Psyllid ID: psy16721

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----
METYYLEYLVFKSKYLRYLPTYKWTSQELLNSKFGLPTEAYHGFAVLSMSVQCVGLLLNKSLNAPTNGPVFRGSSDDFILTLSSQMGENLTCLYCYHLPIFICRATKDQSPKCTQLWFAWGTSDLKRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAMLQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR
cHHHHHHHHHHHHHHHcccccccccHHHHHHHHHEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHEEcccccccEEcccccccccccccEEEEccEEEccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEcccccccccccccccEEEEccccEEEEEEEc
cccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccccHHEEEEccccEEEccEEEccccEEEEEEEEEcccccccccccccccHcccHHcccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHccEEEccccccccccccccccEEEcccccEEEEEEcc
METYYLEYLVFKSKylrylptykwtsqellnskfglpteayHGFAVLSMSVQCVGLLLnkslnaptngpvfrgssDDFILTLSSQmgenltclycyhlpificratkdqspkctQLWFAWGTSDLKRATIGIFIYglhrhpqlwnnpnqfdpdrflpsqsshrnpsgyvpfslgprgcigskYAMLQMKTTISTILRRykilpgdkcksLQDIRFEFGmtmrslpgndiriepr
METYYLEYLVFKSKYLRYLPTYKWTSQELLNSKFGLPTEAYHGFAVLSMSVQCVGLLLNKSLNAPTNGPVFRGSSDDFILTLSSQMGENLTCLYCYHLPIFICRATKDQSPKCTQLWFAWGTSDLKRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAMLQMKTTISTILRrykilpgdkcKSLQDIRFEfgmtmrslpgndiriepr
METYYLEYLVFKSKYLRYLPTYKWTSQELLNSKFGLPTEAYHGFAVLSMSVQCVGLLLNKSLNAPTNGPVFRGSSDDFILTLSSQMGENLTCLYCYHLPIFICRATKDQSPKCTQLWFAWGTSDLKRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAMLQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR
**TYYLEYLVFKSKYLRYLPTYKWTSQELLNSKFGLPTEAYHGFAVLSMSVQCVGLLLNKSLNAPTNGPVFRGSSDDFILTLSSQMGENLTCLYCYHLPIFICRATKDQSPKCTQLWFAWGTSDLKRATIGIFIYGLHRHPQLWNN*********************YVPFSLGPRGCIGSKYAMLQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTM*************
**TYYLEYLVFKSKYLRYLPTYKWTSQELLNSKFGLPTEAYHGFAVLSMSVQCVGLLLNKSLNAPTNGPVFRGSSDDFILTLSSQMGENLTCLYCYHLPIFICRATKDQSPKCTQLWFAWGTSDLKRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAMLQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR
METYYLEYLVFKSKYLRYLPTYKWTSQELLNSKFGLPTEAYHGFAVLSMSVQCVGLLLNKSLNAPTNGPVFRGSSDDFILTLSSQMGENLTCLYCYHLPIFICRATKDQSPKCTQLWFAWGTSDLKRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAMLQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR
*ETYYLEYLVFKSKY******YKWTSQELLNSKFGLPTEAYHGFAVLSMSVQCVGLLLNKSLNAPTNGPVFRGSSDDFILTLSSQMGENLTCLYCYHLPIFICRATKDQSPKCTQLWFAWGTSDLKRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAMLQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METYYLEYLVFKSKYLRYLPTYKWTSQELLNSKFGLPTEAYHGFAVLSMSVQCVGLLLNKSLNAPTNGPVFRGSSDDFILTLSSQMGENLTCLYCYHLPIFICRATKDQSPKCTQLWFAWGTSDLKRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAMLQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query234 2.2.26 [Sep-21-2011]
Q9V557520 Probable cytochrome P450 yes N/A 0.401 0.180 0.474 4e-21
Q9VMS7509 Probable cytochrome P450 no N/A 0.452 0.208 0.403 3e-20
Q9VMS9509 Probable cytochrome P450 no N/A 0.512 0.235 0.365 3e-20
Q9VYY4574 Cytochrome P450 4g15 OS=D no N/A 0.444 0.181 0.420 4e-20
Q9VA27535 Cytochrome P450 4c3 OS=Dr no N/A 0.427 0.186 0.436 7e-20
Q9V559515 Probable cytochrome P450 no N/A 0.405 0.184 0.408 8e-19
Q9V558513 Cytochrome P450 4p1 OS=Dr no N/A 0.405 0.185 0.428 3e-18
Q9VMS8511 Probable cytochrome P450 no N/A 0.512 0.234 0.341 4e-18
Q9V3S0556 Cytochrome P450 4g1 OS=Dr no N/A 0.452 0.190 0.366 1e-17
P29981511 Cytochrome P450 4C1 OS=Bl N/A N/A 0.418 0.191 0.405 2e-16
>sp|Q9V557|CP4P2_DROME Probable cytochrome P450 4p2 OS=Drosophila melanogaster GN=Cyp4p2 PE=2 SV=1 Back     alignment and function desciption
 Score =  101 bits (252), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 64/97 (65%), Gaps = 3/97 (3%)

