Psyllid ID: psy16822


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MSVSQPLAHGLDLIKVVSSPPGLSALKTPQCSSEVMETRNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEYNQPMVLPNGYVYGEQEGK
cccccccccccccccEEEEccccccccccccccccccccccccccccHHHHHHHHHcccccccccEEEEcccccccccccccEEcccccEEEEcccc
ccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHccccccccccEEEEEEEccccccccccccEccccEEEcccccc
msvsqplahgldlikvvssppglsalktpqcssevmetrnkscpvcmepfntlakslpyarcnqsrLVCSisglqfneynqpmvlpngyvygeqegk
msvsqplahGLDLikvvssppglsalktpqcsseVMETRNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQfneynqpmvlpNGYVYGEQEGK
MSVSQPLAHGLDLIKVVSSPPGLSALKTPQCSSEVMETRNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEYNQPMVLPNGYVYGEQEGK
************LI****************************CPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEYNQPMVLPNGYVY******
***SQPLAHGLDLIKVVSSPPGLSALKTPQCS**********CPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEYNQPMVLPNGYVYGEQ*G*
********HGLDLIKVVSSPPGLSAL**************KSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEYNQPMVLPNGYVYGEQEGK
*SVSQPLAHGLDLIKVVSSPPGLSALKTPQCSSEVMETRNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEYNQPMVLPNGYVYGE****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVSQPLAHGLDLIKVVSSPPGLSALKTPQCSSEVMETRNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEYNQPMVLPNGYVYGEQEGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query97 2.2.26 [Sep-21-2011]
Q5F398396 Macrophage erythroblast a yes N/A 0.855 0.209 0.530 5e-18
Q7SXR3396 Macrophage erythroblast a yes N/A 0.855 0.209 0.530 5e-18
Q6GR10396 Macrophage erythroblast a N/A N/A 0.855 0.209 0.530 5e-18
Q3MHJ2434 Macrophage erythroblast a yes N/A 0.731 0.163 0.605 9e-18
Q5RKJ1396 Macrophage erythroblast a yes N/A 0.731 0.179 0.591 3e-17
Q4VC33396 Macrophage erythroblast a yes N/A 0.731 0.179 0.591 3e-17
Q5R532396 Macrophage erythroblast a yes N/A 0.731 0.179 0.591 3e-17
Q7L5Y9396 Macrophage erythroblast a no N/A 0.731 0.179 0.591 3e-17
Q4R9A8396 Macrophage erythroblast a N/A N/A 0.731 0.179 0.591 3e-17
Q9URU9404 Protein fyv10 OS=Schizosa yes N/A 0.731 0.175 0.405 1e-08
>sp|Q5F398|MAEA_CHICK Macrophage erythroblast attacher OS=Gallus gallus GN=MAEA PE=2 SV=1 Back     alignment and function desciption
 Score = 89.7 bits (221), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 54/83 (65%)

Query: 10  GLDLIKVVSSPPGLSALKTPQCSSEVMETRNKSCPVCMEPFNTLAKSLPYARCNQSRLVC 69
           G + +  ++   GLSA+KTPQC  E   ++N  CPVC +  N LA+ LP A C  SRLVC
Sbjct: 281 GNNSVFTITLQAGLSAIKTPQCYKEDGSSKNPDCPVCSKSLNKLAQPLPMAHCANSRLVC 340

Query: 70  SISGLQFNEYNQPMVLPNGYVYG 92
            ISG   NE N PM+LPNGYVYG
Sbjct: 341 KISGDVMNENNPPMMLPNGYVYG 363




May play a possible role in erythroblast and macrophages maturation. May associate with F-actin to regulate actin distribution in erythroblasts and macrophages. May contribute to nuclear architecture and cells division events.
Gallus gallus (taxid: 9031)
>sp|Q7SXR3|MAEA_DANRE Macrophage erythroblast attacher OS=Danio rerio GN=maea PE=2 SV=2 Back     alignment and function description
>sp|Q6GR10|MAEA_XENLA Macrophage erythroblast attacher OS=Xenopus laevis GN=maea PE=2 SV=2 Back     alignment and function description
>sp|Q3MHJ2|MAEA_BOVIN Macrophage erythroblast attacher OS=Bos taurus GN=MAEA PE=2 SV=1 Back     alignment and function description
>sp|Q5RKJ1|MAEA_RAT Macrophage erythroblast attacher OS=Rattus norvegicus GN=Maea PE=2 SV=2 Back     alignment and function description
>sp|Q4VC33|MAEA_MOUSE Macrophage erythroblast attacher OS=Mus musculus GN=Maea PE=1 SV=1 Back     alignment and function description
>sp|Q5R532|MAEA_PONAB Macrophage erythroblast attacher OS=Pongo abelii GN=MAEA PE=2 SV=1 Back     alignment and function description
>sp|Q7L5Y9|MAEA_HUMAN Macrophage erythroblast attacher OS=Homo sapiens GN=MAEA PE=1 SV=1 Back     alignment and function description
>sp|Q4R9A8|MAEA_MACFA Macrophage erythroblast attacher OS=Macaca fascicularis GN=MAEA PE=2 SV=1 Back     alignment and function description
>sp|Q9URU9|FYV10_SCHPO Protein fyv10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fyv10 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query97
193702333 391 PREDICTED: macrophage erythroblast attac 0.752 0.186 0.780 4e-26
328716958 350 PREDICTED: macrophage erythroblast attac 0.752 0.208 0.780 4e-26
332025960 391 Macrophage erythroblast attacher [Acromy 0.814 0.202 0.683 5e-23
322785354 391 hypothetical protein SINV_11420 [Solenop 0.814 0.202 0.683 5e-23
307200107 393 Macrophage erythroblast attacher [Harpeg 0.814 0.201 0.683 7e-23
156538040 359 PREDICTED: macrophage erythroblast attac 0.814 0.220 0.670 2e-22
156538038 392 PREDICTED: macrophage erythroblast attac 0.814 0.201 0.670 2e-22
307171438 391 Macrophage erythroblast attacher [Campon 0.814 0.202 0.658 3e-22
380012212 388 PREDICTED: LOW QUALITY PROTEIN: macropha 0.814 0.203 0.670 3e-22
328776327 388 PREDICTED: macrophage erythroblast attac 0.814 0.203 0.670 3e-22
>gi|193702333|ref|XP_001948876.1| PREDICTED: macrophage erythroblast attacher-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 61/73 (83%)

Query: 22  GLSALKTPQCSSEVMETRNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEYNQ 81
           GLSALKTPQC SE+ E RN SCPVC E FNTLAK LP+A C+QSRL CSISGL  NE+N 
Sbjct: 286 GLSALKTPQCYSEIKEARNISCPVCQEWFNTLAKPLPFAHCSQSRLFCSISGLPLNEHNI 345

Query: 82  PMVLPNGYVYGEQ 94
           PMVLPNGYVYGEQ
Sbjct: 346 PMVLPNGYVYGEQ 358




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328716958|ref|XP_003246085.1| PREDICTED: macrophage erythroblast attacher-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332025960|gb|EGI66116.1| Macrophage erythroblast attacher [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322785354|gb|EFZ12028.1| hypothetical protein SINV_11420 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307200107|gb|EFN80439.1| Macrophage erythroblast attacher [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|156538040|ref|XP_001604096.1| PREDICTED: macrophage erythroblast attacher-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|156538038|ref|XP_001604075.1| PREDICTED: macrophage erythroblast attacher-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307171438|gb|EFN63282.1| Macrophage erythroblast attacher [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380012212|ref|XP_003690180.1| PREDICTED: LOW QUALITY PROTEIN: macrophage erythroblast attacher-like [Apis florea] Back     alignment and taxonomy information
>gi|328776327|ref|XP_395151.3| PREDICTED: macrophage erythroblast attacher-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query97
FB|FBgn0051357394 CG31357 [Drosophila melanogast 0.721 0.177 0.555 9.9e-19
UNIPROTKB|Q5F398396 MAEA "Macrophage erythroblast 0.855 0.209 0.530 1.3e-18
ZFIN|ZDB-GENE-030131-294396 maea "macrophage erythroblast 0.855 0.209 0.530 1.3e-18
UNIPROTKB|E7ENL1317 MAEA "Macrophage erythroblast 0.731 0.223 0.591 3.6e-18
UNIPROTKB|B4DQT1348 MAEA "Macrophage erythroblast 0.731 0.204 0.591 5.3e-18
UNIPROTKB|F1MXB7412 MAEA "Macrophage erythroblast 0.731 0.172 0.605 5.6e-18
UNIPROTKB|Q3MHJ2434 MAEA "Macrophage erythroblast 0.731 0.163 0.605 6.8e-18
UNIPROTKB|B4DVN3395 MAEA "cDNA FLJ54556, highly si 0.731 0.179 0.591 1e-17
UNIPROTKB|Q7L5Y9396 MAEA "Macrophage erythroblast 0.731 0.179 0.591 1e-17
MGI|MGI:1891748396 Maea "macrophage erythroblast 0.731 0.179 0.591 1e-17
FB|FBgn0051357 CG31357 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 229 (85.7 bits), Expect = 9.9e-19, P = 9.9e-19
 Identities = 40/72 (55%), Positives = 53/72 (73%)

Query:    22 GLSALKTPQCSSEVMETRNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEYNQ 81
             GLSALKTP C ++    RN +CPVC E  N +A  LPY+ C QSRL+C ++GL  NE+NQ
Sbjct:   292 GLSALKTPHCYAQTC--RNLNCPVCQEDLNRIALKLPYSHCVQSRLICRVTGLPLNEHNQ 349

Query:    82 PMVLPNGYVYGE 93
             PM+LPNG ++G+
Sbjct:   350 PMMLPNGQIFGQ 361




GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0003674 "molecular_function" evidence=ND
UNIPROTKB|Q5F398 MAEA "Macrophage erythroblast attacher" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-294 maea "macrophage erythroblast attacher" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E7ENL1 MAEA "Macrophage erythroblast attacher" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DQT1 MAEA "Macrophage erythroblast attacher" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MXB7 MAEA "Macrophage erythroblast attacher" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MHJ2 MAEA "Macrophage erythroblast attacher" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B4DVN3 MAEA "cDNA FLJ54556, highly similar to Homo sapiens macrophage erythroblast attacher (MAEA), transcript variant 1, mRNA" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q7L5Y9 MAEA "Macrophage erythroblast attacher" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1891748 Maea "macrophage erythroblast attacher" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5F398MAEA_CHICKNo assigned EC number0.53010.85560.2095yesN/A
Q3MHJ2MAEA_BOVINNo assigned EC number0.60560.73190.1635yesN/A
Q7SXR3MAEA_DANRENo assigned EC number0.53010.85560.2095yesN/A
Q5R532MAEA_PONABNo assigned EC number0.59150.73190.1792yesN/A
Q4VC33MAEA_MOUSENo assigned EC number0.59150.73190.1792yesN/A
Q5RKJ1MAEA_RATNo assigned EC number0.59150.73190.1792yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query97
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 3e-09
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information
 Score = 48.5 bits (116), Expect = 3e-09
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 57 LPYARCNQSRLVCSISG-LQFNEYNQPMVLPNGYVYGEQ 94
          LPYA    S  VC IS  +  +E N P++LP G+VY  +
Sbjct: 1  LPYAHHFHSIFVCPISKEVMTDEENPPVMLPCGHVYSRK 39


This zinc-finger is the dimerisation motif for LisH proteins, and is also a typical RING-type of plant ubiquitin ligases. Length = 55

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 97
KOG0396|consensus389 99.97
KOG2817|consensus394 98.61
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.39
COG5109396 Uncharacterized conserved protein, contains RING Z 98.23
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.01
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.49
PF04641 260 Rtf2: Rtf2 RING-finger 96.81
KOG3113|consensus 293 95.96
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 91.28
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 85.55
>KOG0396|consensus Back     alignment and domain information
Probab=99.97  E-value=1e-32  Score=223.16  Aligned_cols=86  Identities=45%  Similarity=0.860  Sum_probs=79.5

Q ss_pred             ccccCcccceeeEEecCccccccCccccccccccCCCCCCCCChhHHHhhhhCCCceecccEEEeccccccccCCCCcee
Q psy16822          5 QPLAHGLDLIKVVSSPPGLSALKTPQCSSEVMETRNKSCPVCMEPFNTLAKSLPYARCNQSRLVCSISGLQFNEYNQPMV   84 (97)
Q Consensus         5 ~pll~~~~~~~~~~l~aGlsaLKTp~C~~~~~~~~~~~CPvC~~~~~~La~~LP~ah~~~S~LvC~iSg~vmde~N~P~~   84 (97)
                      .|+|+       ++++||||++|||.|+.+.+.....+||+|++.|+++|++||||||.||+|||+||||.||++|+|++
T Consensus       276 ~~~L~-------~~l~~GLsalKTp~c~~~~~~~~~~~CpvC~~~f~~ia~~LPfah~~~S~Lvc~isge~md~~N~P~l  348 (389)
T KOG0396|consen  276 NPALT-------IYLQAGLSALKTPRCLNDESDNNPNNCPVCCEAFKPIAQALPFAHHAQSRLVCSISGELMDDDNPPHL  348 (389)
T ss_pred             CcHHH-------HHHHhhhhhcccccccccccCCCCCCCCCcccccchhhhcCCchhhhhhHHHhhccccccCCCCCccc
Confidence            56677       99999999999999998865545568999999999999999999999999999999999999999999


Q ss_pred             cCCCceecccCCC
Q psy16822         85 LPNGYVYGEQEGK   97 (97)
Q Consensus        85 lPNG~VYs~~aL~   97 (97)
                      ||||+|||.++|+
T Consensus       349 fpnG~Vyg~~~L~  361 (389)
T KOG0396|consen  349 FPNGYVYGTKALE  361 (389)
T ss_pred             ccCceeehhHHHH
Confidence            9999999999874



>KOG2817|consensus Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG3113|consensus Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query97
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.68
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 96.77
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 96.77
2f42_A179 STIP1 homology and U-box containing protein 1; cha 96.75
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 96.03
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 95.91
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 93.56
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 93.44
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 88.83
2ysj_A63 Tripartite motif-containing protein 31; ring-type 87.6
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 86.67
2ysl_A73 Tripartite motif-containing protein 31; ring-type 86.37
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 85.07
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 83.29
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 82.98
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 82.57
2ecw_A85 Tripartite motif-containing protein 30; metal bind 82.44
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 81.62
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, struct 81.44
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 81.33
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 81.07
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
Probab=97.68  E-value=4.5e-06  Score=50.82  Aligned_cols=28  Identities=18%  Similarity=0.393  Sum_probs=24.6

Q ss_pred             EEEeccccccccCCCCceec-CCCceecccCC
Q psy16822         66 RLVCSISGLQFNEYNQPMVL-PNGYVYGEQEG   96 (97)
Q Consensus        66 ~LvC~iSg~vmde~N~P~~l-PNG~VYs~~aL   96 (97)
                      .++|+||+++|.   +|+++ ++|+||.+++|
T Consensus         3 ~~~CpIs~~~m~---dPV~~~~sG~~yer~~I   31 (61)
T 2bay_A            3 HMLCAISGKVPR---RPVLSPKSRTIFEKSLL   31 (61)
T ss_dssp             -CCCTTTCSCCS---SEEEETTTTEEEEHHHH
T ss_pred             eEEecCCCCCCC---CCEEeCCCCcEEcHHHH
Confidence            578999999998   58999 99999998876



>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query97
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 96.68
d2c2la280 STIP1 homology and U box-containing protein 1, STU 96.45
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 96.02
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 95.73
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 88.44
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 85.86
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 84.48
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 81.64
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 81.17
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: Pre-mRNA splicing factor Prp19
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=96.68  E-value=0.00014  Score=41.77  Aligned_cols=27  Identities=22%  Similarity=0.501  Sum_probs=22.9

Q ss_pred             EEeccccccccCCCCceecC-CCceecccCC
Q psy16822         67 LVCSISGLQFNEYNQPMVLP-NGYVYGEQEG   96 (97)
Q Consensus        67 LvC~iSg~vmde~N~P~~lP-NG~VYs~~aL   96 (97)
                      |+|+|++++|.   .|+++| .||+|.++.|
T Consensus         1 l~C~Ic~~~~~---~Pv~~~~cGh~fc~~cI   28 (56)
T d2baya1           1 MLCAISGKVPR---RPVLSPKSRTIFEKSLL   28 (56)
T ss_dssp             CCCTTTCSCCS---SEEEETTTTEEEEHHHH
T ss_pred             CCCccCCchHH---hcCccCCCCCcccHHHH
Confidence            58999999995   589887 7999988764



>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure