Psyllid ID: psy16749
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 821 | ||||||
| 357621647 | 1133 | putative pol-like protein [Danaus plexip | 0.401 | 0.291 | 0.315 | 2e-32 | |
| 125901787 | 1222 | pol-like protein [Biomphalaria glabrata] | 0.390 | 0.262 | 0.297 | 5e-22 | |
| 427791321 | 1210 | Putative tick transposon, partial [Rhipi | 0.375 | 0.254 | 0.271 | 6e-21 | |
| 427791807 | 1212 | Putative tick transposon, partial [Rhipi | 0.375 | 0.254 | 0.271 | 6e-21 | |
| 427798889 | 1199 | Putative tick transposon, partial [Rhipi | 0.378 | 0.259 | 0.280 | 1e-18 | |
| 427798887 | 1199 | Putative tick transposon, partial [Rhipi | 0.378 | 0.259 | 0.277 | 1e-18 | |
| 427798885 | 1199 | Putative tick transposon, partial [Rhipi | 0.378 | 0.259 | 0.274 | 6e-18 | |
| 323450868 | 2778 | hypothetical protein AURANDRAFT_65424 [A | 0.277 | 0.082 | 0.307 | 2e-06 | |
| 427795117 | 1654 | Hypothetical protein, partial [Rhipiceph | 0.238 | 0.118 | 0.314 | 0.0001 | |
| 392342464 | 3307 | PREDICTED: collagen alpha-3(VI) chain [R | 0.176 | 0.043 | 0.3 | 0.0007 |
| >gi|357621647|gb|EHJ73416.1| putative pol-like protein [Danaus plexippus] | Back alignment and taxonomy information |
|---|
Score = 147 bits (372), Expect = 2e-32, Method: Compositional matrix adjust.
Identities = 111/352 (31%), Positives = 167/352 (47%), Gaps = 22/352 (6%)
Query: 478 CNKYLNIMKMICNKHWGMNPTIGLNYYKATIRATLDFGSVFYSESCSSKLKTLDKVQNQA 537
C +NI++ + WG +P Y A IR+ D+GS S L LDK+Q +
Sbjct: 664 CENNINILRSLSGVWWGSHPYTQKILYNAIIRSHFDYGSFLLVPCIKSALSILDKIQAKC 723
Query: 538 LRLAMGYLNSTPIDNILVECRENPMSKRTPQLVDRFVLKVIS-SQTALAAKLNTLTVTHM 596
LR+ G + S+PI+ + VEC E P+ R L DRF LKVI S L KLN+L+
Sbjct: 724 LRIICGAMKSSPINALQVECGEAPLHLRRQYLSDRFFLKVIQFSNHPLIPKLNSLSDLIP 783
Query: 597 TSKYCKTKPTPPIVNSYCNISHQYGRELITYEKPIIYNYD-------YDIGKVSLQSETF 649
++KY K P ++ S + + P++ N YD+ ++ +
Sbjct: 784 SNKYWSHKEYPCLLTSLV--------KFLRLPCPVLQNQMFPLFATPYDV--LNFHPQIL 833
Query: 650 NEYRKHPDS-LQDAALSSEIQEKCPNAICIYTDASKKNEK--VGAAWFCPTYKSKACFKL 706
E+ S + + + ++E + +CIYTDASK ++ GAA + P Y FK
Sbjct: 834 LEFGIDKGSAIANVQFQNYVKEHWSDWLCIYTDASKMADQSNAGAAVWIPKYNIILNFKF 893
Query: 707 HPATSTYTAEVIGIWEALKYSASLKNNEILILTDSKSACQKLSKNCLNTTPTH-LELEIL 765
S +TAE I I EA+ + S K N +I +DSKS Q +++N + + L+I
Sbjct: 894 PSEISIFTAESIAILEAVSFVESHKLNNSIIFSDSKSCLQAIARNPFISKHNYPYILKIK 953
Query: 766 SSYKHLQNTCKTVKLAWIKGHEGIKGNVEVDRLAKYATVHGEASTIVISPTN 817
Q++ V+LAWI H GI GN VD AK AT G + P +
Sbjct: 954 DILFRCQSSNIQVRLAWIPSHSGIHGNETVDYYAKDATNTGCMDHFGVYPND 1005
|
Source: Danaus plexippus Species: Danaus plexippus Genus: Danaus Family: Nymphalidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|125901787|gb|ABN58714.1| pol-like protein [Biomphalaria glabrata] | Back alignment and taxonomy information |
|---|
| >gi|427791321|gb|JAA61112.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427791807|gb|JAA61355.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427798889|gb|JAA64896.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427798887|gb|JAA64895.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427798885|gb|JAA64894.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|323450868|gb|EGB06747.1| hypothetical protein AURANDRAFT_65424 [Aureococcus anophagefferens] | Back alignment and taxonomy information |
|---|
| >gi|427795117|gb|JAA63010.1| Hypothetical protein, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|392342464|ref|XP_003754596.1| PREDICTED: collagen alpha-3(VI) chain [Rattus norvegicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 821 | ||||||
| ASPGD|ASPL0000075333 | 486 | AN10625 [Emericella nidulans ( | 0.164 | 0.277 | 0.340 | 6.4e-09 | |
| ASPGD|ASPL0000017106 | 306 | AN7977 [Emericella nidulans (t | 0.155 | 0.418 | 0.302 | 3e-06 | |
| ASPGD|ASPL0000037597 | 666 | AN2711 [Emericella nidulans (t | 0.155 | 0.192 | 0.281 | 0.00024 | |
| ASPGD|ASPL0000010587 | 342 | AN3980 [Emericella nidulans (t | 0.147 | 0.353 | 0.285 | 0.0003 | |
| ASPGD|ASPL0000077547 | 1581 | AN8648 [Emericella nidulans (t | 0.155 | 0.080 | 0.295 | 0.0004 | |
| ASPGD|ASPL0000040226 | 1538 | AN2661 [Emericella nidulans (t | 0.153 | 0.081 | 0.285 | 0.00053 |
| ASPGD|ASPL0000075333 AN10625 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Score = 165 (63.1 bits), Expect = 6.4e-09, P = 6.4e-09
Identities = 47/138 (34%), Positives = 67/138 (48%)
Query: 668 IQEKCPNAICIYTDASKKNEKVGAAWFCPTYK-SKACFKLHPATST-YTAEVIGIWEALK 725
I + P I +YTD S N +VGAA CP Y S++ + + ST Y AE+ GI AL
Sbjct: 175 ILNRAPRPIALYTDGSGINGRVGAAAICPKYLISRSSYMGQQSESTVYVAELQGILLALV 234
Query: 726 YSASLKNNEILILTDSKSACQKLSKNCLNTTPTHLELEILSSYKHLQNTCKTVKLAWIKG 785
+ +I TD+++ Q L + LE I++ K + V WI
Sbjct: 235 IILQRQMQHAVIFTDNQATLQALRNPGSQSGQYILEAIIMALNKG-RKAGLNVHFRWIPA 293
Query: 786 HEGIKGNVEVDRLAKYAT 803
H G++GN + DR AK AT
Sbjct: 294 HRGVEGNEQADRRAKEAT 311
|
|
| ASPGD|ASPL0000017106 AN7977 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000037597 AN2711 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000010587 AN3980 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000077547 AN8648 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000040226 AN2661 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 821 | |||
| cd09276 | 128 | cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI dom | 3e-26 | |
| pfam00075 | 126 | pfam00075, RNase_H, RNase H | 2e-15 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 3e-15 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 4e-15 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 8e-15 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-14 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-13 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-12 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-11 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-11 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-11 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 7e-11 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 8e-11 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-10 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 4e-10 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 5e-10 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-10 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 7e-10 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-09 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-09 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-09 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 1e-09 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-09 | |
| cd06222 | 123 | cd06222, RNase_H, RNase H is an endonuclease that | 3e-09 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 4e-09 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 5e-09 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 7e-09 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-08 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-08 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 2e-08 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 3e-08 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 4e-08 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 4e-08 | |
| PRK12727 | 559 | PRK12727, PRK12727, flagellar biosynthesis regulat | 4e-08 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 4e-08 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 6e-08 | |
| PRK12372 | 413 | PRK12372, PRK12372, ribonuclease III; Reviewed | 1e-07 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 1e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-07 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 2e-07 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 2e-07 | |
| PRK14900 | 1052 | PRK14900, valS, valyl-tRNA synthetase; Provisional | 2e-07 | |
| cd09280 | 150 | cd09280, RNase_HI_eukaryote_like, Eukaryotic RNase | 3e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 4e-07 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 4e-07 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 4e-07 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 4e-07 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 5e-07 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 6e-07 | |
| PRK12373 | 400 | PRK12373, PRK12373, NADH dehydrogenase subunit E; | 6e-07 | |
| PRK12373 | 400 | PRK12373, PRK12373, NADH dehydrogenase subunit E; | 6e-07 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 7e-07 | |
| cd09273 | 135 | cd09273, RNase_HI_RT_Bel, Bel/Pao family of RNase | 7e-07 | |
| PTZ00436 | 357 | PTZ00436, PTZ00436, 60S ribosomal protein L19-like | 7e-07 | |
| PLN03209 | 576 | PLN03209, PLN03209, translocon at the inner envelo | 1e-06 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 2e-06 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 2e-06 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-06 | |
| PRK14900 | 1052 | PRK14900, valS, valyl-tRNA synthetase; Provisional | 2e-06 | |
| PRK12373 | 400 | PRK12373, PRK12373, NADH dehydrogenase subunit E; | 2e-06 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 2e-06 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 2e-06 | |
| PRK00708 | 209 | PRK00708, PRK00708, sec-independent translocase; P | 2e-06 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 3e-06 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 3e-06 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 4e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-06 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 6e-06 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 6e-06 | |
| PRK08691 | 709 | PRK08691, PRK08691, DNA polymerase III subunits ga | 6e-06 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 7e-06 | |
| PRK12727 | 559 | PRK12727, PRK12727, flagellar biosynthesis regulat | 8e-06 | |
| cd09278 | 139 | cd09278, RNase_HI_prokaryote_like, RNase HI family | 9e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 1e-05 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 1e-05 | |
| PRK14949 | 944 | PRK14949, PRK14949, DNA polymerase III subunits ga | 1e-05 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 1e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-05 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 2e-05 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 2e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 2e-05 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 2e-05 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 2e-05 | |
| PRK07003 | 830 | PRK07003, PRK07003, DNA polymerase III subunits ga | 3e-05 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 3e-05 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 4e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 5e-05 | |
| PTZ00436 | 357 | PTZ00436, PTZ00436, 60S ribosomal protein L19-like | 5e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 5e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 6e-05 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 6e-05 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 6e-05 | |
| TIGR01347 | 403 | TIGR01347, sucB, 2-oxoglutarate dehydrogenase comp | 7e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 8e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 8e-05 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 8e-05 | |
| PRK00708 | 209 | PRK00708, PRK00708, sec-independent translocase; P | 8e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 9e-05 | |
| PRK10118 | 408 | PRK10118, PRK10118, flagellar hook-length control | 9e-05 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 9e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 1e-04 | |
| PRK00708 | 209 | PRK00708, PRK00708, sec-independent translocase; P | 1e-04 | |
| PRK00708 | 209 | PRK00708, PRK00708, sec-independent translocase; P | 1e-04 | |
| COG0328 | 154 | COG0328, RnhA, Ribonuclease HI [DNA replication, r | 1e-04 | |
| pfam02993 | 238 | pfam02993, MCPVI, Minor capsid protein VI | 1e-04 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 1e-04 | |
| TIGR00601 | 378 | TIGR00601, rad23, UV excision repair protein Rad23 | 1e-04 | |
| PRK12372 | 413 | PRK12372, PRK12372, ribonuclease III; Reviewed | 2e-04 | |
| PTZ00436 | 357 | PTZ00436, PTZ00436, 60S ribosomal protein L19-like | 2e-04 | |
| PRK00708 | 209 | PRK00708, PRK00708, sec-independent translocase; P | 2e-04 | |
| TIGR02813 | 2582 | TIGR02813, omega_3_PfaA, polyketide-type polyunsat | 2e-04 | |
| COG3087 | 264 | COG3087, FtsN, Cell division protein [Cell divisio | 2e-04 | |
| PTZ00436 | 357 | PTZ00436, PTZ00436, 60S ribosomal protein L19-like | 3e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 3e-04 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 3e-04 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 3e-04 | |
| PHA03269 | 566 | PHA03269, PHA03269, envelope glycoprotein C; Provi | 3e-04 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 4e-04 | |
| PRK14900 | 1052 | PRK14900, valS, valyl-tRNA synthetase; Provisional | 4e-04 | |
| PRK12373 | 400 | PRK12373, PRK12373, NADH dehydrogenase subunit E; | 4e-04 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 4e-04 | |
| pfam10667 | 245 | pfam10667, DUF2486, Protein of unknown function (D | 4e-04 | |
| PRK12727 | 559 | PRK12727, PRK12727, flagellar biosynthesis regulat | 5e-04 | |
| PRK05704 | 407 | PRK05704, PRK05704, dihydrolipoamide succinyltrans | 5e-04 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 5e-04 | |
| PRK12799 | 421 | PRK12799, motB, flagellar motor protein MotB; Revi | 5e-04 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 5e-04 | |
| pfam07382 | 187 | pfam07382, HC2, Histone H1-like nucleoprotein HC2 | 5e-04 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 6e-04 | |
| pfam10310 | 436 | pfam10310, DUF2413, Protein of unknown function (D | 6e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 7e-04 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 7e-04 | |
| cd09279 | 128 | cd09279, RNase_HI_archaeal_like, RNAse HI family t | 7e-04 | |
| PRK10811 | 1068 | PRK10811, rne, ribonuclease E; Reviewed | 8e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 8e-04 | |
| PHA03379 | 935 | PHA03379, PHA03379, EBNA-3A; Provisional | 8e-04 | |
| pfam05539 | 408 | pfam05539, Pneumo_att_G, Pneumovirinae attachment | 9e-04 | |
| COG5373 | 931 | COG5373, COG5373, Predicted membrane protein [Func | 9e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 0.001 | |
| PLN03237 | 1465 | PLN03237, PLN03237, DNA topoisomerase 2; Provision | 0.001 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 0.001 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 0.001 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 0.001 | |
| PRK00708 | 209 | PRK00708, PRK00708, sec-independent translocase; P | 0.001 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 0.001 | |
| pfam07382 | 187 | pfam07382, HC2, Histone H1-like nucleoprotein HC2 | 0.001 | |
| pfam07382 | 187 | pfam07382, HC2, Histone H1-like nucleoprotein HC2 | 0.001 | |
| COG5373 | 931 | COG5373, COG5373, Predicted membrane protein [Func | 0.001 | |
| cd09277 | 133 | cd09277, RNase_HI_bacteria_HBD, Bacterial RNase HI | 0.001 | |
| pfam10243 | 506 | pfam10243, MIP-T3, Microtubule-binding protein MIP | 0.001 | |
| PRK14900 | 1052 | PRK14900, valS, valyl-tRNA synthetase; Provisional | 0.002 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 0.002 | |
| PRK08691 | 709 | PRK08691, PRK08691, DNA polymerase III subunits ga | 0.002 | |
| TIGR00601 | 378 | TIGR00601, rad23, UV excision repair protein Rad23 | 0.002 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 0.002 | |
| PRK13108 | 460 | PRK13108, PRK13108, prolipoprotein diacylglyceryl | 0.002 | |
| PRK11901 | 327 | PRK11901, PRK11901, hypothetical protein; Reviewed | 0.002 | |
| PRK11901 | 327 | PRK11901, PRK11901, hypothetical protein; Reviewed | 0.002 | |
| PHA03291 | 401 | PHA03291, PHA03291, envelope glycoprotein I; Provi | 0.002 | |
| PTZ00449 | 943 | PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti | 0.002 | |
| pfam05283 | 187 | pfam05283, MGC-24, Multi-glycosylated core protein | 0.002 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.002 | |
| PRK14907 | 295 | PRK14907, rplD, 50S ribosomal protein L4; Provisio | 0.002 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 0.003 | |
| PRK14900 | 1052 | PRK14900, valS, valyl-tRNA synthetase; Provisional | 0.003 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 0.003 | |
| PTZ00144 | 418 | PTZ00144, PTZ00144, dihydrolipoamide succinyltrans | 0.003 | |
| PRK11855 | 547 | PRK11855, PRK11855, dihydrolipoamide acetyltransfe | 0.003 | |
| PHA03269 | 566 | PHA03269, PHA03269, envelope glycoprotein C; Provi | 0.003 | |
| PHA03269 | 566 | PHA03269, PHA03269, envelope glycoprotein C; Provi | 0.003 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 0.003 | |
| TIGR02927 | 579 | TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogena | 0.003 | |
| pfam13456 | 88 | pfam13456, RVT_3, Reverse transcriptase-like | 0.003 | |
| pfam09507 | 427 | pfam09507, CDC27, DNA polymerase subunit Cdc27 | 0.003 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 0.003 | |
| PRK14724 | 987 | PRK14724, PRK14724, DNA topoisomerase III; Provisi | 0.003 | |
| PRK07735 | 430 | PRK07735, PRK07735, NADH dehydrogenase subunit C; | 0.003 | |
| PRK14959 | 624 | PRK14959, PRK14959, DNA polymerase III subunits ga | 0.003 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 0.004 | |
| PRK13808 | 333 | PRK13808, PRK13808, adenylate kinase; Provisional | 0.004 | |
| PTZ00436 | 357 | PTZ00436, PTZ00436, 60S ribosomal protein L19-like | 0.004 | |
| PRK00708 | 209 | PRK00708, PRK00708, sec-independent translocase; P | 0.004 | |
| PRK05035 | 695 | PRK05035, PRK05035, electron transport complex pro | 0.004 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 0.004 | |
| PRK10856 | 331 | PRK10856, PRK10856, cytoskeletal protein RodZ; Pro | 0.004 | |
| PRK12799 | 421 | PRK12799, motB, flagellar motor protein MotB; Revi | 0.004 | |
| pfam06070 | 777 | pfam06070, Herpes_UL32, Herpesvirus large structur | 0.004 | |
| PRK11907 | 814 | PRK11907, PRK11907, bifunctional 2',3'-cyclic nucl | 0.004 |
| >gnl|CDD|187700 cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI domain of reverse transcriptases | Back alignment and domain information |
|---|
Score = 103 bits (260), Expect = 3e-26
Identities = 44/130 (33%), Positives = 64/130 (49%), Gaps = 6/130 (4%)
Query: 677 CIYTDASKKNEKVGAAWFCP-TYKSKACFKLHPATSTYTAEVIGIWEALKYSASLKNN-- 733
IYTD SK + GA + +KL P S + AE++ I EAL+ +
Sbjct: 1 VIYTDGSKLEGRTGAGFAIVRKGTISRSYKLGPYCSVFDAELLAILEALQLALREGRRAR 60
Query: 734 EILILTDSKSACQKLSKNCLNTTPTHLELEILSSYKHLQNTCKTVKLAWIKGHEGIKGNV 793
+I I +DS++A + L + + L L I + + L N V+L W+ GH GI+GN
Sbjct: 61 KITIFSDSQAALKALRSP---RSSSPLVLRIRKAIRELANHGVKVRLHWVPGHSGIEGNE 117
Query: 794 EVDRLAKYAT 803
DRLAK A
Sbjct: 118 RADRLAKEAA 127
|
Ribonuclease H (RNase H) is classified into two families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). Ribonuclease HI (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes. RNase HI has also been observed as an adjunct domain to the reverse transcriptase gene in retroviruses, long-term repeat (LTR)-bearing retrotransposons and non-LTR retrotransposons. RNase HI in LTR retrotransposons perform degradation of the original RNA template, generation of a polypurine tract (the primer for plus-strand DNA synthesis), and final removal of RNA primers from newly synthesized minus and plus strands. The catalytic residues for RNase H enzymatic activity, three aspartatic acids and one glutamatic acid residue (DEDD), are unvaried across all RNase H domains. The position of the RNase domain of non-LTR and LTR transposons is at the carboxyl terminal of the reverse transcriptase (RT) domain and their RNase domains group together, indicating a common evolutionary origin. Many non-LTR transposons have lost the RNase domain because their activity is at the nucleus and cellular RNase may suffice; however LTR retotransposons always encode their own RNase domain because it requires RNase activity in RNA-protein particles in the cytoplasm. RNase H inhibitors have been explored as an anti-HIV drug target because RNase H inactivation inhibits reverse transcription. Length = 128 |
| >gnl|CDD|215695 pfam00075, RNase_H, RNase H | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187690 cd06222, RNase_H, RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237081 PRK12372, PRK12372, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187704 cd09280, RNase_HI_eukaryote_like, Eukaryotic RNase H is longer and more complex than their prokaryotic counterparts and unlike prokaryote, RNase H are essential in higher eukaryote | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237082 PRK12373, PRK12373, NADH dehydrogenase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237082 PRK12373, PRK12373, NADH dehydrogenase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187697 cd09273, RNase_HI_RT_Bel, Bel/Pao family of RNase HI in long-term repeat retroelements | Back alignment and domain information |
|---|
| >gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237082 PRK12373, PRK12373, NADH dehydrogenase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236333 PRK08691, PRK08691, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187702 cd09278, RNase_HI_prokaryote_like, RNase HI family found mainly in prokaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237863 PRK14949, PRK14949, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233365 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236652 PRK10118, PRK10118, flagellar hook-length control protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223405 COG0328, RnhA, Ribonuclease HI [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >gnl|CDD|237081 PRK12372, PRK12372, ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >gnl|CDD|225629 COG3087, FtsN, Cell division protein [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|165527 PHA03269, PHA03269, envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237082 PRK12373, PRK12373, NADH dehydrogenase subunit E; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220840 pfam10667, DUF2486, Protein of unknown function (DUF2486) | Back alignment and domain information |
|---|
| >gnl|CDD|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235571 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183756 PRK12799, motB, flagellar motor protein MotB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|219392 pfam07382, HC2, Histone H1-like nucleoprotein HC2 | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413) | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187703 cd09279, RNase_HI_archaeal_like, RNAse HI family that includes Archaeal RNase HI | Back alignment and domain information |
|---|
| >gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|223066 PHA03379, PHA03379, EBNA-3A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G | Back alignment and domain information |
|---|
| >gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215641 PLN03237, PLN03237, DNA topoisomerase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219392 pfam07382, HC2, Histone H1-like nucleoprotein HC2 | Back alignment and domain information |
|---|
| >gnl|CDD|219392 pfam07382, HC2, Histone H1-like nucleoprotein HC2 | Back alignment and domain information |
|---|
| >gnl|CDD|227665 COG5373, COG5373, Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|187701 cd09277, RNase_HI_bacteria_HBD, Bacterial RNase HI containing a hybrid binding domain (HBD) at the N-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 | Back alignment and domain information |
|---|
| >gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236333 PRK08691, PRK08691, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237284 PRK13108, PRK13108, prolipoprotein diacylglyceryl transferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237015 PRK11901, PRK11901, hypothetical protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237015 PRK11901, PRK11901, hypothetical protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223033 PHA03291, PHA03291, envelope glycoprotein I; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|191251 pfam05283, MGC-24, Multi-glycosylated core protein 24 (MGC-24) | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184900 PRK14907, rplD, 50S ribosomal protein L4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237855 PRK14900, valS, valyl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240289 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237000 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|165527 PHA03269, PHA03269, envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165527 PHA03269, PHA03269, envelope glycoprotein C; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200219 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|205634 pfam13456, RVT_3, Reverse transcriptase-like | Back alignment and domain information |
|---|
| >gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237803 PRK14724, PRK14724, DNA topoisomerase III; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|184923 PRK14959, PRK14959, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172341 PRK13808, PRK13808, adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185616 PTZ00436, PTZ00436, 60S ribosomal protein L19-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234818 PRK00708, PRK00708, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|236776 PRK10856, PRK10856, cytoskeletal protein RodZ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183756 PRK12799, motB, flagellar motor protein MotB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|218881 pfam06070, Herpes_UL32, Herpesvirus large structural phosphoprotein UL32 | Back alignment and domain information |
|---|
| >gnl|CDD|237019 PRK11907, PRK11907, bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 821 | |||
| COG0328 | 154 | RnhA Ribonuclease HI [DNA replication, recombinati | 99.84 | |
| PF00075 | 132 | RNase_H: RNase H; InterPro: IPR002156 The RNase H | 99.83 | |
| PRK06548 | 161 | ribonuclease H; Provisional | 99.83 | |
| PRK08719 | 147 | ribonuclease H; Reviewed | 99.82 | |
| PRK00203 | 150 | rnhA ribonuclease H; Reviewed | 99.82 | |
| cd06222 | 130 | RnaseH RNase H (RNase HI) is an endonuclease that | 99.7 | |
| KOG3752|consensus | 371 | 99.69 | ||
| PRK13907 | 128 | rnhA ribonuclease H; Provisional | 99.61 | |
| PRK07708 | 219 | hypothetical protein; Validated | 99.51 | |
| PRK07238 | 372 | bifunctional RNase H/acid phosphatase; Provisional | 99.35 | |
| PF13456 | 87 | RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EH | 99.01 | |
| PF09004 | 42 | DUF1891: Domain of unknown function (DUF1891); Int | 89.53 | |
| PHA03378 | 991 | EBNA-3B; Provisional | 88.15 | |
| PHA03378 | 991 | EBNA-3B; Provisional | 87.9 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 81.37 |
| >COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Probab=99.84 E-value=1.3e-20 Score=184.92 Aligned_cols=130 Identities=22% Similarity=0.163 Sum_probs=104.2
Q ss_pred cEEEeccccccC--CCcceEEecCCCc--cceeeccCCCCCcchhHHHHHHHHHHHHHhcCCCcEEEEcchHHHHHHHhh
Q psy16749 675 AICIYTDASKKN--EKVGAAWFCPTYK--SKACFKLHPATSTYTAEVIGIWEALKYSASLKNNEILILTDSKSACQKLSK 750 (821)
Q Consensus 675 ~i~IYTDGS~~~--g~vGagvv~~~~~--~~~~~~l~~~~T~~~AEL~AI~~ALe~a~~~~~~~I~I~SDSqsAL~~L~~ 750 (821)
.+.||+||+|.. |-.|+|+|+..++ ...+..+. .+||+++||+|++.||+++.+.+...|.|+|||++|+++|..
T Consensus 3 ~v~if~DGa~~gNpG~gG~g~vl~~~~~~~~~s~~~~-~tTNNraEl~A~i~AL~~l~~~~~~~v~l~tDS~yv~~~i~~ 81 (154)
T COG0328 3 KVEIFTDGACLGNPGPGGWGAVLRYGDGEKELSGGEG-RTTNNRAELRALIEALEALKELGACEVTLYTDSKYVVEGITR 81 (154)
T ss_pred ceEEEecCccCCCCCCceEEEEEEcCCceEEEeeeee-cccChHHHHHHHHHHHHHHHhcCCceEEEEecHHHHHHHHHH
Confidence 578999999994 5566777665333 23444444 889999999999999999999888999999999999999998
Q ss_pred cccC----CCC------CCchHHHHHHHHHHHhcCCcEEEEEecCCCCCcccHHHHHHHHHHhhcC
Q psy16749 751 NCLN----TTP------THLELEILSSYKHLQNTCKTVKLAWIKGHEGIKGNVEVDRLAKYATVHG 806 (821)
Q Consensus 751 ~~~~----~~p------~~~s~~i~~i~~~L~~~~~~V~~~WVPGHsGI~GNE~AD~LAK~A~~~~ 806 (821)
|..+ +|. ..+..+++++..++ .....|.+.||+||.|.++||+||+||+.|+...
T Consensus 82 w~~~w~~~~w~~~~~~pvkn~dl~~~~~~~~-~~~~~v~~~WVkgH~g~~~NeraD~LA~~~~~~~ 146 (154)
T COG0328 82 WIVKWKKNGWKTADKKPVKNKDLWEELDELL-KRHELVFWEWVKGHAGHPENERADQLAREAARAA 146 (154)
T ss_pred HHhhccccCccccccCccccHHHHHHHHHHH-hhCCeEEEEEeeCCCCChHHHHHHHHHHHHHHhh
Confidence 7553 333 23445677777666 4556999999999999999999999999998765
|
|
| >PF00075 RNase_H: RNase H; InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site | Back alignment and domain information |
|---|
| >PRK06548 ribonuclease H; Provisional | Back alignment and domain information |
|---|
| >PRK08719 ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >PRK00203 rnhA ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner | Back alignment and domain information |
|---|
| >KOG3752|consensus | Back alignment and domain information |
|---|
| >PRK13907 rnhA ribonuclease H; Provisional | Back alignment and domain information |
|---|
| >PRK07708 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK07238 bifunctional RNase H/acid phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13456 RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EHG_A 3HST_B | Back alignment and domain information |
|---|
| >PF09004 DUF1891: Domain of unknown function (DUF1891); InterPro: IPR015095 This domain is found at the extreme N terminus of eukaryotic alkylated DNA repair protein homologs | Back alignment and domain information |
|---|
| >PHA03378 EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >PHA03378 EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 821 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-14 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-10 | |
| 2kq2_A | 147 | Ribonuclease H-related protein; PSI, NESG, protein | 4e-11 | |
| 3p1g_A | 165 | Xenotropic murine leukemia virus-related virus (X | 9e-11 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-07 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 3e-06 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 8e-05 | |
| 2xag_A | 852 | Lysine-specific histone demethylase 1; amine oxida | 2e-06 | |
| 3qio_A | 150 | GAG-POL polyprotein; RNAse H, inhibitor, nuclease, | 2e-06 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 6e-06 | |
| 2qkb_A | 154 | Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy | 9e-06 | |
| 3dva_I | 428 | Dihydrolipoyllysine-residue acetyltransferase comp | 1e-05 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-05 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 2e-05 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 1e-04 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 4e-05 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 6e-05 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 8e-05 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 4e-04 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 5e-04 | |
| 1mu2_A | 555 | HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym | 1e-04 | |
| 2zd1_A | 557 | Reverse transcriptase/ribonuclease H; P51/P66, het | 4e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 8e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 75.7 bits (185), Expect = 5e-14
Identities = 59/375 (15%), Positives = 104/375 (27%), Gaps = 125/375 (33%)
Query: 420 TRPATTTSKPATTTSTDIE-DEMNQPFTPEELEA----------------AIKS-----G 457
TR T + T+T I D + TP+E+++ + +
Sbjct: 272 TRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLS 331
Query: 458 LITTPGRDNIHYPMIENLP--DCNKYLNIMKMICNKHWGMNPTIGLNYYKATIRATLDFG 515
+I RD + +N +C+K I++ N + P +
Sbjct: 332 IIAESIRDGLA--TWDNWKHVNCDKLTTIIESSLNV---LEPAEYRKMFD-------RL- 378
Query: 516 SVFYSESCSSKLKTL-----DKVQNQALRLAMGYLNSTPIDNILVECRENPMSKRTPQLV 570
SVF S L D +++ + + + LVE + + P +
Sbjct: 379 SVF-PPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYS-----LVEKQPKESTISIPSIY 432
Query: 571 DRFVLKVISSQTALAAKLNTLTVTH--MTSKYCKTKPTPPIVNSYCNISHQYGRELITYE 628
+K + ++ AL + V H + + PP ++ Y
Sbjct: 433 LELKVK-LENEYALHRSI----VDHYNIPKTFDSDDLIPPYLDQY--------------- 472
Query: 629 KPIIYNYDYDIG---KVSLQSETFNEYRKHPDSLQDAALSSEIQEKCPNAICIYTD---A 682
Y++ IG K E +R ++ D
Sbjct: 473 ---FYSH---IGHHLKNIEHPERMTLFRM-----------------------VFLDFRFL 503
Query: 683 SKKNEKVGAAWFCP-----------TYKSKACFKLHPATSTYTAEVIGIWEALKYSASLK 731
+K AW YK C P Y V I + L K
Sbjct: 504 EQKIRHDSTAWNASGSILNTLQQLKFYKPYIC-DNDP---KYERLVNAILDFLP-----K 554
Query: 732 NNEILILTDSKSACQ 746
E LI + +
Sbjct: 555 IEENLICSKYTDLLR 569
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A Length = 147 | Back alignment and structure |
|---|
| >3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A Length = 165 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Length = 852 | Back alignment and structure |
|---|
| >3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A Length = 150 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* Length = 154 | Back alignment and structure |
|---|
| >3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B Length = 555 | Back alignment and structure |
|---|
| >2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... Length = 557 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 821 | |||
| 2qkb_A | 154 | Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy | 99.89 | |
| 3qio_A | 150 | GAG-POL polyprotein; RNAse H, inhibitor, nuclease, | 99.86 | |
| 3h08_A | 146 | RNH (ribonuclease H); RNAse H, 3D-structure, endon | 99.85 | |
| 1jl1_A | 155 | Ribonuclease HI; RNAse HI, protein stability, ther | 99.83 | |
| 2e4l_A | 158 | Ribonuclease HI, RNAse HI; hydrolase, endoribonucl | 99.83 | |
| 3p1g_A | 165 | Xenotropic murine leukemia virus-related virus (X | 99.83 | |
| 2kq2_A | 147 | Ribonuclease H-related protein; PSI, NESG, protein | 99.83 | |
| 1ril_A | 166 | Ribonuclease H; hydrolase(endoribonuclease); 2.80A | 99.81 | |
| 2lsn_A | 165 | Reverse transcriptase; RNAse H, viral protein; NMR | 99.8 | |
| 3hst_B | 141 | Protein RV2228C/MT2287; ribonuclease H1, RV2228C N | 99.73 | |
| 3u3g_D | 140 | Ribonuclease H, RNAse H1; hydrolase, cleave the RN | 99.72 | |
| 2ehg_A | 149 | Ribonuclease HI; RNAse HI, hyperthermophilic archa | 99.7 | |
| 1mu2_A | 555 | HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym | 99.7 | |
| 2zd1_A | 557 | Reverse transcriptase/ribonuclease H; P51/P66, het | 99.68 | |
| 1zbf_A | 142 | Ribonuclease H-related protein; RNAse H, RNA/DNA h | 99.22 | |
| 4htu_A | 134 | Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine, | 99.08 |
| >2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* | Back alignment and structure |
|---|
Probab=99.89 E-value=5.7e-23 Score=199.84 Aligned_cols=132 Identities=17% Similarity=0.248 Sum_probs=107.5
Q ss_pred CCcEEEeccccccCC-----CcceEEecCCCcc-ceeeccCCCCCcchhHHHHHHHHHHHHHhcCCCcEEEEcchHHHHH
Q psy16749 673 PNAICIYTDASKKNE-----KVGAAWFCPTYKS-KACFKLHPATSTYTAEVIGIWEALKYSASLKNNEILILTDSKSACQ 746 (821)
Q Consensus 673 ~~~i~IYTDGS~~~g-----~vGagvv~~~~~~-~~~~~l~~~~T~~~AEL~AI~~ALe~a~~~~~~~I~I~SDSqsAL~ 746 (821)
.+.++||||||+..+ ..|+|+|+.+++. .....+...++++.|||.||+.||+++.+.+...|.||+||+++++
T Consensus 5 ~~~~~iytDGs~~~n~~~~~~aG~Gvv~~~~~~~~~~~~l~~~~tn~~aEl~A~~~aL~~~~~~~~~~v~i~tDS~~vi~ 84 (154)
T 2qkb_A 5 GDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTNSMFTIN 84 (154)
T ss_dssp TTEEEEEEEEEEETTTSSSCEEEEEEECSTTCTTCEEEECCSSCCHHHHHHHHHHHHHHHHHHTTCCEEEEEESCHHHHH
T ss_pred CCeEEEEEccCcCCCCCCCCcEEEEEEEECCCceeEEeecCCCCchHHHHHHHHHHHHHHHHhCCCceEEEEECcHHHHh
Confidence 467899999999843 2799999865432 3445565578999999999999999999888899999999999999
Q ss_pred HHhhccc----CCCC------CCchHHHHHHHHHHHhcCCcEEEEEecCCCCCcccHHHHHHHHHHhhcC
Q psy16749 747 KLSKNCL----NTTP------THLELEILSSYKHLQNTCKTVKLAWIKGHEGIKGNVEVDRLAKYATVHG 806 (821)
Q Consensus 747 ~L~~~~~----~~~p------~~~s~~i~~i~~~L~~~~~~V~~~WVPGHsGI~GNE~AD~LAK~A~~~~ 806 (821)
+|..|.. ++|. ..+..++.++..++. +..|.|.|||||+|++||++||+|||+|+..+
T Consensus 85 ~i~~~~~~w~~~~w~~~~~~~~~n~~l~~~i~~l~~--~~~v~~~~V~~H~g~~~N~~AD~LA~~a~~~~ 152 (154)
T 2qkb_A 85 GITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQ--GMDIQWMHVPGHSGFIGNEEADRLAREGAKQS 152 (154)
T ss_dssp HHHTHHHHHHTTTSBCTTSSBCTTHHHHHHHHHHHT--TCEEEEEECCTTSSCHHHHHHHHHHHHHHTCC
T ss_pred hhhhhHHHHHhccccccCCCccccHHHHHHHHHHHc--CCceEEEEccCCCCCHhHHHHHHHHHHHHHhc
Confidence 9998642 3333 334567888877764 46799999999999999999999999999865
|
| >3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} SCOP: c.55.3.1 PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A | Back alignment and structure |
|---|
| >3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 3aa4_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 3aa3_A 3aa2_A 3aa5_X 1rbv_A ... | Back alignment and structure |
|---|
| >2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis} PDB: 2zqb_A | Back alignment and structure |
|---|
| >3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A 4e89_A | Back alignment and structure |
|---|
| >2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A | Back alignment and structure |
|---|
| >1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A | Back alignment and structure |
|---|
| >2lsn_A Reverse transcriptase; RNAse H, viral protein; NMR {Simian foamy virus} | Back alignment and structure |
|---|
| >3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3u3g_D Ribonuclease H, RNAse H1; hydrolase, cleave the RNA strand of RNA/DNA hybrid; 1.40A {Uncultured organism} | Back alignment and structure |
|---|
| >2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, D stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii} PDB: 3aly_A | Back alignment and structure |
|---|
| >1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B | Back alignment and structure |
|---|
| >2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... | Back alignment and structure |
|---|
| >1zbf_A Ribonuclease H-related protein; RNAse H, RNA/DNA hybrid, DDE motif, hydrolase; 1.50A {Bacillus halodurans} SCOP: c.55.3.1 PDB: 1zbi_A 2g8u_A 2g8i_A 2g8h_A 2g8k_A 2g8f_A 2g8v_A 2g8w_A 3ey1_A* 1zbl_A 3d0p_A* 3i8d_A* 2r7y_A* | Back alignment and structure |
|---|
| >4htu_A Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine, W-C base PAIR, wobble base PAIR, D helix; HET: DNA UCL; 1.49A {Bacillus halodurans} PDB: 3d0p_A* 4hue_A* 4huf_A* 4hug_A* 1zbf_A 1zbi_A 2g8u_A 3uld_A* 3ey1_A* 3twh_A* 2g8f_A 2g8v_A 2g8w_A 2g8i_A 2g8h_A 2g8k_A 3i8d_A* 2r7y_A* 1zbl_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 821 | ||||
| d1mu2a1 | 126 | c.55.3.1 (A:430-555) HIV RNase H (Domain of revers | 4e-13 | |
| d1s1ta1 | 110 | c.55.3.1 (A:430-539) HIV RNase H (Domain of revers | 4e-09 | |
| d1jl1a_ | 152 | c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli | 2e-08 | |
| d1rila_ | 147 | c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermoph | 3e-07 |
| >d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} Length = 126 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Ribonuclease H-like family: Ribonuclease H domain: HIV RNase H (Domain of reverse transcriptase) species: Human immunodeficiency virus type 2 [TaxId: 11709]
Score = 64.5 bits (156), Expect = 4e-13
Identities = 32/130 (24%), Positives = 47/130 (36%), Gaps = 9/130 (6%)
Query: 673 PNAICIYTDASKKNEKVGAAWFCPTYKSKACFKLHPATSTYTAEVIGIWEALKYSASLKN 732
P A YTD S + T + K K T+ AE+ AL S N
Sbjct: 5 PGAETFYTDGSCNRQSKEGKAGYVTDRGKDKVKKLEQTTNQQAELEAFAMALTDSGPKVN 64
Query: 733 NEILILTDSKSACQKLSKNCLNTTPTHLELEILSSYKHLQNTCKTVKLAWIKGHEGIKGN 792
I+ DS+ ++ + + I K + + +AW+ H+GI GN
Sbjct: 65 ----IIVDSQYVMGIVASQPTESESKIVNQIIEEMIKK-----EAIYVAWVPAHKGIGGN 115
Query: 793 VEVDRLAKYA 802
EVD L
Sbjct: 116 QEVDHLVSQG 125
|
| >d1s1ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} Length = 110 | Back information, alignment and structure |
|---|
| >d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} Length = 152 | Back information, alignment and structure |
|---|
| >d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} Length = 147 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 821 | |||
| d1mu2a1 | 126 | HIV RNase H (Domain of reverse transcriptase) {Hum | 99.85 | |
| d1rila_ | 147 | RNase H (RNase HI) {Thermus thermophilus [TaxId: 2 | 99.84 | |
| d1jl1a_ | 152 | RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | 99.84 | |
| d1s1ta1 | 110 | HIV RNase H (Domain of reverse transcriptase) {Hum | 99.62 | |
| d1zbfa1 | 132 | BH0863-like Ribonuclease H {Bacillus halodurans [T | 99.4 |
| >d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Ribonuclease H-like family: Ribonuclease H domain: HIV RNase H (Domain of reverse transcriptase) species: Human immunodeficiency virus type 2 [TaxId: 11709]
Probab=99.85 E-value=5.6e-22 Score=184.63 Aligned_cols=121 Identities=24% Similarity=0.279 Sum_probs=89.5
Q ss_pred CCCcEEEeccccccC--CCcceEEecCCCccceeeccCCCCCcchhHHHHHHHHHHHHHhcCCCcEEEEcchHHHHHHHh
Q psy16749 672 CPNAICIYTDASKKN--EKVGAAWFCPTYKSKACFKLHPATSTYTAEVIGIWEALKYSASLKNNEILILTDSKSACQKLS 749 (821)
Q Consensus 672 ~~~~i~IYTDGS~~~--g~vGagvv~~~~~~~~~~~l~~~~T~~~AEL~AI~~ALe~a~~~~~~~I~I~SDSqsAL~~L~ 749 (821)
..+...||||||+.. +..|+|+++..++. ....+ ...+|+.|||.||++||++ ....+.||+||+++++.|.
T Consensus 4 ~~~~~t~YTDGS~~~n~~~~~~g~~~~~~~~-~~~~~-~~~tnn~AEl~Ai~~al~~----~~~~i~I~tDS~~v~~~~~ 77 (126)
T d1mu2a1 4 IPGAETFYTDGSCNRQSKEGKAGYVTDRGKD-KVKKL-EQTTNQQAELEAFAMALTD----SGPKVNIIVDSQYVMGIVA 77 (126)
T ss_dssp CTTCEEEEEEEEECTTTCCEEEEEEETTSCE-EEEEE-SSCCHHHHHHHHHHHHHHT----SCSEEEEEESCHHHHHHHH
T ss_pred CCCCcEEEEcCCCCCCCCcEEEEEEecCCCE-EEEec-CCCcchHHHHHHHHHHhcc----CCcceEEEechHHHHHHHh
Confidence 356689999999884 34566666654432 22333 3579999999999999975 4578999999999999999
Q ss_pred hcccCCCCCCchHHHHHHHHHHHhcCCcEEEEEecCCCCCcccHHHHHHHHHHh
Q psy16749 750 KNCLNTTPTHLELEILSSYKHLQNTCKTVKLAWIKGHEGIKGNVEVDRLAKYAT 803 (821)
Q Consensus 750 ~~~~~~~p~~~s~~i~~i~~~L~~~~~~V~~~WVPGHsGI~GNE~AD~LAK~A~ 803 (821)
+|.. ......+.+++..+. +...|+|.|||||+|+.|||+||+||++|+
T Consensus 78 ~~~~----~~~~~~~~~~~~~~~-~~~~v~~~wV~gH~g~~gNe~AD~LA~~ai 126 (126)
T d1mu2a1 78 SQPT----ESESKIVNQIIEEMI-KKEAIYVAWVPAHKGIGGNQEVDHLVSQGI 126 (126)
T ss_dssp TCCS----EESCHHHHHHHHHHH-HCSEEEEEECCSSSCCTTHHHHHHHHHTTC
T ss_pred cCCc----cccchHHHHHHHHhh-hcceeEEEEEeCCCCCcchHHHHHHHHhhC
Confidence 8432 122233444344333 346999999999999999999999999874
|
| >d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s1ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} | Back information, alignment and structure |
|---|
| >d1zbfa1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|