Psyllid ID: psy16819

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MDQLVFKMEEPPELEQIDDSSMFKMEPNDSDVDFGPQMRIRSNTWPLPRPDNYVDEPSPPTSAKLEDFETLGGELSALLSESKCNGGLLNCPTAGGLALKKTATSRRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKMRIRSNTWPLPRPDNYVDEPSPPTSAKLEDFETLGGELSALLSESKCNGGLLNCPTAGGLALKKTATSRRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKFFKKFR
cccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccHHHHcccccccccccHHHHHHHHHHccccccccHHHHHHHHHccccccccccccccccccccccccc
ccEEEEEEccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccccccEEccccc
mdqlvfkmeeppeleqiddssmfkmepndsdvdfgpqmrirsntwplprpdnyvdepspptsakledFETLGGELSALLSEskcnggllncptagglalkKTATSrrnawgsssyADLISQAIQSSPEQRLTLSQIYDWMIqnvpyfkdkgdsnssagwkmrirsntwplprpdnyvdepspptsakledFETLGGELSALLSEskcnggllncptagglalkKTATSrrnawgsssyADLISQAIQSSPEQRLTLSQIYDWMIqnvpyfkdkgdsnssaGWKFFKKFR
mdqlvfkmeeppeleqiddssmfKMEPndsdvdfgpQMRIRsntwplprpdnyvdepsppTSAKLEDFETLGGELSALLSESKCNGGLLNCPTAGGLALKKTATSRRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFkdkgdsnssagWKMRIRsntwplprpdnyVDEPSPPTSAKLEDFETLGGELSALLSESKCNGGLLNCPTAGGLALKKTATSRRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFkdkgdsnssagwkffkkfr
MDQLVFKMEEPPELEQIDDSSMFKMEPNDSDVDFGPQMRIRSNTWPLPRPDNYVDEPSPPTSAKLEDFETlggelsallsesKCNGGLLNCPTAGGLALKKTATSRRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKMRIRSNTWPLPRPDNYVDEPSPPTSAKLEDFETlggelsallsesKCNGGLLNCPTAGGLALKKTATSRRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKFFKKFR
****************************************************************************ALLSESKCNGGLLNCPTAGGLALKKTA*****AWG***YADLI**********RLTLSQIYDWMIQNVPYFKD**************************************************ALLSESKCNGGLLNCPTAGGLALKKTA*****AWG***YADLI**********RLTLSQIYDWMIQNVPYFKD*****************
***LVFKMEEP*******************************************************************************************************YADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKG**********RIRSNTWPLPRPDNYVDEPSPPTSAKLEDFETLGGELSALLSESKCNGGLLN****************************************LTLSQIYDWMIQNVPYFKDKGDSNSSAGWKF*K***
MDQLVFKMEEPPELEQIDDSSMFKMEPNDSDVDFGPQMRIRSNTWPLPRPDNYVDEPSPPTSAKLEDFETLGGELSALLSESKCNGGLLNCPTAGGLALKKTATSRRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKMRIRSNTWPLPRPDNYVDEPSPPTSAKLEDFETLGGELSALLSESKCNGGLLNCPTAGGLALKKTATSRRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKFFKKFR
*DQLVFKMEEPPELEQIDDSSMFKMEPNDSDVDFGPQMRIRSNTWPLPRPD********************************************************NAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKD*************IRSNTWPLPRPDN********************************************************AWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKD*****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQLVFKMEEPPELEQIDDSSMFKMEPNDSDVDFGPQMRIRSNTWPLPRPDNYVDEPSPPTSAKLEDFETLGGELSALLSESKCNGGLLNCPTAGGLALKKTATSRRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKMRIRSNTWPLPRPDNYVDEPSPPTSAKLEDFETLGGELSALLSESKCNGGLLNCPTAGGLALKKTATSRRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKFFKKFR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query289 2.2.26 [Sep-21-2011]
Q298W7 644 Forkhead box protein O OS yes N/A 0.418 0.187 0.514 4e-32
Q95V55 613 Forkhead box protein O OS yes N/A 0.418 0.197 0.507 9e-31
B4G4S8 629 Forkhead box protein O OS N/A N/A 0.411 0.189 0.529 9e-31
B4HF64 609 Forkhead box protein O OS N/A N/A 0.418 0.198 0.507 9e-31
B3P0K6 615 Forkhead box protein O OS N/A N/A 0.418 0.196 0.507 1e-30
B4PTD3 628 Forkhead box protein O OS N/A N/A 0.418 0.192 0.522 1e-30
B3LYS5 600 Forkhead box protein O OS N/A N/A 0.418 0.201 0.507 1e-30
P98177 505 Forkhead box protein O4 O yes N/A 0.474 0.271 0.528 4e-30
Q9WVH3 505 Forkhead box protein O4 O yes N/A 0.474 0.271 0.528 6e-30
A8MYZ6 492 Forkhead box protein O6 O no N/A 0.463 0.272 0.536 9e-30
>sp|Q298W7|FOXO_DROPS Forkhead box protein O OS=Drosophila pseudoobscura pseudoobscura GN=foxo PE=3 SV=2 Back     alignment and function desciption
 Score =  138 bits (348), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 86/136 (63%), Gaps = 15/136 (11%)

Query: 31  DVDFGPQMRIRSNTWPLPRPDNYVDEPSPPTSAKLEDFETLGGELSALLSESKCNGGLLN 90
           DV F PQ R RSNTWP PRP+N+V+ P    S K  + +   G+    +  +        
Sbjct: 36  DVGFEPQTRARSNTWPCPRPENFVEPPDELDSTKASNQQLAAGDSQQAIQNANA------ 89

Query: 91  CPTAGGLALKKTATSRRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDK 150
                     K  +SRRNAWG+ SYADLI+ AI S+ ++RLTLSQIY+WM+QNVPYFKDK
Sbjct: 90  ---------AKKNSSRRNAWGNLSYADLITHAIGSATDKRLTLSQIYEWMVQNVPYFKDK 140

Query: 151 GDSNSSAGWKMRIRSN 166
           GDSNSSAGWK  IR N
Sbjct: 141 GDSNSSAGWKNSIRHN 156
Transcription factor involved in the regulation of the insulin signaling pathway. Consistently activates both the downstream target Thor\d4EBP and the feedback control target InR. Involved in negative regulation of the cell cycle, modulating cell growth and proliferation. In response to cellular stresses, such as nutrient deprivation or increased levels of reactive oxygen species, foxo is activated and inhibits growth through the action of target genes such as Thor. Foxo activated in the adult fat body can regulate lifespan in adults; an insulin peptide itself may function as one secondary messenger of insulin-regulated aging. Also regulates Lip4, homolog of human acid lipases, thereby acting as a key modulator of lipid metabolism by insulin signaling and integrates insulin responses to glucose and lipid homeostasis.
Drosophila pseudoobscura pseudoobscura (taxid: 46245)
>sp|Q95V55|FOXO_DROME Forkhead box protein O OS=Drosophila melanogaster GN=foxo PE=1 SV=1 Back     alignment and function description
>sp|B4G4S8|FOXO_DROPE Forkhead box protein O OS=Drosophila persimilis GN=foxo PE=3 SV=2 Back     alignment and function description
>sp|B4HF64|FOXO_DROSE Forkhead box protein O OS=Drosophila sechellia GN=foxo PE=3 SV=2 Back     alignment and function description
>sp|B3P0K6|FOXO_DROER Forkhead box protein O OS=Drosophila erecta GN=foxo PE=3 SV=2 Back     alignment and function description
>sp|B4PTD3|FOXO_DROYA Forkhead box protein O OS=Drosophila yakuba GN=foxo PE=3 SV=2 Back     alignment and function description
>sp|B3LYS5|FOXO_DROAN Forkhead box protein O OS=Drosophila ananassae GN=foxo PE=3 SV=2 Back     alignment and function description
>sp|P98177|FOXO4_HUMAN Forkhead box protein O4 OS=Homo sapiens GN=FOXO4 PE=1 SV=5 Back     alignment and function description
>sp|Q9WVH3|FOXO4_MOUSE Forkhead box protein O4 OS=Mus musculus GN=Foxo4 PE=1 SV=1 Back     alignment and function description
>sp|A8MYZ6|FOXO6_HUMAN Forkhead box protein O6 OS=Homo sapiens GN=FOXO6 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
384071177 523 FoxO protein [Blattella germanica] 0.453 0.250 0.557 2e-33
241997566 652 zinc finger protein, putative [Ixodes sc 0.373 0.165 0.572 4e-32
325303488190 TPA_inf: forkhead/HNF3 family transcript 0.377 0.573 0.565 2e-31
118193703 566 forkhead box subgroup O [Aedes aegypti] 0.425 0.217 0.551 7e-31
383859600 573 PREDICTED: forkhead box protein O-like [ 0.453 0.228 0.521 9e-31
391333748 544 PREDICTED: forkhead box protein O-like [ 0.397 0.211 0.548 1e-30
427781639318 Putative transcription factor of the for 0.380 0.345 0.550 2e-30
198452262 644 GA16248 [Drosophila pseudoobscura pseudo 0.418 0.187 0.514 2e-30
328708966 453 PREDICTED: forkhead box protein O-like [ 0.463 0.295 0.547 4e-30
307206320177 Forkhead box protein O6 [Harpegnathos sa 0.408 0.666 0.552 8e-30
>gi|384071177|emb|CCF23214.1| FoxO protein [Blattella germanica] Back     alignment and taxonomy information
 Score =  149 bits (375), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 82/147 (55%), Positives = 97/147 (65%), Gaps = 16/147 (10%)

Query: 25  MEPNDSDVD--FGPQMRIRSNTWPLPRPDNYVDEPSPPTSAKLEDFETLGGEL---SALL 79
           MEP  +++D  F PQ R RSNTWPLPRPDN+VD    P        +  GG +     ++
Sbjct: 2   MEPTLAELDSGFEPQQRARSNTWPLPRPDNFVDIKEEP------GIKCPGGVVLPCGGVM 55

Query: 80  SESKCNGGLLNCPTAGGLALKKTATSRRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDW 139
                  G L  PTA      K  +SRRNAWG+ SYADLI+QAI S+PE+RLTLSQIY+W
Sbjct: 56  GPEGTLAGGLQLPTA-----TKKNSSRRNAWGNLSYADLITQAITSAPEKRLTLSQIYEW 110

Query: 140 MIQNVPYFKDKGDSNSSAGWKMRIRSN 166
           M+QNVPYFKDKGDSNSSAGWK  IR N
Sbjct: 111 MVQNVPYFKDKGDSNSSAGWKNSIRHN 137

Source: Blattella germanica

Species: Blattella germanica

Genus: Blattella

Family: Ectobiidae

Order: Blattodea

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|241997566|ref|XP_002433432.1| zinc finger protein, putative [Ixodes scapularis] gi|215490855|gb|EEC00496.1| zinc finger protein, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|325303488|tpg|DAA34163.1| TPA_inf: forkhead/HNF3 family transcription factor [Amblyomma variegatum] Back     alignment and taxonomy information
>gi|118193703|gb|ABK76646.1| forkhead box subgroup O [Aedes aegypti] Back     alignment and taxonomy information
>gi|383859600|ref|XP_003705281.1| PREDICTED: forkhead box protein O-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|391333748|ref|XP_003741272.1| PREDICTED: forkhead box protein O-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|427781639|gb|JAA56271.1| Putative transcription factor of the forkhead/hnf3 family [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|198452262|ref|XP_001358695.2| GA16248 [Drosophila pseudoobscura pseudoobscura] gi|302425232|sp|Q298W7.2|FOXO_DROPS RecName: Full=Forkhead box protein O gi|198131856|gb|EAL27838.2| GA16248 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|328708966|ref|XP_001944722.2| PREDICTED: forkhead box protein O-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307206320|gb|EFN84377.1| Forkhead box protein O6 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
ZFIN|ZDB-GENE-050116-1 643 foxo3a "forkhead box O3A" [Dan 0.387 0.174 0.495 5e-33
UNIPROTKB|G3N0Z9 513 G3N0Z9 "Uncharacterized protei 0.290 0.163 0.553 1.7e-32
UNIPROTKB|B4G4S8 629 foxo "Forkhead box protein O" 0.235 0.108 0.739 1e-30
UNIPROTKB|Q6EUW1 657 foxo3 "Forkhead box protein O3 0.252 0.111 0.684 3.8e-30
UNIPROTKB|Q66JJ0 626 foxo1 "Forkhead box protein O1 0.231 0.107 0.791 4.1e-30
UNIPROTKB|Q6EUW2 631 foxo1 "Forkhead box protein O1 0.231 0.106 0.791 4.2e-30
UNIPROTKB|Q8T5L2 593 4F11.4 "Putative transcription 0.415 0.202 0.534 4.5e-30
ZFIN|ZDB-GENE-061013-59 652 foxo1a "forkhead box O1 a" [Da 0.252 0.111 0.726 5.1e-30
UNIPROTKB|E1BBI0 611 E1BBI0 "Uncharacterized protei 0.435 0.206 0.522 6.1e-30
UNIPROTKB|A8MYZ6 492 FOXO6 "Forkhead box protein O6 0.456 0.268 0.514 1e-29
ZFIN|ZDB-GENE-050116-1 foxo3a "forkhead box O3A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 283 (104.7 bits), Expect = 5.0e-33, Sum P(3) = 5.0e-33
 Identities = 59/119 (49%), Positives = 77/119 (64%)

Query:    50 PDNYVDEPSPPTSAKLEDFETXXXXXXXXXXXXKCNGGLLNCPTAGGLALK--KTATSRR 107
             P +    P+  T+A   D +              C+   +N     GL  +  + +++RR
Sbjct:    83 PSSAAALPAIETNASANDKDIYGSPGSSQHALAACSDSSIN-----GLIPQQPRKSSARR 137

Query:   108 NAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKMRIRSN 166
             NAWG+ SYADLI+QAI+SSPE+RLTL+QIYDWM++NVPYFKDKGDSNSSAGWK  IR N
Sbjct:   138 NAWGNYSYADLITQAIESSPEKRLTLAQIYDWMVRNVPYFKDKGDSNSSAGWKNSIRHN 196
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0005667 "transcription factor complex" evidence=IBA
GO:0008286 "insulin receptor signaling pathway" evidence=IBA
GO:0051090 "regulation of sequence-specific DNA binding transcription factor activity" evidence=IBA
GO:0048513 "organ development" evidence=IBA
GO:0008134 "transcription factor binding" evidence=IBA
GO:0042127 "regulation of cell proliferation" evidence=IBA
GO:0006974 "response to DNA damage stimulus" evidence=IBA
GO:0007389 "pattern specification process" evidence=IBA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IBA
GO:0008301 "DNA binding, bending" evidence=IBA
GO:0003690 "double-stranded DNA binding" evidence=IBA
GO:0009888 "tissue development" evidence=IBA
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IBA
GO:0019901 "protein kinase binding" evidence=IBA
GO:0009790 "embryo development" evidence=IBA
GO:0005829 "cytosol" evidence=IBA
GO:0051960 "regulation of nervous system development" evidence=IMP
GO:0043523 "regulation of neuron apoptotic process" evidence=IMP
GO:0005634 "nucleus" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
UNIPROTKB|G3N0Z9 G3N0Z9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B4G4S8 foxo "Forkhead box protein O" [Drosophila persimilis (taxid:7234)] Back     alignment and assigned GO terms
UNIPROTKB|Q6EUW1 foxo3 "Forkhead box protein O3" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q66JJ0 foxo1 "Forkhead box protein O1" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q6EUW2 foxo1 "Forkhead box protein O1" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q8T5L2 4F11.4 "Putative transcription factor" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061013-59 foxo1a "forkhead box O1 a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BBI0 E1BBI0 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A8MYZ6 FOXO6 "Forkhead box protein O6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P98177FOXO4_HUMANNo assigned EC number0.52810.47400.2712yesN/A
Q298W7FOXO_DROPSNo assigned EC number0.51470.41860.1878yesN/A
Q95V55FOXO_DROMENo assigned EC number0.50730.41860.1973yesN/A
Q9WVH3FOXO4_MOUSENo assigned EC number0.52810.47400.2712yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
cd0005978 cd00059, FH, Forkhead (FH), also known as a "winge 1e-17
cd0005978 cd00059, FH, Forkhead (FH), also known as a "winge 5e-16
smart0033989 smart00339, FH, FORKHEAD 1e-14
smart0033989 smart00339, FH, FORKHEAD 2e-13
pfam0025096 pfam00250, Fork_head, Fork head domain 1e-12
pfam0025096 pfam00250, Fork_head, Fork head domain 5e-11
COG5025 610 COG5025, COG5025, Transcription factor of the Fork 2e-05
>gnl|CDD|238016 cd00059, FH, Forkhead (FH), also known as a "winged helix" Back     alignment and domain information 
 Score = 75.3 bits (186), Expect = 1e-17
 Identities = 30/53 (56%), Positives = 37/53 (69%), Gaps = 5/53 (9%)

Query: 114 SYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKMRIRSN 166
           SY+ LI+ AIQSSPE+RLTLS+IY W+  N PYF+D       AGW+  IR N
Sbjct: 5   SYSALIAMAIQSSPEKRLTLSEIYKWISDNFPYFRDA-----PAGWQNSIRHN 52

FH is named for the Drosophila fork head protein, a transcription factor which promotes terminal rather than segmental development. This family of transcription factor domains, which bind to B-DNA as monomers, are also found in the Hepatocyte nuclear factor (HNF) proteins, which provide tissue-specific gene regulation. The structure contains 2 flexible loops or "wings" in the C-terminal region, hence the term winged helix. Length = 78
>gnl|CDD|238016 cd00059, FH, Forkhead (FH), also known as a "winged helix" Back     alignment and domain information
>gnl|CDD|214627 smart00339, FH, FORKHEAD Back     alignment and domain information
>gnl|CDD|214627 smart00339, FH, FORKHEAD Back     alignment and domain information
>gnl|CDD|189470 pfam00250, Fork_head, Fork head domain Back     alignment and domain information
>gnl|CDD|189470 pfam00250, Fork_head, Fork head domain Back     alignment and domain information
>gnl|CDD|227358 COG5025, COG5025, Transcription factor of the Forkhead/HNF3 family [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 289
cd0005978 FH Forkhead (FH), also known as a "winged helix". 100.0
smart0033989 FH FORKHEAD. FORKHEAD, also known as a "winged hel 99.97
PF0025096 Fork_head: Fork head domain; InterPro: IPR001766 T 99.97
KOG3563|consensus 454 99.95
KOG2294|consensus 454 99.94
KOG3562|consensus277 99.92
COG5025 610 Transcription factor of the Forkhead/HNF3 family [ 99.88
cd0005978 FH Forkhead (FH), also known as a "winged helix". 99.83
KOG4385|consensus581 99.79
smart0033989 FH FORKHEAD. FORKHEAD, also known as a "winged hel 99.78
PF0025096 Fork_head: Fork head domain; InterPro: IPR001766 T 99.74
KOG3563|consensus 454 99.72
COG5025 610 Transcription factor of the Forkhead/HNF3 family [ 99.7
KOG2294|consensus 454 99.61
KOG3562|consensus 277 99.5
KOG4385|consensus 581 99.26
PF0053877 Linker_histone: linker histone H1 and H5 family; I 92.39
smart0052666 H15 Domain in histone families 1 and 5. 91.72
cd0007388 H15 linker histone 1 and histone 5 domains; the ba 89.52
smart0052666 H15 Domain in histone families 1 and 5. 87.74
PF0053877 Linker_histone: linker histone H1 and H5 family; I 87.69
KOG4012|consensus243 82.21
>cd00059 FH Forkhead (FH), also known as a "winged helix" Back     alignment and domain information 
Probab=100.00  E-value=2.5e-34  Score=222.94  Aligned_cols=78  Identities=45%  Similarity=0.738  Sum_probs=75.8

Q ss_pred             CCCCcHHHHHHHHHhcCCCCCcCHHHHHHHHHhcCCccccCCCCCCCCCcccccccccCCCCCCCCCCCCCCCCCCCCCc
Q psy16819        110 WGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKMRIRSNTWPLPRPDNYVDEPSPPTSAKLE  189 (289)
Q Consensus       110 kP~~SYa~LI~~AI~ssp~~~LTL~eIY~wi~~~~pyf~~~~ds~s~~gWknSIRHNL~~~s~~~~F~k~~~~~~~~g~g  189 (289)
                      ||++||++||++||+++|+++|||+|||+||+++||||+.++     .||||||||||   |+|+||+|+++..+.+|+|
T Consensus         1 kP~~sY~~LI~~Ai~~sp~~~lTL~eIy~~I~~~~pyyr~~~-----~gWknSIRHnL---S~n~~F~kv~r~~~~~gkg   72 (78)
T cd00059           1 KPPYSYSALIAMAIQSSPEKRLTLSEIYKWISDNFPYFRDAP-----AGWQNSIRHNL---SLNKCFVKVPREPDEPGKG   72 (78)
T ss_pred             CCCCCHHHHHHHHHHhCCCCCeeHHHHHHHHHHhCCccccCC-----CCCccceeEec---ccccceEECCCCCCCCCCC
Confidence            799999999999999999999999999999999999999986     89999999999   9999999999999999999


Q ss_pred             cccccc
Q psy16819        190 DFETLG  195 (289)
Q Consensus       190 ~~w~v~  195 (289)
                      +||+|+
T Consensus        73 ~~W~i~   78 (78)
T cd00059          73 SYWTLD   78 (78)
T ss_pred             CeeeeC
Confidence            999986

FH is named for the Drosophila fork head protein, a transcription factor which promotes terminal rather than segmental development. This family of transcription factor domains, which bind to B-DNA as monomers, are also found in the Hepatocyte nuclear factor (HNF) proteins, which provide tissue-specific gene regulation. The structure contains 2 flexible loops or "wings" in the C-terminal region, hence the term winged helix.
>smart00339 FH FORKHEAD Back     alignment and domain information
>PF00250 Fork_head: Fork head domain; InterPro: IPR001766 The fork head protein of Drosophila melanogaster, a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [] Back     alignment and domain information
>KOG3563|consensus Back     alignment and domain information
>KOG2294|consensus Back     alignment and domain information
>KOG3562|consensus Back     alignment and domain information
>COG5025 Transcription factor of the Forkhead/HNF3 family [Transcription] Back     alignment and domain information
>cd00059 FH Forkhead (FH), also known as a "winged helix" Back     alignment and domain information
>KOG4385|consensus Back     alignment and domain information
>smart00339 FH FORKHEAD Back     alignment and domain information
>PF00250 Fork_head: Fork head domain; InterPro: IPR001766 The fork head protein of Drosophila melanogaster, a transcription factor that promotes terminal rather than segmental development, contains neither homeodomains nor zinc-fingers characteristic of other transcription factors [] Back     alignment and domain information
>KOG3563|consensus Back     alignment and domain information
>COG5025 Transcription factor of the Forkhead/HNF3 family [Transcription] Back     alignment and domain information
>KOG2294|consensus Back     alignment and domain information
>KOG3562|consensus Back     alignment and domain information
>KOG4385|consensus Back     alignment and domain information
>PF00538 Linker_histone: linker histone H1 and H5 family; InterPro: IPR005818 Histone proteins have central roles in both chromatin organisation (as structural units of the nucleosome) and gene regulation (as dynamic components that have a direct impact on DNA transcription and replication) Back     alignment and domain information
>smart00526 H15 Domain in histone families 1 and 5 Back     alignment and domain information
>cd00073 H15 linker histone 1 and histone 5 domains; the basic subunit of chromatin is the nucleosome, consisting of an octamer of core histones, two full turns of DNA, a linker histone (H1 or H5) and a variable length of linker DNA; H1/H5 are chromatin-associated proteins that bind to the exterior of nucleosomes and dramatically stabilize the highly condensed states of chromatin fibers; stabilization of higher order folding occurs through electrostatic neutralization of the linker DNA segments, through a highly positively charged carboxy- terminal domain known as the AKP helix (Ala, Lys, Pro); thought to be involved in specific protein-protein and protein-DNA interactions and play a role in suppressing core histone tail domain acetylation in the chromatin fiber Back     alignment and domain information
>smart00526 H15 Domain in histone families 1 and 5 Back     alignment and domain information
>PF00538 Linker_histone: linker histone H1 and H5 family; InterPro: IPR005818 Histone proteins have central roles in both chromatin organisation (as structural units of the nucleosome) and gene regulation (as dynamic components that have a direct impact on DNA transcription and replication) Back     alignment and domain information
>KOG4012|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
1e17_A150 Solution Structure Of The Dna Binding Domain Of The 3e-24
1e17_A150 Solution Structure Of The Dna Binding Domain Of The 6e-23
3l2c_A110 Crystal Structure Of The Dna Binding Domain Of Foxo 3e-24
3l2c_A110 Crystal Structure Of The Dna Binding Domain Of Foxo 9e-23
3co6_C100 Crystal Structure Of Foxo1 Dbd Bound To Dbe1 Dna Le 3e-24
3co6_C100 Crystal Structure Of Foxo1 Dbd Bound To Dbe1 Dna Le 8e-23
3co7_C117 Crystal Structure Of Foxo1 Dbd Bound To Dbe2 Dna Le 4e-24
3co7_C117 Crystal Structure Of Foxo1 Dbd Bound To Dbe2 Dna Le 8e-23
2k86_A103 Solution Structure Of Foxo3a Forkhead Domain Length 6e-23
2k86_A103 Solution Structure Of Foxo3a Forkhead Domain Length 1e-21
2uzk_A97 Crystal Structure Of The Human Foxo3a-Dbd Bound To 5e-19
2uzk_A97 Crystal Structure Of The Human Foxo3a-Dbd Bound To 9e-18
2kiu_A87 Solution Structure And Backbone Dynamics Of The Dna 1e-06
2kiu_A87 Solution Structure And Backbone Dynamics Of The Dna 1e-05
2c6y_A111 Crystal Structure Of Interleukin Enhancer-Binding F 6e-05
2c6y_A111 Crystal Structure Of Interleukin Enhancer-Binding F 2e-04
1jxs_A98 Solution Structure Of The Dna-Binding Domain Of Int 7e-05
1jxs_A98 Solution Structure Of The Dna-Binding Domain Of Int 2e-04
2a07_F93 Crystal Structure Of Foxp2 Bound Specifically To Dn 8e-05
1d5v_A94 Solution Structure Of The Forkhead Domain Of The Ad 1e-04
3g73_A142 Structure Of The Foxm1 Dna Binding Length = 142 2e-04
2a3s_A101 Solution Structure And Dynamics Of Dna-Binding Doma 2e-04
2a3s_A101 Solution Structure And Dynamics Of Dna-Binding Doma 7e-04
1vtn_C102 Co-Crystal Structure Of The Hnf-3FORK HEAD DNA-Reco 3e-04
1vtn_C102 Co-Crystal Structure Of The Hnf-3FORK HEAD DNA-Reco 3e-04
>pdb|3L2C|A Chain A, Crystal Structure Of The Dna Binding Domain Of Foxo4 Bound To Dna Length = 110 Back     alignment and structure
>pdb|3L2C|A Chain A, Crystal Structure Of The Dna Binding Domain Of Foxo4 Bound To Dna Length = 110 Back     alignment and structure
>pdb|3CO6|C Chain C, Crystal Structure Of Foxo1 Dbd Bound To Dbe1 Dna Length = 100 Back     alignment and structure
>pdb|3CO6|C Chain C, Crystal Structure Of Foxo1 Dbd Bound To Dbe1 Dna Length = 100 Back     alignment and structure
>pdb|3CO7|C Chain C, Crystal Structure Of Foxo1 Dbd Bound To Dbe2 Dna Length = 117 Back     alignment and structure
>pdb|3CO7|C Chain C, Crystal Structure Of Foxo1 Dbd Bound To Dbe2 Dna Length = 117 Back     alignment and structure
>pdb|2K86|A Chain A, Solution Structure Of Foxo3a Forkhead Domain Length = 103 Back     alignment and structure
>pdb|2K86|A Chain A, Solution Structure Of Foxo3a Forkhead Domain Length = 103 Back     alignment and structure
>pdb|2UZK|A Chain A, Crystal Structure Of The Human Foxo3a-Dbd Bound To Dna Length = 97 Back     alignment and structure
>pdb|2UZK|A Chain A, Crystal Structure Of The Human Foxo3a-Dbd Bound To Dna Length = 97 Back     alignment and structure
>pdb|2KIU|A Chain A, Solution Structure And Backbone Dynamics Of The Dna-Binding Domain Of Foxp1: Insight Into Its Domain Swapping Length = 87 Back     alignment and structure
>pdb|2KIU|A Chain A, Solution Structure And Backbone Dynamics Of The Dna-Binding Domain Of Foxp1: Insight Into Its Domain Swapping Length = 87 Back     alignment and structure
>pdb|2C6Y|A Chain A, Crystal Structure Of Interleukin Enhancer-Binding Factor 1 Bound To Dna Length = 111 Back     alignment and structure
>pdb|2C6Y|A Chain A, Crystal Structure Of Interleukin Enhancer-Binding Factor 1 Bound To Dna Length = 111 Back     alignment and structure
>pdb|1JXS|A Chain A, Solution Structure Of The Dna-Binding Domain Of Interleukin Enhancer Binding Factor Length = 98 Back     alignment and structure
>pdb|1JXS|A Chain A, Solution Structure Of The Dna-Binding Domain Of Interleukin Enhancer Binding Factor Length = 98 Back     alignment and structure
>pdb|2A07|F Chain F, Crystal Structure Of Foxp2 Bound Specifically To Dna. Length = 93 Back     alignment and structure
>pdb|1D5V|A Chain A, Solution Structure Of The Forkhead Domain Of The Adipocyte- Transcription Factor Freac-11 (S12) Length = 94 Back     alignment and structure
>pdb|3G73|A Chain A, Structure Of The Foxm1 Dna Binding Length = 142 Back     alignment and structure
>pdb|2A3S|A Chain A, Solution Structure And Dynamics Of Dna-Binding Domain Of Myocyte Nuclear Factor Length = 101 Back     alignment and structure
>pdb|2A3S|A Chain A, Solution Structure And Dynamics Of Dna-Binding Domain Of Myocyte Nuclear Factor Length = 101 Back     alignment and structure
>pdb|1VTN|C Chain C, Co-Crystal Structure Of The Hnf-3FORK HEAD DNA-Recognition Motif Resembles Histone H5 Length = 102 Back     alignment and structure
>pdb|1VTN|C Chain C, Co-Crystal Structure Of The Hnf-3FORK HEAD DNA-Recognition Motif Resembles Histone H5 Length = 102 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
3coa_C117 Forkhead box protein O1; winged helix, forkhead do 1e-29
3coa_C117 Forkhead box protein O1; winged helix, forkhead do 1e-27
1e17_A150 AFX; DNA binding domain, winged helix; NMR {Homo s 5e-28
1e17_A150 AFX; DNA binding domain, winged helix; NMR {Homo s 3e-26
3l2c_A110 Forkhead box protein O4; winged helix, transcripti 1e-27
3l2c_A110 Forkhead box protein O4; winged helix, transcripti 3e-26
3bpy_A85 FORK head domain, forkhead transcription factor FO 5e-27
3bpy_A85 FORK head domain, forkhead transcription factor FO 2e-25
2a07_F93 Forkhead box protein P2; double-helix, swapping, h 2e-15
2a07_F93 Forkhead box protein P2; double-helix, swapping, h 5e-14
2hdc_A97 Protein (transcription factor); structure, dyanami 6e-15
2hdc_A97 Protein (transcription factor); structure, dyanami 2e-13
1vtn_C102 HNF-3/FORK head DNA-recognition motif; protein-DNA 8e-15
1vtn_C102 HNF-3/FORK head DNA-recognition motif; protein-DNA 2e-13
2hfh_A109 Genesis, HFH-2; HNF-3 homologues, winged helix pro 1e-14
2hfh_A109 Genesis, HFH-2; HNF-3 homologues, winged helix pro 4e-13
2c6y_A111 Forkhead box protein K2; transcription regulation, 3e-14
2c6y_A111 Forkhead box protein K2; transcription regulation, 7e-13
1kq8_A100 HFH-1, hepatocyte nuclear factor 3 forkhead homolo 4e-14
1kq8_A100 HFH-1, hepatocyte nuclear factor 3 forkhead homolo 1e-12
3g73_A142 Forkhead box protein M1; DNA-binding domain, forkh 1e-13
3g73_A142 Forkhead box protein M1; DNA-binding domain, forkh 2e-12
>3coa_C Forkhead box protein O1; winged helix, forkhead domain, chromosomal rearrangement; HET: DNA; 2.20A {Homo sapiens} PDB: 3co7_C* 2k86_A 2uzk_A Length = 117 Back     alignment and structure
 Score =  107 bits (269), Expect = 1e-29
 Identities = 49/66 (74%), Positives = 61/66 (92%)

Query: 101 KTATSRRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWK 160
           K+++SRRNAWG+ SYADLI++AI+SS E+RLTLSQIY+WM+++VPYFKDKGDSNSSAGWK
Sbjct: 2   KSSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWK 61

Query: 161 MRIRSN 166
             IR N
Sbjct: 62  NSIRHN 67
>3coa_C Forkhead box protein O1; winged helix, forkhead domain, chromosomal rearrangement; HET: DNA; 2.20A {Homo sapiens} PDB: 3co7_C* 2k86_A 2uzk_A Length = 117 Back     alignment and structure
>3l2c_A Forkhead box protein O4; winged helix, transcription-DNA COMP; 1.87A {Homo sapiens} PDB: 3co6_C* Length = 110 Back     alignment and structure
>3l2c_A Forkhead box protein O4; winged helix, transcription-DNA COMP; 1.87A {Homo sapiens} PDB: 3co6_C* Length = 110 Back     alignment and structure
>3bpy_A FORK head domain, forkhead transcription factor FOXO4, DNA binding domain; forkhead BOX, winged helix; 1.87A {Homo sapiens} SCOP: a.4.5.14 Length = 85 Back     alignment and structure
>3bpy_A FORK head domain, forkhead transcription factor FOXO4, DNA binding domain; forkhead BOX, winged helix; 1.87A {Homo sapiens} SCOP: a.4.5.14 Length = 85 Back     alignment and structure
>2a07_F Forkhead box protein P2; double-helix, swapping, homodimer, monomer, winged-helix, magnesium, transcription/DNA complex; 1.90A {Homo sapiens} SCOP: a.4.5.14 PDB: 2as5_F 2kiu_A 3qrf_F Length = 93 Back     alignment and structure
>2a07_F Forkhead box protein P2; double-helix, swapping, homodimer, monomer, winged-helix, magnesium, transcription/DNA complex; 1.90A {Homo sapiens} SCOP: a.4.5.14 PDB: 2as5_F 2kiu_A 3qrf_F Length = 93 Back     alignment and structure
>2hdc_A Protein (transcription factor); structure, dyanamics, genesis, winged helix protein, protein/DNA complex; HET: DNA; NMR {Rattus norvegicus} SCOP: a.4.5.14 Length = 97 Back     alignment and structure
>2hdc_A Protein (transcription factor); structure, dyanamics, genesis, winged helix protein, protein/DNA complex; HET: DNA; NMR {Rattus norvegicus} SCOP: a.4.5.14 Length = 97 Back     alignment and structure
>1vtn_C HNF-3/FORK head DNA-recognition motif; protein-DNA complex, double helix, transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} PDB: 1d5v_A Length = 102 Back     alignment and structure
>1vtn_C HNF-3/FORK head DNA-recognition motif; protein-DNA complex, double helix, transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} PDB: 1d5v_A Length = 102 Back     alignment and structure
>2hfh_A Genesis, HFH-2; HNF-3 homologues, winged helix protein; NMR {Rattus norvegicus} SCOP: a.4.5.14 Length = 109 Back     alignment and structure
>2hfh_A Genesis, HFH-2; HNF-3 homologues, winged helix protein; NMR {Rattus norvegicus} SCOP: a.4.5.14 Length = 109 Back     alignment and structure
>2c6y_A Forkhead box protein K2; transcription regulation, DNA-binding domain, forkhead transcription factors, interleukin enhancer binding factor; 2.4A {Homo sapiens} SCOP: a.4.5.14 PDB: 1jxs_A 2a3s_A 2d2w_A Length = 111 Back     alignment and structure
>2c6y_A Forkhead box protein K2; transcription regulation, DNA-binding domain, forkhead transcription factors, interleukin enhancer binding factor; 2.4A {Homo sapiens} SCOP: a.4.5.14 PDB: 1jxs_A 2a3s_A 2d2w_A Length = 111 Back     alignment and structure
>1kq8_A HFH-1, hepatocyte nuclear factor 3 forkhead homolog 1, winged; winged helix protein, structure, transcription; NMR {Rattus norvegicus} SCOP: a.4.5.14 Length = 100 Back     alignment and structure
>1kq8_A HFH-1, hepatocyte nuclear factor 3 forkhead homolog 1, winged; winged helix protein, structure, transcription; NMR {Rattus norvegicus} SCOP: a.4.5.14 Length = 100 Back     alignment and structure
>3g73_A Forkhead box protein M1; DNA-binding domain, forkhead transcription factors, FOXM1, W helix; HET: DNA; 2.21A {Homo sapiens} Length = 142 Back     alignment and structure
>3g73_A Forkhead box protein M1; DNA-binding domain, forkhead transcription factors, FOXM1, W helix; HET: DNA; 2.21A {Homo sapiens} Length = 142 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
3bpy_A85 FORK head domain, forkhead transcription factor FO 100.0
3coa_C117 Forkhead box protein O1; winged helix, forkhead do 100.0
3l2c_A110 Forkhead box protein O4; winged helix, transcripti 100.0
1e17_A150 AFX; DNA binding domain, winged helix; NMR {Homo s 100.0
1vtn_C102 HNF-3/FORK head DNA-recognition motif; protein-DNA 100.0
2hdc_A97 Protein (transcription factor); structure, dyanami 100.0
1kq8_A100 HFH-1, hepatocyte nuclear factor 3 forkhead homolo 100.0
2hfh_A109 Genesis, HFH-2; HNF-3 homologues, winged helix pro 100.0
2c6y_A111 Forkhead box protein K2; transcription regulation, 100.0
2a07_F93 Forkhead box protein P2; double-helix, swapping, h 99.97
3g73_A142 Forkhead box protein M1; DNA-binding domain, forkh 99.96
3bpy_A85 FORK head domain, forkhead transcription factor FO 99.89
3l2c_A110 Forkhead box protein O4; winged helix, transcripti 99.88
3coa_C117 Forkhead box protein O1; winged helix, forkhead do 99.87
1e17_A150 AFX; DNA binding domain, winged helix; NMR {Homo s 99.86
1kq8_A100 HFH-1, hepatocyte nuclear factor 3 forkhead homolo 99.83
2hdc_A97 Protein (transcription factor); structure, dyanami 99.83
1vtn_C102 HNF-3/FORK head DNA-recognition motif; protein-DNA 99.83
2hfh_A109 Genesis, HFH-2; HNF-3 homologues, winged helix pro 99.83
2c6y_A111 Forkhead box protein K2; transcription regulation, 99.82
2a07_F93 Forkhead box protein P2; double-helix, swapping, h 99.81
3g73_A142 Forkhead box protein M1; DNA-binding domain, forkh 99.77
1uss_A88 Histone H1; DNA binding protein, linker histone, D 85.28
1uhm_A78 Histone H1, histone HHO1P; winged helix-turn-helix 83.07
1hst_A90 Histone H5; chromosomal protein; 2.60A {Gallus gal 82.55
>3bpy_A FORK head domain, forkhead transcription factor FOXO4, DNA binding domain; forkhead BOX, winged helix; 1.87A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=8.7e-38  Score=244.73  Aligned_cols=85  Identities=56%  Similarity=0.968  Sum_probs=81.6

Q ss_pred             CCCCCCCCcHHHHHHHHHhcCCCCCcCHHHHHHHHHhcCCccccCCCCCCCCCcccccccccCCCCCCCCCCCCCCCCCC
Q psy16819        106 RRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKMRIRSNTWPLPRPDNYVDEPSPPTS  185 (289)
Q Consensus       106 ~~~~kP~~SYa~LI~~AI~ssp~~~LTL~eIY~wi~~~~pyf~~~~ds~s~~gWknSIRHNL~~~s~~~~F~k~~~~~~~  185 (289)
                      +||+||+|||++||++||+++|+++|||+|||+||+++||||+.++|+++..||||||||||   |+|+||+|+++.  .
T Consensus         1 ~rn~kp~~SY~~LI~~Ai~~sp~~~ltL~eIY~~i~~~fpyy~~~~~~~s~~gWqNSIRHNL---Sln~~F~Kv~r~--~   75 (85)
T 3bpy_A            1 RRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNL---SLHSKFIKVHNE--A   75 (85)
T ss_dssp             CCBTTBSCCHHHHHHHHHHHSTTSCBCHHHHHHHHHHHCGGGTTCTTCCTTSHHHHHHHHHH---HHCTTEEEECCC--S
T ss_pred             CCCCcCCCCHHHHHHHHHHhCCcCCccHHHHHHHHHHhCcchhcCccCccCCCcchhhhhhc---cHhhhheeCCCC--C
Confidence            58999999999999999999999999999999999999999999999888999999999999   999999999984  6


Q ss_pred             CCCccccccc
Q psy16819        186 AKLEDFETLG  195 (289)
Q Consensus       186 ~g~g~~w~v~  195 (289)
                      +|+|+||+|+
T Consensus        76 ~GKg~~W~ld   85 (85)
T 3bpy_A           76 TGKSSWWMLN   85 (85)
T ss_dssp             TTCCCEEEEC
T ss_pred             CCCCCceecC
Confidence            8999999986
>3coa_C Forkhead box protein O1; winged helix, forkhead domain, chromosomal rearrangement; HET: DNA; 2.20A {Homo sapiens} PDB: 3co7_C* 2k86_A 2uzk_A Back     alignment and structure
>3l2c_A Forkhead box protein O4; winged helix, transcription-DNA COMP; 1.87A {Homo sapiens} SCOP: a.4.5.14 PDB: 3co6_C* Back     alignment and structure
>1vtn_C HNF-3/FORK head DNA-recognition motif; protein-DNA complex, double helix, transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} PDB: 1d5v_A Back     alignment and structure
>2hdc_A Protein (transcription factor); structure, dyanamics, genesis, winged helix protein, protein/DNA complex; HET: DNA; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>1kq8_A HFH-1, hepatocyte nuclear factor 3 forkhead homolog 1, winged; winged helix protein, structure, transcription; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>2hfh_A Genesis, HFH-2; HNF-3 homologues, winged helix protein; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>2c6y_A Forkhead box protein K2; transcription regulation, DNA-binding domain, forkhead transcription factors, interleukin enhancer binding factor; 2.4A {Homo sapiens} SCOP: a.4.5.14 PDB: 1jxs_A 2a3s_A 2d2w_A Back     alignment and structure
>2a07_F Forkhead box protein P2; double-helix, swapping, homodimer, monomer, winged-helix, magnesium, transcription/DNA complex; 1.90A {Homo sapiens} SCOP: a.4.5.14 PDB: 2as5_F 2kiu_A 3qrf_F Back     alignment and structure
>3g73_A Forkhead box protein M1; DNA-binding domain, forkhead transcription factors, FOXM1, W helix; HET: DNA; 2.21A {Homo sapiens} Back     alignment and structure
>3bpy_A FORK head domain, forkhead transcription factor FOXO4, DNA binding domain; forkhead BOX, winged helix; 1.87A {Homo sapiens} Back     alignment and structure
>3l2c_A Forkhead box protein O4; winged helix, transcription-DNA COMP; 1.87A {Homo sapiens} SCOP: a.4.5.14 PDB: 3co6_C* Back     alignment and structure
>3coa_C Forkhead box protein O1; winged helix, forkhead domain, chromosomal rearrangement; HET: DNA; 2.20A {Homo sapiens} PDB: 3co7_C* 2k86_A 2uzk_A Back     alignment and structure
>1kq8_A HFH-1, hepatocyte nuclear factor 3 forkhead homolog 1, winged; winged helix protein, structure, transcription; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>2hdc_A Protein (transcription factor); structure, dyanamics, genesis, winged helix protein, protein/DNA complex; HET: DNA; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>1vtn_C HNF-3/FORK head DNA-recognition motif; protein-DNA complex, double helix, transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} PDB: 1d5v_A Back     alignment and structure
>2hfh_A Genesis, HFH-2; HNF-3 homologues, winged helix protein; NMR {Rattus norvegicus} SCOP: a.4.5.14 Back     alignment and structure
>2c6y_A Forkhead box protein K2; transcription regulation, DNA-binding domain, forkhead transcription factors, interleukin enhancer binding factor; 2.4A {Homo sapiens} SCOP: a.4.5.14 PDB: 1jxs_A 2a3s_A 2d2w_A Back     alignment and structure
>2a07_F Forkhead box protein P2; double-helix, swapping, homodimer, monomer, winged-helix, magnesium, transcription/DNA complex; 1.90A {Homo sapiens} SCOP: a.4.5.14 PDB: 2as5_F 2kiu_A 3qrf_F Back     alignment and structure
>3g73_A Forkhead box protein M1; DNA-binding domain, forkhead transcription factors, FOXM1, W helix; HET: DNA; 2.21A {Homo sapiens} Back     alignment and structure
>1uss_A Histone H1; DNA binding protein, linker histone, DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: a.4.5.13 PDB: 1yqa_A Back     alignment and structure
>1uhm_A Histone H1, histone HHO1P; winged helix-turn-helix, linker histone, riken structural genomics/proteomics initiative, RSGI; NMR {Saccharomyces cerevisiae} SCOP: a.4.5.13 Back     alignment and structure
>1hst_A Histone H5; chromosomal protein; 2.60A {Gallus gallus} SCOP: a.4.5.13 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 289
d3bpya185 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapie 2e-24
d3bpya185 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapie 2e-23
d1kq8a_75 a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Ra 2e-14
d1kq8a_75 a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Ra 1e-13
d1d5va_94 a.4.5.14 (A:) Adipocyte-transcription factor FREAC 1e-13
d1d5va_94 a.4.5.14 (A:) Adipocyte-transcription factor FREAC 4e-13
d2hdca_97 a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [Ta 1e-13
d2hdca_97 a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [Ta 1e-13
d2a07f182 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP 2e-13
d2a07f182 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP 3e-13
d2c6ya198 a.4.5.14 (A:1-98) Interleukin enhancer binding fac 4e-13
d2c6ya198 a.4.5.14 (A:1-98) Interleukin enhancer binding fac 1e-12
>d3bpya1 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Forkhead DNA-binding domain
domain: Afx (Foxo4)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 92.3 bits (229), Expect = 2e-24
 Identities = 47/61 (77%), Positives = 56/61 (91%)

Query: 106 RRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKMRIRS 165
           RRNAWG+ SYA+LISQAI+S+PE+RLTL+QIY+WM++ VPYFKDKGDSNSSAGWK  IR 
Sbjct: 1   RRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRH 60

Query: 166 N 166
           N
Sbjct: 61  N 61
>d3bpya1 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1kq8a_ a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 75 Back     information, alignment and structure
>d1kq8a_ a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 75 Back     information, alignment and structure
>d1d5va_ a.4.5.14 (A:) Adipocyte-transcription factor FREAC-11 (s12, fkh-14) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1d5va_ a.4.5.14 (A:) Adipocyte-transcription factor FREAC-11 (s12, fkh-14) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2hdca_ a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 97 Back     information, alignment and structure
>d2hdca_ a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 97 Back     information, alignment and structure
>d2a07f1 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2a07f1 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2c6ya1 a.4.5.14 (A:1-98) Interleukin enhancer binding factor {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2c6ya1 a.4.5.14 (A:1-98) Interleukin enhancer binding factor {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
d3bpya185 Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2c6ya198 Interleukin enhancer binding factor {Human (Homo s 100.0
d1d5va_94 Adipocyte-transcription factor FREAC-11 (s12, fkh- 100.0
d2hdca_97 Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} 100.0
d1kq8a_75 HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norv 99.97
d2a07f182 Forkhead box protein P2, FOXP2 {Human (Homo sapien 99.97
d3bpya185 Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2c6ya198 Interleukin enhancer binding factor {Human (Homo s 99.81
d1d5va_94 Adipocyte-transcription factor FREAC-11 (s12, fkh- 99.81
d2hdca_97 Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} 99.8
d2a07f182 Forkhead box protein P2, FOXP2 {Human (Homo sapien 99.79
d1kq8a_75 HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norv 99.73
d1hsta_74 Histone H5, globular domain {Chicken (Gallus gallu 91.99
d1ussa_88 Histone H1 homologue Hho1p {Baker's yeast (Sacchar 91.57
d1usta_92 Histone H1 homologue Hho1p {Baker's yeast (Sacchar 91.16
d1ussa_88 Histone H1 homologue Hho1p {Baker's yeast (Sacchar 84.31
d1hsta_74 Histone H5, globular domain {Chicken (Gallus gallu 80.57
>d3bpya1 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Forkhead DNA-binding domain
domain: Afx (Foxo4)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.6e-35  Score=230.11  Aligned_cols=85  Identities=56%  Similarity=0.968  Sum_probs=80.5

Q ss_pred             CCCCCCCCcHHHHHHHHHhcCCCCCcCHHHHHHHHHhcCCccccCCCCCCCCCcccccccccCCCCCCCCCCCCCCCCCC
Q psy16819        106 RRNAWGSSSYADLISQAIQSSPEQRLTLSQIYDWMIQNVPYFKDKGDSNSSAGWKMRIRSNTWPLPRPDNYVDEPSPPTS  185 (289)
Q Consensus       106 ~~~~kP~~SYa~LI~~AI~ssp~~~LTL~eIY~wi~~~~pyf~~~~ds~s~~gWknSIRHNL~~~s~~~~F~k~~~~~~~  185 (289)
                      |+|+||++||++||++||+++|+++|||+|||+||+++|||||..+|.....||||||||||   |+|+||+|++++  .
T Consensus         1 ~~n~~~~~SY~~LI~~Ai~~sp~~~ltL~eIY~~i~~~fPyyr~~~~~~~~~gWkNSIRHnL---Sl~~~F~kv~r~--~   75 (85)
T d3bpya1           1 RRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNL---SLHSKFIKVHNE--A   75 (85)
T ss_dssp             CCBTTBSCCHHHHHHHHHHHSTTSCBCHHHHHHHHHHHCGGGTTCTTCCTTSHHHHHHHHHH---HHCTTEEEECCC--S
T ss_pred             CCCCCCCcCHHHHHHHHHHhCCCCCccHHHHHHHHHHhChhhhccCcccccccchhhHHHHh---hHhhheeeCCCC--C
Confidence            58999999999999999999999999999999999999999999988778899999999999   999999999886  4


Q ss_pred             CCCccccccc
Q psy16819        186 AKLEDFETLG  195 (289)
Q Consensus       186 ~g~g~~w~v~  195 (289)
                      .|+|+||+|+
T Consensus        76 ~gKg~~W~i~   85 (85)
T d3bpya1          76 TGKSSWWMLN   85 (85)
T ss_dssp             TTCCCEEEEC
T ss_pred             CCCCceeecC
Confidence            6899999986
>d2c6ya1 a.4.5.14 (A:1-98) Interleukin enhancer binding factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5va_ a.4.5.14 (A:) Adipocyte-transcription factor FREAC-11 (s12, fkh-14) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hdca_ a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kq8a_ a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a07f1 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpya1 a.4.5.14 (A:93-177) Afx (Foxo4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c6ya1 a.4.5.14 (A:1-98) Interleukin enhancer binding factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5va_ a.4.5.14 (A:) Adipocyte-transcription factor FREAC-11 (s12, fkh-14) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hdca_ a.4.5.14 (A:) Genesis {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a07f1 a.4.5.14 (F:503-584) Forkhead box protein P2, FOXP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kq8a_ a.4.5.14 (A:) HFH-1 (HNF-3 forkhead homolog-1) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hsta_ a.4.5.13 (A:) Histone H5, globular domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ussa_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1usta_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ussa_ a.4.5.13 (A:) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hsta_ a.4.5.13 (A:) Histone H5, globular domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure