEVERQSRAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAE 60
+++ I +L+E++E E+ +R KAEKQ+ DL+ ELE L LE+ T+ Q EL +
Sbjct: 1121 LESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELRGSDYKD 1180
Query: 61 MS 62
Sbjct: 1181 DD 1182
|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 156 | |||
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 97.04 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 96.59 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.46 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 96.38 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 95.85 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 95.74 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 95.7 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 95.61 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 95.41 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 95.34 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.13 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 95.0 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 94.44 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 94.24 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 93.24 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 91.06 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 90.21 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 89.93 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 88.73 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 88.31 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 88.27 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 86.78 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 85.14 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 83.98 | |
| 1m1j_A | 491 | Fibrinogen alpha subunit; coiled coils, disulfide | 82.78 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 82.3 | |
| 1nfn_A | 191 | Apolipoprotein E3; lipid transport, heparin-bindin | 81.67 | |
| 3trt_A | 77 | Vimentin; cytoskeleton, intermediate filament, alp | 80.77 |
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
Probab=97.04 E-value=0.036 Score=38.63 Aligned_cols=60 Identities=13% Similarity=0.250 Sum_probs=37.0
Q ss_pred HHHHHHhhHHHHHHHHHHHHHHHHHHHHhHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy16513 79 LANLRKKHNDAVSEMGEQIDQLNKLKTKLDEANRTINDLDVARKKLIIENSDLVRQLSKVTAD 141 (156)
Q Consensus 79 ~~~~k~k~~~~~~el~~q~~~l~r~k~~lee~~r~~~el~~~~~~l~~E~~el~r~l~e~e~~ 141 (156)
....+.++...-.+|...+..+ ..++++......+|...+++++.+|.+|..++++.+..
T Consensus 67 ~EE~~~~L~~~k~eLe~~l~el---~~rleeeee~~~~L~~~kkkle~e~~~Lk~~led~e~~ 126 (129)
T 2fxo_A 67 AEERCDQLIKNKIQLEAKVKEM---NKRLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT 126 (129)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred HHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 4444444444444444444332 22445555567778888888888888888888887653
|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A | Back alignment and structure |
|---|
| >1m1j_A Fibrinogen alpha subunit; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: h.1.8.1 PDB: 1ei3_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1nfn_A Apolipoprotein E3; lipid transport, heparin-binding, plasma protein, HDL, VLDL; 1.80A {Homo sapiens} SCOP: a.24.1.1 PDB: 1h7i_A 1ea8_A 1b68_A 1nfo_A 2kc3_A 1ya9_A | Back alignment and structure |
|---|
| >3trt_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural protein; 2.30A {Homo sapiens} PDB: 3klt_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 156 | |||
| d1gs9a_ | 144 | Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: | 84.83 |
| >d1gs9a_ a.24.1.1 (A:) Apolipoprotein E {Human (Homo sapiens), E4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Four-helical up-and-down bundle superfamily: Apolipoprotein family: Apolipoprotein domain: Apolipoprotein E species: Human (Homo sapiens), E4 [TaxId: 9606]
Probab=84.83 E-value=2.1 Score=28.05 Aligned_cols=20 Identities=10% Similarity=0.204 Sum_probs=8.6
Q ss_pred HHHHHHHhhHHHHHHHHHHH
Q psy16513 78 TLANLRKKHNDAVSEMGEQI 97 (156)
Q Consensus 78 ~~~~~k~k~~~~~~el~~q~ 97 (156)
.+.+++.++...++++...+
T Consensus 86 ~lee~r~kl~~~~eel~~~~ 105 (144)
T d1gs9a_ 86 DMEDVRGRLVQYRGEVQAML 105 (144)
T ss_dssp HHHHHHHHHHHHHHHHHTST
T ss_pred HHHHHHHHHHHHHHHHHHHH
Confidence 34444444444444444433
|