Query: 126 KRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAM 185
           KR+ I I ++ +HR+P+ W +P +F P+RFLP     R+P  Y+PFS G R CIG KYAM
Sbjct: 412 KRSQINIHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAM 471

Query: 186 LQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMR 222
            +MKT +  IL+ +KILP    KS   I F+ G+T+R
Sbjct: 472 QEMKTLMVVILKHFKILPVIDPKS---IVFQVGITLR 505
May be involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q9VMS7|C4AC3_DROME Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 Back     alignment and function description
>sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VYY4|C4G15_DROME Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 Back     alignment and function description
>sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 Back     alignment and function description
>sp|Q9V559|CP4P3_DROME Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 Back     alignment and function description
>sp|Q9V558|CP4P1_DROME Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VMS8|C4AC2_DROME Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 Back     alignment and function description
>sp|Q9V3S0|CP4G1_DROME Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 Back     alignment and function description
>sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query234
223976197 512 CYP4CD1 [Liposcelis bostrychophila] 0.457 0.208 0.458 6e-22
195028951 689 GH21869 [Drosophila grimshawi] gi|193903 0.423 0.143 0.471 4e-21
5263306 501 family 4 cytochrome P450 [Coptotermes ac 0.444 0.207 0.448 1e-20
194863222 524 GG23427 [Drosophila erecta] gi|190662203 0.401 0.179 0.484 3e-20
91091572 495 PREDICTED: similar to cytochrome P450 [T 0.431 0.204 0.475 3e-20
195473907 508 GE25361 [Drosophila yakuba] gi|194175334 0.512 0.236 0.390 3e-20
157136428 510 cytochrome P450 [Aedes aegypti] gi|10886 0.431 0.198 0.451 6e-20
389612634137 cytochrome P450 4ac1, partial [Papilio x 0.380 0.649 0.521 6e-20
195576718 509 GD23332 [Drosophila simulans] gi|1941902 0.452 0.208 0.422 7e-20
270008169 492 cytochrome P450-like protein [Tribolium 0.444 0.211 0.458 7e-20
>gi|223976197|gb|ACI25370.2| CYP4CD1 [Liposcelis bostrychophila] Back     alignment and taxonomy information
 Score =  110 bits (274), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 50/109 (45%), Positives = 70/109 (64%), Gaps = 2/109 (1%)

Query: 126 KRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAM 185
           K   +G+ IY LHR P++W NP +FDPD F P     RNP  YVPFS GPR CIG K+AM
Sbjct: 401 KGTNVGMIIYSLHRDPKVWPNPEKFDPDNFTPDAIQGRNPYSYVPFSAGPRNCIGQKFAM 460

Query: 186 LQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR 234
           L+MK+T+S ++R+YK+LP    K    ++    + + SL G  ++I+ R
Sbjct: 461 LEMKSTVSKVVRQYKLLPSPYEK--HKLQLTSELVLMSLSGVHVKIQRR 507

Source: Liposcelis bostrychophila

Species: Liposcelis bostrychophila

Genus: Liposcelis

Family: Liposcelidae

Order: Psocoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195028951|ref|XP_001987338.1| GH21869 [Drosophila grimshawi] gi|193903338|gb|EDW02205.1| GH21869 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|5263306|gb|AAC03111.2| family 4 cytochrome P450 [Coptotermes acinaciformis] Back     alignment and taxonomy information
>gi|194863222|ref|XP_001970336.1| GG23427 [Drosophila erecta] gi|190662203|gb|EDV59395.1| GG23427 [Drosophila erecta] Back     alignment and taxonomy information
>gi|91091572|ref|XP_967642.1| PREDICTED: similar to cytochrome P450 [Tribolium castaneum] gi|270001269|gb|EEZ97716.1| cytochrome P450-like protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195473907|ref|XP_002089233.1| GE25361 [Drosophila yakuba] gi|194175334|gb|EDW88945.1| GE25361 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|157136428|ref|XP_001663752.1| cytochrome P450 [Aedes aegypti] gi|108869961|gb|EAT34186.1| AAEL013554-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|389612634|dbj|BAM19742.1| cytochrome P450 4ac1, partial [Papilio xuthus] Back     alignment and taxonomy information
>gi|195576718|ref|XP_002078221.1| GD23332 [Drosophila simulans] gi|194190230|gb|EDX03806.1| GD23332 [Drosophila simulans] Back     alignment and taxonomy information
>gi|270008169|gb|EFA04617.1| cytochrome P450-like protein [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query234
FB|FBgn0033395520 Cyp4p2 "Cyp4p2" [Drosophila me 0.401 0.180 0.474 7.5e-20
FB|FBgn0030304574 Cyp4g15 "Cyp4g15" [Drosophila 0.444 0.181 0.420 3.3e-19
FB|FBgn0031695509 Cyp4ac3 "Cyp4ac3" [Drosophila 0.452 0.208 0.403 6.8e-19
FB|FBgn0015032535 Cyp4c3 "Cytochrome P450-4c3" [ 0.427 0.186 0.436 7.7e-19
ZFIN|ZDB-GENE-031219-3509 cyp4t8 "cytochrome P450, famil 0.504 0.231 0.401 8.7e-19
ZFIN|ZDB-GENE-070410-108516 cyp4f3 "cytochrome P450, famil 0.384 0.174 0.483 1.2e-18
FB|FBgn0031693509 Cyp4ac1 "Cyp4ac1" [Drosophila 0.452 0.208 0.394 1.8e-18
FB|FBgn0033397515 Cyp4p3 "Cyp4p3" [Drosophila me 0.435 0.198 0.392 5.2e-18
UNIPROTKB|Q6AZ67347 Cyp4f6 "Cyp4f6 protein" [Rattu 0.414 0.279 0.362 1.4e-17
FB|FBgn0030615495 Cyp4s3 "Cyp4s3" [Drosophila me 0.431 0.204 0.416 1.6e-17
FB|FBgn0033395 Cyp4p2 "Cyp4p2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 243 (90.6 bits), Expect = 7.5e-20, P = 7.5e-20
 Identities = 46/97 (47%), Positives = 64/97 (65%)

Query:   126 KRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAM 185
             KR+ I I ++ +HR+P+ W +P +F P+RFLP     R+P  Y+PFS G R CIG KYAM
Sbjct:   412 KRSQINIHVFDIHRNPKYWESPEEFRPERFLPQNCLKRHPYAYIPFSAGQRNCIGQKYAM 471

Query:   186 LQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMR 222
              +MKT +  IL+ +KILP    KS   I F+ G+T+R
Sbjct:   472 QEMKTLMVVILKHFKILPVIDPKS---IVFQVGITLR 505
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;ISS;NAS
GO:0016020 "membrane" evidence=NAS
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
FB|FBgn0030304 Cyp4g15 "Cyp4g15" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031695 Cyp4ac3 "Cyp4ac3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015032 Cyp4c3 "Cytochrome P450-4c3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031219-3 cyp4t8 "cytochrome P450, family 4, subfamily T, polypeptide 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-108 cyp4f3 "cytochrome P450, family 4, subfamily F, polypeptide 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0031693 Cyp4ac1 "Cyp4ac1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033397 Cyp4p3 "Cyp4p3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AZ67 Cyp4f6 "Cyp4f6 protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0030615 Cyp4s3 "Cyp4s3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query234
pfam00067461 pfam00067, p450, Cytochrome P450 8e-24
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-16
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 7e-14
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 7e-13
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 4e-09
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 5e-09
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 2e-07
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 3e-07
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 1e-06
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 6e-06
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 7e-06
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 2e-05
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 3e-05
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 5e-05
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 6e-05
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 1e-04
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 3e-04
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 4e-04
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 5e-04
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 0.001
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 0.004
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score = 98.5 bits (246), Expect = 8e-24
 Identities = 27/78 (34%), Positives = 48/78 (61%)

Query: 126 KRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAM 185
           K   + + +Y LHR P+++ NP +FDP+RFL      R    ++PF  GPR C+G + A 
Sbjct: 358 KGTLVIVNLYALHRDPEVFPNPEEFDPERFLDENGKFRKSFAFLPFGAGPRNCLGERLAR 417

Query: 186 LQMKTTISTILRRYKILP 203
           ++MK  ++T+L+ +++  
Sbjct: 418 MEMKLFLATLLQNFEVEL 435

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 234
KOG0158|consensus499 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
KOG0157|consensus497 100.0
KOG0159|consensus519 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
KOG0156|consensus489 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
KOG0684|consensus486 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
PLN02648480 allene oxide synthase 99.96
>KOG0158|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.8e-46  Score=331.89  Aligned_cols=222  Identities=18%  Similarity=0.293  Sum_probs=192.1

Q ss_pred             EEecccccccccchhh---------hHHHHhhhcCcchhhhccccchhhHHHHhhhccccccccCcccccccccCCchHH
Q psy16721         10 VFKSKYLRYLPTYKWT---------SQELLNSKFGLPTEAYHGFAVLSMSVQCVGLLLNKSLNAPTNGPVFRGSSDDFIL   80 (234)
Q Consensus        10 ~~~~~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~aG~dtts~~l~~i~~l~~~~~~~~~~~~~~~~~~d~~~~   80 (234)
                      ..+|||+++|.+++..         .-...++.++.+.|++||.||||+++.  ++++.++.||++|..++++.......
T Consensus       264 ~~r~Dfi~lll~~~~~~~~~~~~~~~lt~dei~aQafvFl~AGfeTts~tls--f~lYeLA~~PdvQ~kLreEI~~~~~~  341 (499)
T KOG0158|consen  264 IERNDFIDLLLDARASDFAKSKSHKALTDDEIAAQAFVFLLAGFETTASTLS--FALYELAKNPDVQDKLREEIDEVLEE  341 (499)
T ss_pred             CCCchHHHHHHHhhcccccccccccccCHHHHHHHHHHHHHhhhHhHHHHHH--HHHHHHhcChHHHHHHHHHHHHHhcc
Confidence            4688999999999954         112445789999999999999999999  99999999999999998765433111


Q ss_pred             ---HHHHHhcCcccccccccCceecccCCCCCCCccccceEEc-CEEeCCCCEEEEeecccccCCCCCCCCCCccCCCCC
Q psy16721         81 ---TLSSQMGENLTCLYCYHLPIFICRATKDQSPKCTQLWFAW-GTSDLKRATIGIFIYGLHRHPQLWNNPNQFDPDRFL  156 (234)
Q Consensus        81 ---~~~~~~~~~~~~~~~~~e~lr~~p~~~~~~r~~~~d~~l~-g~~ip~G~~v~~~~~~~~~d~~~~~dp~~F~P~Rfl  156 (234)
                         ..-..+.+++|++.|++|++|++|+++.+.|.+++|++++ ++.||||+.|.++.+++||||++||||++|+||||.
T Consensus       342 ~~~ltyd~l~~L~YLd~Vi~ETLR~yP~~~~~~R~C~k~~~i~~~~~i~kG~~V~Ip~~alH~Dp~~~p~Pe~F~PERF~  421 (499)
T KOG0158|consen  342 KEGLTYDSLSKLKYLDMVIKETLRLYPPAPFLNRECTKDYEIPGGFVIPKGTPVMIPTYALHHDPEYWPEPEKFKPERFE  421 (499)
T ss_pred             cCCCCHHHHhCCcHHHHHHHHHHhhCCCcccccceecCceecCCCeEeCCCCEEEeecccccCCcccCCCcccCCCccCC
Confidence               2234567899999999999999999999999999999999 999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCcccccCCCCCCCccHHHHHHHHHHHHHHHhhhCeeeeCCCCCCCccceeeeeeEEecCCCeeEEEEeC
Q psy16721        157 PSQSSHRNPSGYVPFSLGPRGCIGSKYAMLQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR  234 (234)
Q Consensus       157 ~~~~~~~~~~~~~~FG~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~R  234 (234)
                      +++....++.+|+|||.|||+|+|++||.+|+|+.+++||++|+++..+. ..+....-..++++.|++++++++++|
T Consensus       422 ~~~~~~~~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~~lL~~f~~~~~~~-t~~~~~~~~~~~~l~pk~gi~Lkl~~r  498 (499)
T KOG0158|consen  422 EENNKSRHPGAYLPFGVGPRNCIGMRFALMEAKLALAHLLRNFSFEVCPT-TIIPLEGDPKGFTLSPKGGIWLKLEPR  498 (499)
T ss_pred             CCcccccCCccccCCCCCccccHHHHHHHHHHHHHHHHHHhhCEEecCCc-ccCcccCCccceeeecCCceEEEEEeC
Confidence            88876778899999999999999999999999999999999999999984 212211112278899999999999997

>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>KOG0156|consensus Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query234
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 6e-12
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 6e-12
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 6e-12
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 1e-09
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 1e-09
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 4e-09
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 4e-08
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 7e-08
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 8e-07
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 8e-07
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 9e-07
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 9e-07
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 9e-07
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 2e-06
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 2e-06
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 2e-06
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 4e-06
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 4e-06
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 4e-06
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 4e-06
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 4e-06
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 7e-06
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 8e-06
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 8e-06
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 1e-05
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 2e-05
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 2e-05
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 3e-05
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 3e-05
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 3e-05
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 3e-05
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 3e-05
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 3e-05
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 4e-05
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 7e-05
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 7e-05
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 8e-05
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 9e-05
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 1e-04
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 1e-04
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 1e-04
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 1e-04
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 2e-04
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 2e-04
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 2e-04
3pm0_A507 Structural Characterization Of The Complex Between 2e-04
2fr7_A412 Crystal Structure Of Cytochrome P450 Cyp199a2 Lengt 2e-04
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 5e-04
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 5e-04
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 5e-04
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 5e-04
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 5e-04
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 5e-04
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 5e-04
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 7e-04
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 8e-04
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure 
Iteration: 1

 Score = 67.4 bits (163), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
Query: 126 KRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAM 185
           K   + I  Y LHR P+ W  P +F P+RF      + +P  Y PF  GPR CIG ++A+
Sbjct: 369 KGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFAL 428
Query: 186 LQMKTTISTILRRYKILPGDKCKSLQ 211
           + MK  +  +L+ +   P   CK  Q
Sbjct: 429 MNMKLALIRVLQNFSFKP---CKETQ 451
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|2FR7|A Chain A, Crystal Structure Of Cytochrome P450 Cyp199a2 Length = 412 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query234
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 9e-36
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 6e-34
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 5e-33
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-31
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 2e-29
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 9e-29
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-28
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 4e-28
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 2e-27
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 3e-26
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 5e-26
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 2e-25
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 5e-25
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 8e-25
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 4e-23
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 8e-23
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 3e-20
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 6e-20
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 6e-17
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 4e-15
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 6e-15
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 3e-14
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 9e-14
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-13
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-13
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 4e-13
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 6e-13
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 7e-13
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 1e-12
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 2e-05
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 3e-05
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 3e-05
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 4e-05
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 4e-05
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 5e-05
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 5e-05
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 5e-05
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 5e-05
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 7e-05
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 7e-05
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 7e-05
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 7e-05
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 8e-05
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 9e-05
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 9e-05
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 1e-04
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 1e-04
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 1e-04
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 1e-04
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 2e-04
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 2e-04
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 2e-04
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 3e-04
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 3e-04
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 3e-04
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 3e-04
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 3e-04
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 3e-04
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 3e-04
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 4e-04
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 4e-04
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 4e-04
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 5e-04
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 5e-04
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score =  130 bits (329), Expect = 9e-36
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 6/109 (5%)

Query: 126 KRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAM 185
               +    Y + R    + +P  F+PDRF P     +    Y PFSLG R CIG ++A 
Sbjct: 339 GNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAP--KPRFTYFPFSLGHRSCIGQQFAQ 396

Query: 186 LQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR 234
           +++K  ++ +L+R +          Q    +   T++ L      + PR
Sbjct: 397 MEVKVVMAKLLQRLEFRLVPG----QRFGLQEQATLKPLDPVLCTLRPR 441
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query234
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.98
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.97
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.97
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.97
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.97
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=5.4e-43  Score=313.03  Aligned_cols=199  Identities=16%  Similarity=0.165  Sum_probs=169.0

Q ss_pred             hhcCcchhhhccccchhhHHHHhhhccccccccCcccccccccCCc---hHHHHHHHhcCcccccccccCceecccCCCC
Q psy16721         32 SKFGLPTEAYHGFAVLSMSVQCVGLLLNKSLNAPTNGPVFRGSSDD---FILTLSSQMGENLTCLYCYHLPIFICRATKD  108 (234)
Q Consensus        32 ~~~~~~~~~~aG~dtts~~l~~i~~l~~~~~~~~~~~~~~~~~~d~---~~~~~~~~~~~~~~~~~~~~e~lr~~p~~~~  108 (234)
                      +...+.++++||+|||++++.  |.++.+..+|++++.+.++....   ........+.+++|+.++++|++|++|+++.
T Consensus       273 i~~~~~~~~~AG~dTta~~l~--~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~~l~~lpyl~avi~EtlRl~p~~~~  350 (479)
T 3tbg_A          273 LRIVVADLFSAGMVTTSTTLA--WGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQRFGDIVPL  350 (479)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH--HHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCHHHHTTCHHHHHHHHHHHHHHCSSTT
T ss_pred             HHHHHHHHHHhhhhhhHHHHH--HHHHHhccCHHHHHHHHHHHHHHHhhccccchhhhccccccccceeeeccccccccc
Confidence            566788999999999999999  99999999999988886653111   1111223567999999999999999999877


Q ss_pred             CCC-ccccceEEcCEEeCCCCEEEEeecccccCCCCCCCCCCccCCCCCCCCCCCCCCCcccccCCCCCCCccHHHHHHH
Q psy16721        109 QSP-KCTQLWFAWGTSDLKRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAMLQ  187 (234)
Q Consensus       109 ~~r-~~~~d~~l~g~~ip~G~~v~~~~~~~~~d~~~~~dp~~F~P~Rfl~~~~~~~~~~~~~~FG~G~r~C~G~~~A~~~  187 (234)
                      ..| .+.+|++++||.||||+.|.++.+++||||++|+||++|+||||+++++...++..|+|||+|+|.|+|++||.+|
T Consensus       351 ~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~~~~~~~~pFG~G~R~C~G~~lA~~e  430 (479)
T 3tbg_A          351 GVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARME  430 (479)
T ss_dssp             CCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCBCCCTTCCTTCCSTTSCTTHHHHHHH
T ss_pred             cceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCcccCCCCceecCCCCCcCChhHHHHHHH
Confidence            666 5668999999999999999999999999999999999999999998887777788999999999999999999999


Q ss_pred             HHHHHHHHhhhCeeeeCCCCCCCccceeeeeeEEecCCCeeEEEEeC
Q psy16721        188 MKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR  234 (234)
Q Consensus       188 ~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~R  234 (234)
                      +++++|.|+++|+|+++++.. ........+++..|+ +++|+++||
T Consensus       431 ~~~~la~ll~~f~~~~~~~~~-~~~~~~~~~~~~~P~-~~~v~~~pR  475 (479)
T 3tbg_A          431 LFLFFTSLLQHFSFSVPTGQP-RPSHHGVFAFLVSPS-PYELCAVPR  475 (479)
T ss_dssp             HHHHHHHHHHHEEEECCTTSC-CCCSCEEESSSEEEC-CCCBEEEEC
T ss_pred             HHHHHHHHHHccEEEeCCCCC-CccccccceeeecCC-CeEEEEEEC
Confidence            999999999999999987722 123334456778887 899999998
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 234
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-25
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-25
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-24
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-22
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 1e-20
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 4e-19
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 2e-17
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 5e-17
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 1e-16
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 1e-16
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 2e-16
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 7e-16
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 2e-15
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 2e-15
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 2e-15
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 1e-14
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 5e-14
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 1e-13
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 1e-13
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 9e-13
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 2e-11
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  101 bits (252), Expect = 1e-25
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 2/109 (1%)

Query: 126 KRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAM 185
           K   + I  Y LHR P+ W  P +F P+RF      + +P  Y PF  GPR CIG ++A+
Sbjct: 363 KGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFAL 422

Query: 186 LQMKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR 234
           + MK  +  +L+ +   P  + +    ++   G  ++      +++E R
Sbjct: 423 MNMKLALIRVLQNFSFKPCKETQ--IPLKLSLGGLLQPEKPVVLKVESR 469
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query234
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.97
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.97
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.97
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.97
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.97
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.97
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.97
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.97
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.97
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.96
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.96
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.96
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.95
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=6.8e-42  Score=302.10  Aligned_cols=200  Identities=18%  Similarity=0.288  Sum_probs=172.8

Q ss_pred             hhhcCcchhhhccccchhhHHHHhhhccccccccCcccccccccCCch---HHHHHHHhcCcccccccccCceecccCCC
Q psy16721         31 NSKFGLPTEAYHGFAVLSMSVQCVGLLLNKSLNAPTNGPVFRGSSDDF---ILTLSSQMGENLTCLYCYHLPIFICRATK  107 (234)
Q Consensus        31 ~~~~~~~~~~~aG~dtts~~l~~i~~l~~~~~~~~~~~~~~~~~~d~~---~~~~~~~~~~~~~~~~~~~e~lr~~p~~~  107 (234)
                      ++...+.++++||+|||++++.  |.++.+..++++++.+.++..+..   .......+.+++++.++++|++|++|+..
T Consensus       267 ei~~~~l~l~~Ag~~tta~~l~--~~l~~L~~~Pe~~~klr~Ei~~~~~~~~~~~~~~l~~~~~l~a~i~E~lRl~p~~~  344 (472)
T d1tqna_         267 ELVAQSIIFIFAGYETTSSVLS--FIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAM  344 (472)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHCHHHHHHHHHHHHHHSTTTCCCCHHHHHHCHHHHHHHHHHHHHCCTTC
T ss_pred             HHHhhhhhhhhcccccccccce--eeccccccCccccccccceeheeccccccchHHHhhccccccceeeeccccCCccc
Confidence            3566788899999999999999  899999899988888765432211   11112345689999999999999999999


Q ss_pred             CCCCccccceEEcCEEeCCCCEEEEeecccccCCCCCCCCCCccCCCCCCCCCCCCCCCcccccCCCCCCCccHHHHHHH
Q psy16721        108 DQSPKCTQLWFAWGTSDLKRATIGIFIYGLHRHPQLWNNPNQFDPDRFLPSQSSHRNPSGYVPFSLGPRGCIGSKYAMLQ  187 (234)
Q Consensus       108 ~~~r~~~~d~~l~g~~ip~G~~v~~~~~~~~~d~~~~~dp~~F~P~Rfl~~~~~~~~~~~~~~FG~G~r~C~G~~~A~~~  187 (234)
                      .++|.+.+|+.++|+.||||+.|+++.+.+|+||++|+||++|+||||++.+.+...+..++|||+|+|.|||++||.+|
T Consensus       345 ~~~r~~~~d~~~~g~~ipkGt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~~~~~~~~FG~G~r~C~G~~~A~~~  424 (472)
T d1tqna_         345 RLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMN  424 (472)
T ss_dssp             CEEEECCSCEEETTEEECTTCEEEECHHHHHTCTTTSSSTTSCCGGGGSTTTGGGCCTTTSCTTCCSTTSCTTHHHHHHH
T ss_pred             ccccccccCccccCceeCCCCEEEEechhhhcCchhCCCccccCccccCCCCcccCCCceecCCCCCCccChhHHHHHHH
Confidence            99999999999999999999999999999999999999999999999998877666778899999999999999999999


Q ss_pred             HHHHHHHHhhhCeeeeCCCCCCCccceeeeeeEEecCCCeeEEEEeC
Q psy16721        188 MKTTISTILRRYKILPGDKCKSLQDIRFEFGMTMRSLPGNDIRIEPR  234 (234)
Q Consensus       188 ~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~R  234 (234)
                      ++++++.|+++|||+++++.  +.+.......++.|+.++.+++++|
T Consensus       425 ~~~~la~ll~~f~~~~~~~~--~~~~~~~~~~~~~p~~~~~~~~~~R  469 (472)
T d1tqna_         425 MKLALIRVLQNFSFKPCKET--QIPLKLSLGGLLQPEKPVVLKVESR  469 (472)
T ss_dssp             HHHHHHHHHTTEEEECCTTC--CSSCCBCSSSSCCBSSCCEEEEEET
T ss_pred             HHHHHHHHHHhCEEEeCCCC--CCCceeccceEEeeCCCEEEEEEEC
Confidence            99999999999999988772  3345555677789999999999998
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure