Psyllid ID: psy16685


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MIYILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPVSGSNDEKNLNKFNIVKAQM
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccEHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccccccccccccccccEccccHHHHHHHHHccc
MIYILRVLIsekphvcsvcskgfstssslnthrrihsgekphqcqvcgkrftassnlyyhrmthikvnddFKEIlnlepvsgsndeknlnKFNIVKAQM
MIYILRvlisekphvcsvCSKGFSTSSSLNTHRrihsgekphqcqvcGKRFTASSNLYYHRMTHIKVNDDFKEILNLepvsgsndeknlnkfnivkaqm
MIYILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPVSGSNDEKNLNKFNIVKAQM
*IYILRVLISEKPHVCSVCSKGF******************HQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNL**********************
MIYILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPVSGSNDEKNLNKFNIV*A**
MIYILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPVSGSNDEKNLNKFNIVKAQM
MIYILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPVSGSNDEKNLNKFNIV****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIYILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPVSGSNDEKNLNKFNIVKAQM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query99 2.2.26 [Sep-21-2011]
O60304480 Zinc finger protein 500 O yes N/A 0.555 0.114 0.542 7e-15
P0CG23659 Zinc finger protein 853 O no N/A 0.585 0.088 0.559 2e-14
Q07230 614 Zinc finger and SCAN doma no N/A 0.656 0.105 0.538 5e-14
Q86WZ6799 Zinc finger protein 227 O no N/A 0.141 0.017 0.55 6e-14
Q7Z7L9 614 Zinc finger and SCAN doma no N/A 0.656 0.105 0.538 7e-14
Q5RCD9 645 Zinc finger and SCAN doma no N/A 0.656 0.100 0.538 8e-14
A0JNB1787 Zinc finger protein 227 O no N/A 0.191 0.024 0.55 8e-14
Q14590 738 Zinc finger protein 235 O no N/A 0.606 0.081 0.540 1e-13
Q96LW9406 Zinc finger protein 323 O no N/A 0.656 0.160 0.523 1e-13
Q9UK10 706 Zinc finger protein 225 O no N/A 0.616 0.086 0.548 2e-13
>sp|O60304|ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens GN=ZNF500 PE=2 SV=2 Back     alignment and function desciption
 Score = 79.0 bits (193), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 32/59 (54%), Positives = 42/59 (71%)

Query: 6   RVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTH 64
           R    E+P+ C VC KGFS  S+ +TH+R+H+GEKP+ C  CGKRF+ SS+L  HR TH
Sbjct: 345 RTHTGERPYKCLVCGKGFSDRSNFSTHQRVHTGEKPYPCPECGKRFSQSSSLVIHRRTH 403




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|P0CG23|ZN853_HUMAN Zinc finger protein 853 OS=Homo sapiens GN=ZNF853 PE=2 SV=1 Back     alignment and function description
>sp|Q07230|ZSCA2_MOUSE Zinc finger and SCAN domain-containing protein 2 OS=Mus musculus GN=Zscan2 PE=1 SV=1 Back     alignment and function description
>sp|Q86WZ6|ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens GN=ZNF227 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z7L9|ZSCA2_HUMAN Zinc finger and SCAN domain-containing protein 2 OS=Homo sapiens GN=ZSCAN2 PE=2 SV=2 Back     alignment and function description
>sp|Q5RCD9|ZSCA2_PONAB Zinc finger and SCAN domain-containing protein 2 OS=Pongo abelii GN=ZSCAN2 PE=2 SV=1 Back     alignment and function description
>sp|A0JNB1|ZN227_BOVIN Zinc finger protein 227 OS=Bos taurus GN=ZNF227 PE=2 SV=1 Back     alignment and function description
>sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 Back     alignment and function description
>sp|Q96LW9|ZN323_HUMAN Zinc finger protein 323 OS=Homo sapiens GN=ZNF323 PE=2 SV=2 Back     alignment and function description
>sp|Q9UK10|ZN225_HUMAN Zinc finger protein 225 OS=Homo sapiens GN=ZNF225 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
242024237 349 zinc finger protein c2h2, putative [Pedi 0.626 0.177 0.887 2e-25
193610439 497 PREDICTED: zinc finger protein 235-like 0.626 0.124 0.870 3e-25
312380485 428 hypothetical protein AND_07455 [Anophele 0.626 0.144 0.870 5e-25
158288337 325 AGAP009483-PA [Anopheles gambiae str. PE 0.626 0.190 0.870 9e-25
157108553 404 zinc finger protein [Aedes aegypti] gi|1 0.626 0.153 0.870 9e-25
158288339 338 AGAP009482-PA [Anopheles gambiae str. PE 0.626 0.183 0.870 1e-24
170036583 330 zinc finger protein [Culex quinquefascia 0.626 0.187 0.870 1e-24
321475720179 hypothetical protein DAPPUDRAFT_44266 [D 0.626 0.346 0.870 1e-24
357611828 309 hypothetical protein KGM_07310 [Danaus p 0.626 0.200 0.870 1e-24
391336961 495 PREDICTED: zinc finger protein 235-like 0.626 0.125 0.854 2e-24
>gi|242024237|ref|XP_002432535.1| zinc finger protein c2h2, putative [Pediculus humanus corporis] gi|212517987|gb|EEB19797.1| zinc finger protein c2h2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  119 bits (298), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/62 (88%), Positives = 57/62 (91%)

Query: 5   LRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTH 64
           +R    EKPHVC VC+KGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTH
Sbjct: 202 MRTHTGEKPHVCMVCNKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTH 261

Query: 65  IK 66
           IK
Sbjct: 262 IK 263




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193610439|ref|XP_001952629.1| PREDICTED: zinc finger protein 235-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|312380485|gb|EFR26464.1| hypothetical protein AND_07455 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158288337|ref|XP_310215.4| AGAP009483-PA [Anopheles gambiae str. PEST] gi|157019202|gb|EAA05906.4| AGAP009483-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157108553|ref|XP_001650281.1| zinc finger protein [Aedes aegypti] gi|108884041|gb|EAT48266.1| AAEL000715-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|158288339|ref|XP_310216.4| AGAP009482-PA [Anopheles gambiae str. PEST] gi|157019203|gb|EAA05918.4| AGAP009482-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170036583|ref|XP_001846143.1| zinc finger protein [Culex quinquefasciatus] gi|167879211|gb|EDS42594.1| zinc finger protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|321475720|gb|EFX86682.1| hypothetical protein DAPPUDRAFT_44266 [Daphnia pulex] Back     alignment and taxonomy information
>gi|357611828|gb|EHJ67666.1| hypothetical protein KGM_07310 [Danaus plexippus] Back     alignment and taxonomy information
>gi|391336961|ref|XP_003742843.1| PREDICTED: zinc finger protein 235-like [Metaseiulus occidentalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
ZFIN|ZDB-GENE-110914-47 293 si:ch211-271g18.2 "si:ch211-27 0.606 0.204 0.55 4.3e-15
ZFIN|ZDB-GENE-110914-52 293 si:dkey-238o14.9 "si:dkey-238o 0.606 0.204 0.55 4.3e-15
UNIPROTKB|I3LN81272 ZNF239 "Uncharacterized protei 0.626 0.227 0.548 5.4e-15
UNIPROTKB|F1Q138279 ZNF500 "Uncharacterized protei 0.595 0.211 0.542 5.4e-15
ZFIN|ZDB-GENE-030131-5765231 zgc:66483 "zgc:66483" [Danio r 0.545 0.233 0.611 8.8e-15
UNIPROTKB|Q9UJN7358 ZNF391 "Zinc finger protein 39 0.595 0.164 0.593 9.7e-15
MGI|MGI:1306812201 Zfp239 "zinc finger protein 23 0.626 0.308 0.532 1.4e-14
ZFIN|ZDB-GENE-110914-31 348 si:dkey-232o15.1 "si:dkey-232o 0.606 0.172 0.55 1.5e-14
UNIPROTKB|F1N9T2303 LOC100858709 "Uncharacterized 0.636 0.207 0.555 1.7e-14
RGD|1563095175 Zfp853 "zinc finger protein 85 0.595 0.337 0.559 1.8e-14
ZFIN|ZDB-GENE-110914-47 si:ch211-271g18.2 "si:ch211-271g18.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 191 (72.3 bits), Expect = 4.3e-15, P = 4.3e-15
 Identities = 33/60 (55%), Positives = 42/60 (70%)

Query:     5 LRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTH 64
             +R+   EKP++C+ C K FS SS+LN H RIH+GEKP  C  CGK F+ SS+L YH M H
Sbjct:    85 MRIHTGEKPYICTQCGKSFSISSNLNQHMRIHTGEKPFTCTQCGKSFSQSSHLNYHMMIH 144


GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
ZFIN|ZDB-GENE-110914-52 si:dkey-238o14.9 "si:dkey-238o14.9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LN81 ZNF239 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q138 ZNF500 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5765 zgc:66483 "zgc:66483" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UJN7 ZNF391 "Zinc finger protein 391" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1306812 Zfp239 "zinc finger protein 239" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-31 si:dkey-232o15.1 "si:dkey-232o15.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9T2 LOC100858709 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1563095 Zfp853 "zinc finger protein 853" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O60304ZN500_HUMANNo assigned EC number0.54230.55550.1145yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 7e-06
PHA00733128 PHA00733, PHA00733, hypothetical protein 7e-04
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 38.9 bits (91), Expect = 7e-06
 Identities = 14/25 (56%), Positives = 19/25 (76%)

Query: 28 SLNTHRRIHSGEKPHQCQVCGKRFT 52
          +L  H R H+GEKP++C VCGK F+
Sbjct: 1  NLRRHMRTHTGEKPYKCPVCGKSFS 25


Length = 26

>gnl|CDD|177301 PHA00733, PHA00733, hypothetical protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 99
KOG2462|consensus279 99.91
KOG2462|consensus279 99.8
KOG3576|consensus267 99.59
KOG3623|consensus1007 99.59
KOG3576|consensus267 99.54
KOG3623|consensus1007 99.47
PHA0276855 hypothetical protein; Provisional 99.23
KOG1074|consensus 958 99.22
KOG3608|consensus 467 99.18
PHA00733128 hypothetical protein 99.15
KOG1074|consensus958 99.12
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 99.05
PHA00733128 hypothetical protein 98.98
KOG3608|consensus467 98.92
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.89
PHA0276855 hypothetical protein; Provisional 98.87
PLN03086567 PRLI-interacting factor K; Provisional 98.81
PHA0061644 hypothetical protein 98.7
PHA0061644 hypothetical protein 98.7
PHA0073279 hypothetical protein 98.63
PLN03086567 PRLI-interacting factor K; Provisional 98.55
KOG3993|consensus500 98.33
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.25
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.1
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.08
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.95
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.93
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.89
COG5189423 SFP1 Putative transcriptional repressor regulating 97.86
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.8
PHA0073279 hypothetical protein 97.73
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.71
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.59
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.55
PRK04860160 hypothetical protein; Provisional 97.45
smart0035526 ZnF_C2H2 zinc finger. 97.41
smart0035526 ZnF_C2H2 zinc finger. 97.22
KOG3993|consensus 500 96.96
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.92
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.74
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.68
PRK04860160 hypothetical protein; Provisional 96.59
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.4
COG5189423 SFP1 Putative transcriptional repressor regulating 95.86
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 95.82
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.8
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 95.21
COG5048467 FOG: Zn-finger [General function prediction only] 95.03
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.0
KOG2893|consensus 341 93.82
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 93.21
KOG1146|consensus 1406 93.04
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 92.9
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 92.52
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 92.07
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 91.6
PF1371937 zinc_ribbon_5: zinc-ribbon domain 91.22
COG1592166 Rubrerythrin [Energy production and conversion] 90.64
KOG2186|consensus 276 90.59
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 90.55
PRK00464154 nrdR transcriptional regulator NrdR; Validated 89.99
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 89.91
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 89.58
PF1371736 zinc_ribbon_4: zinc-ribbon domain 89.53
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 89.04
COG404965 Uncharacterized protein containing archaeal-type C 89.0
PHA0062659 hypothetical protein 88.99
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 88.99
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 88.32
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 87.73
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 87.58
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 87.5
COG5048467 FOG: Zn-finger [General function prediction only] 87.16
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 87.09
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 86.75
PRK06266178 transcription initiation factor E subunit alpha; V 86.53
KOG2893|consensus 341 86.2
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 85.73
smart00531147 TFIIE Transcription initiation factor IIE. 85.38
PF04959214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 84.45
PF14353128 CpXC: CpXC protein 83.92
PRK0967872 DNA-binding transcriptional regulator; Provisional 81.93
KOG4173|consensus253 80.35
>KOG2462|consensus Back     alignment and domain information
Probab=99.91  E-value=8.4e-26  Score=134.73  Aligned_cols=89  Identities=33%  Similarity=0.456  Sum_probs=83.5

Q ss_pred             CeehhhhhcCCCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHHhccCCCcchhhhcccccc
Q psy16685          1 MIYILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPV   80 (99)
Q Consensus         1 l~~h~~~h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~   80 (99)
                      |.+|+|+|+  -|+.|.+||+.|..+..|+.|+++|+|+|||.|+.|+++|...++|+.|+++|.++|+|.|..|+..+.
T Consensus       177 LkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFs  254 (279)
T KOG2462|consen  177 LKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFA  254 (279)
T ss_pred             HhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHH
Confidence            578999988  488999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCCcchhhhhh
Q psy16685         81 SGSNDEKNLNK   91 (99)
Q Consensus        81 ~~~~~~~~~~~   91 (99)
                      .-+.+++|...
T Consensus       255 l~SyLnKH~ES  265 (279)
T KOG2462|consen  255 LKSYLNKHSES  265 (279)
T ss_pred             HHHHHHHhhhh
Confidence            88888888754



>KOG2462|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>PF14353 CpXC: CpXC protein Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-11
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-11
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 5e-10
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-10
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 5e-10
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 5e-10
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 6e-10
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-10
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 8e-10
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 1e-09
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-09
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 2e-09
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 3e-09
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 3e-09
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 6e-09
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 3e-08
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 9e-08
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 9e-08
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-07
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 5e-07
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-06
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-06
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-06
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 3e-06
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-06
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 3e-06
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 5e-06
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 6e-06
2emj_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-05
2eml_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-05
2yts_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-05
2enh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-05
2eme_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 2e-05
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 3e-05
2eps_A54 Solution Structure Of The 4th Zinc Finger Domain Of 3e-05
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 4e-05
2ep0_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-05
2emh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-05
2ep2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-05
2ytr_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-05
2emp_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-05
2em6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-05
2ena_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 9e-05
2ely_A46 Solution Structure Of The Third Zf-C2h2 Domain From 9e-05
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 1e-04
2eq3_A46 Solution Structure Of The 17th C2h2 Type Zinc Finge 1e-04
2ep3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 1e-04
2epz_A46 Solution Structure Of The 4th C2h2 Type Zinc Finger 1e-04
2ysv_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-04
2em3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ytq_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2ytf_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2em5_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2eq2_A46 Solution Structure Of The 16th C2h2 Type Zinc Finge 3e-04
2enc_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2eop_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2yrh_A44 Solution Structure Of The C2h2-Type Zinc Finger Dom 4e-04
2ytd_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2emk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2eor_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 5e-04
2emm_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2en1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2eq1_A46 Solution Structure Of The 9th C2h2 Type Zinc Finger 5e-04
2en6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2ytk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
2yth_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2em9_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2eon_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2ysp_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 9e-04
2ep1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 9e-04
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure

Iteration: 1

Score = 65.1 bits (157), Expect = 1e-11, Method: Compositional matrix adjust. Identities = 29/55 (52%), Positives = 38/55 (69%) Query: 11 EKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHI 65 EKP+ C C K FS SS+L H+R H+GEKP++C CGK F+ SS+L H+ TH Sbjct: 2 EKPYKCPECGKSFSQSSNLQKHQRTHTGEKPYKCPECGKSFSQSSDLQKHQRTHT 56
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2EMJ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 612- 644) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EML|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 752- 784) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2YTS|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 715- 747) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2ENH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 556- 588) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EME|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 725- 757) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2EPS|A Chain A, Solution Structure Of The 4th Zinc Finger Domain Of Zinc Finger Protein 278 Length = 54 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2EP0|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 528- 560) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EMH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 491- 523) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EP2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 603- 635) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YTR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 760- 792) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EMP|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 536- 568) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EM6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 199- 231) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2ENA|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 311- 343) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2ELY|A Chain A, Solution Structure Of The Third Zf-C2h2 Domain From Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2EQ3|A Chain A, Solution Structure Of The 17th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EP3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 631- 663) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2EPZ|A Chain A, Solution Structure Of The 4th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2YSV|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 17 In Zinc Finger Protein 473 Length = 42 Back     alignment and structure
>pdb|2EM3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 640- 672) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2YTQ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 775- 807) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2YTF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 607- 639) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EM5|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 768- 800) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2EQ2|A Chain A, Solution Structure Of The 16th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2ENC|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 395- 427) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EOP|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 719- 751) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2YRH|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (699- 729) From Zinc Finger Protein 473 Length = 44 Back     alignment and structure
>pdb|2YTD|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 426- 458) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2EMK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 668- 700) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EOR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 255- 287) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2EMM|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 544- 576) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2EN1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 563- 595) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EQ1|A Chain A, Solution Structure Of The 9th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EN6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 887- 919) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2YTK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 396- 428) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 479- 511) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EM9|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 367- 399) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EON|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 397- 429) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2YSP|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 507- 539) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EP1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 435- 467) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-24
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-22
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-11
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-24
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-20
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-23
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-23
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-23
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-19
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-23
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-21
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-20
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-23
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-22
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-20
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-22
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-12
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-22
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-14
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-22
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-22
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-21
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-21
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-21
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 2e-15
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-22
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-22
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-20
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-22
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-22
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-15
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-13
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-22
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-09
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-22
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-21
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-10
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-21
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-16
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-10
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-20
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-20
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-18
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-20
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-18
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-17
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-20
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-18
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-20
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-20
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-20
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-18
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-19
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-17
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-19
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-15
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-13
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-19
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-19
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-18
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 8e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-14
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 1e-08
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-19
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-18
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-18
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-18
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-16
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-17
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-16
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-16
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-14
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-14
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-12
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-14
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-14
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-14
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-12
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-12
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-13
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-13
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-13
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-13
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-12
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-12
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-10
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-12
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-12
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-12
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-13
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-13
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-12
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-13
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-13
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-13
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-12
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-13
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-13
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-10
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-13
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-13
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-13
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-13
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-12
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-13
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-13
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 9e-11
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-13
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-12
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-13
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-13
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-13
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-13
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-13
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-13
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 8e-13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-13
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-11
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-12
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-11
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-12
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-10
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-11
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-11
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-12
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-12
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-12
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-12
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-10
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-12
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-10
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-12
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-12
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-12
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-12
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 8e-12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-11
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-11
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-11
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-11
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-11
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-11
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-10
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 8e-10
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 9e-10
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 7e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 6e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 7e-07
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 1e-06
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 8e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 1e-06
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 3e-05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 3e-06
1ard_A29 Yeast transcription factor ADR1; transcription reg 3e-06
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 6e-06
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 2e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 7e-05
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 2e-04
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 2e-04
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 5e-04
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 6e-04
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
 Score = 87.1 bits (217), Expect = 2e-24
 Identities = 23/54 (42%), Positives = 30/54 (55%)

Query: 11 EKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTH 64
          +KP  C +C + FS S  L TH R H+GEKP  C +CG++F  S     H   H
Sbjct: 32 QKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIH 85


>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Length = 30 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Length = 29 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Length = 28 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 98 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.87
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.85
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.85
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.84
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.84
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.83
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.83
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.83
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.81
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.81
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.8
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.8
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.8
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.8
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.8
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.8
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.79
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.79
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.79
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.78
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.78
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.77
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.77
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.77
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.77
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.77
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.77
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.76
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.75
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.75
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.75
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.74
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.74
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.74
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.74
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.72
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.72
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.71
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.71
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.71
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.71
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.71
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.71
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.71
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.7
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.7
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.7
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.69
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.68
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.68
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.68
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.65
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.65
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.64
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.63
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.6
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.6
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.6
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.6
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.6
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.6
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.6
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.59
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.59
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.59
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.59
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.59
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.59
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.59
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.59
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.59
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.59
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.58
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.58
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.58
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.58
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.58
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.58
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.58
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.58
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.58
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.58
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.58
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.58
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.58
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.58
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.58
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.58
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.58
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.58
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.57
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.57
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.57
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.57
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.57
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.57
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.57
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.57
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.56
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.56
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.56
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.56
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.55
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.55
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.55
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.54
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.54
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.54
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.54
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.52
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.52
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.52
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.51
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.51
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.51
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.51
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.51
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.5
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.5
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.5
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.5
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.5
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.5
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.5
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.5
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.5
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.5
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.49
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.49
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.49
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.49
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.49
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.49
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.49
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.49
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.49
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.49
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.48
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.48
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.48
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.48
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.48
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.47
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.47
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.47
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.46
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.46
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.46
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.46
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.46
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.45
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.45
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.44
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.44
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.44
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.44
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.44
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.43
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.43
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.43
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.43
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.43
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.43
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.43
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.43
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.43
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.43
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.43
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.42
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.42
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.42
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.42
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.42
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.42
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.42
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.42
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.42
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.42
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.42
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.42
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.42
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.42
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.42
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.42
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.42
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.42
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.42
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.42
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.41
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.41
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.41
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.41
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.41
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.41
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.41
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.41
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.41
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.41
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.41
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.4
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.4
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.4
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.39
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.39
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.39
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.38
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.37
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.37
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.37
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.37
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.36
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.36
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.36
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.36
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.36
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.35
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.35
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.34
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.34
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.34
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.34
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.34
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.33
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.33
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.33
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.32
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.31
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.31
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.3
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.27
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.27
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.26
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.26
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.25
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.24
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.23
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.23
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.22
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.22
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.21
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.21
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.2
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.19
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.18
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.17
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.16
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.16
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.15
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.14
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.13
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.13
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.13
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.12
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.1
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.08
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 99.08
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.08
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.06
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.0
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.0
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.99
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.98
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.97
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.97
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.97
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.97
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.96
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.96
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.96
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.95
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.95
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.95
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.94
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.93
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.92
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.9
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.89
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.87
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.87
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.86
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.84
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.81
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.79
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.78
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 98.77
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.77
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.75
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.72
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.72
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.71
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.71
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.7
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.7
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.69
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.68
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.67
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.66
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 98.11
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.66
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.63
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.63
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 98.06
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.63
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.62
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.61
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.61
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.59
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.59
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.59
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.59
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.58
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.58
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.57
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.56
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.55
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.54
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.53
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.5
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.87
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.48
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.85
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.85
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.34
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.68
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.25
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.93
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.43
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.29
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.92
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.36
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.33
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.55
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 94.63
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.77
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 93.56
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 92.64
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 92.06
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 91.93
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 91.4
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 90.37
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 90.12
2k5c_A95 Uncharacterized protein PF0385; structural genomic 89.74
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 89.45
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 89.32
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 86.42
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 85.88
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 85.46
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 85.23
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 84.92
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 84.35
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 83.74
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 82.58
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 82.43
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 81.07
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.90  E-value=4.2e-25  Score=121.95  Aligned_cols=92  Identities=18%  Similarity=0.201  Sum_probs=84.7

Q ss_pred             eehhhhhcCCCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHHhccCCCcchhhhccccccC
Q psy16685          2 IYILRVLISEKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTHIKVNDDFKEILNLEPVS   81 (99)
Q Consensus         2 ~~h~~~h~~~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~   81 (99)
                      ..|.++|.|+++|.|++|++.|.....|..|+++|++++||.|..|++.|.....|..|+++|++++|+.|..|+..+..
T Consensus        11 ~h~~~~h~Gek~y~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~   90 (133)
T 2lt7_A           11 DHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFIN   90 (133)
T ss_dssp             SEEEEEETTEEEEEETTTCCEESCHHHHHHHHHHHHCCSCEECSSSSCEESSHHHHHHHHHHHHTCCCEEESSSCCEESS
T ss_pred             hhceeecCCCcCeECCCCCCCcCCHHHHHHHHHHcCCCCCeeCCccCeecccccchhhhccccCCCccccCCCCCCCcCC
Confidence            45677889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcchhhhhhhh
Q psy16685         82 GSNDEKNLNKFN   93 (99)
Q Consensus        82 ~~~~~~~~~~~~   93 (99)
                      ...+..|+...+
T Consensus        91 ~~~L~~H~~~hh  102 (133)
T 2lt7_A           91 YQFMSSHIKSVH  102 (133)
T ss_dssp             HHHHHHHHHHHT
T ss_pred             HHHHHHHhHHhc
Confidence            999998887665



>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 99
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-13
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-12
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-11
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 5e-11
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-10
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-10
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-10
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-10
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 7e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 7e-10
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-09
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-08
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-09
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-09
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-08
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 9e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-06
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-07
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-07
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 7e-07
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 1e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 1e-06
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 4e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 1e-06
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-05
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 5e-05
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 3e-05
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 2e-04
d1njqa_37 g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale c 2e-04
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 6e-04
d1ubdc228 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger 7e-04
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 0.002
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 0.003
d2dmda128 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 { 0.002
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 56.5 bits (137), Expect = 3e-13
 Identities = 18/38 (47%), Positives = 26/38 (68%), Gaps = 1/38 (2%)

Query: 10 SEKPHVCSVCSKGFSTSSSLNTH-RRIHSGEKPHQCQV 46
            KP++C  C KGFS    LN H +++H+ E+PH+CQV
Sbjct: 2  VGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQV 39


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 37 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.8
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.57
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.51
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.5
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.5
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.49
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.48
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.44
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.43
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.43
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.36
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.35
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.33
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.33
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.31
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.31
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.3
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.29
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.25
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.25
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.23
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.21
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.17
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.11
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.1
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.09
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.08
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.08
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.06
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.98
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.93
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.9
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.85
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.82
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.8
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.77
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.73
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.64
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.59
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.59
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.51
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.49
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.45
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.42
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.41
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.35
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.35
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.17
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.13
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.1
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.09
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.08
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.03
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.93
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.92
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.86
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.85
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.83
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.79
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.72
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.71
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.7
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.66
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.56
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.55
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.54
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.53
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.52
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.48
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.48
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.39
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.38
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.33
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.33
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.3
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.27
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.22
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.19
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.19
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.17
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.15
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.13
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.1
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.99
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.97
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.82
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.66
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 96.52
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.33
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.32
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.32
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.23
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.18
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.7
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.65
d1y0jb136 U-shaped transcription factor, different fingers { 95.34
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 94.76
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.55
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.54
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 93.29
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 91.69
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.69
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.55
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 91.14
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 90.93
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 90.26
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.18
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 89.78
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 88.26
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 87.01
d2gmga1105 Hypothetical protein PF0610 {Pyrococcus furiosus [ 86.76
d1twfl_46 RBP12 subunit of RNA polymerase II {Baker's yeast 86.2
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 85.97
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 85.5
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 83.77
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 83.24
d1fu9a_36 U-shaped transcription factor, different fingers { 83.18
d1wjpa226 Zinc finger protein 295, ZNF295 {Human (Homo sapie 82.05
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.80  E-value=2.3e-20  Score=86.67  Aligned_cols=53  Identities=36%  Similarity=0.689  Sum_probs=50.9

Q ss_pred             CCCeecccCcCcCCChHHHHHHhhhcCCCCceecccccccccCcchHHHHHHhc
Q psy16685         11 EKPHVCSVCSKGFSTSSSLNTHRRIHSGEKPHQCQVCGKRFTASSNLYYHRMTH   64 (99)
Q Consensus        11 ~~~~~C~~c~~~~~~~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h   64 (99)
                      |+||.| .||+.|.....|..|+++|++++||.|..|++.|...+.|..|+++|
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            689999 59999999999999999999999999999999999999999999876



>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1twfl_ g.41.9.2 (L:) RBP12 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure