Psyllid ID: psy16828


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370--
MVVISLSDTEAIEPKPSKYIKVECPVCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAPVECSYCGKVLSRKDKLTRHIAAVHSGKEYPCEQCDRKFTNGYKLKQHMLTHMQKDTSISIDVISEIKKFKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQILTHGAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKVHMRKHQ
ccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccHHHHHcccccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHHcccccccccccccccccccccccccHHHHHccc
ccccccccHHHHHcccccccccccccccccEccccHHHHHHHHHccccccccccccccccccccccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccccccccccccccEccccHHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHEEEEEEcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHccccccccccccccEccccHHHHHHHHcc
mvvislsdteaiepkpskyikvecpvcgkvlSRKSKLVSHMRSfhtsvtpeaggdnndtsghMSQIQTMLMldhkkpksrapvecsycgkvlsrkdkLTRHIAAvhsgkeypceqcdrkftngyklKQHMLTHMQKDTSISIDVISEIkkfkcdqcdyatkdkynlgthikrrhtkeYSVLctqcgfgcytnreleehqilthgaepyhckycdktftkrmnvkthermkhenhkpyecyiCNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHMAlhsdakpfvcnicgkdfklkyYVNLHMrthtrirptfecdvchqifptdfrtkhmlvhdvekshlcfvcgagfvndaglkvhMRKHQ
mvvislsdteaiepkpskyikvecpvCGKVLSRKSKLVSHMRSfhtsvtpeaggdnndTSGHMSQIQTMLMLDHKKPksrapvecsycgkvlsrkdkLTRHIAAvhsgkeypceqcdRKFTNGYKLKQHMLTHMQKDTSISIDVISEIKkfkcdqcdyatkdkynlgthikrrhtkeysVLCTQCGFGCYTNRELEEHQILTHGAEPYHCKYCDKTFTKRMNVKThermkhenhkpyeCYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKVHMRKHQ
MVVISLSDTEAIEPKPSKYIKVECPVCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAPVECSYCGKVLSRKDKLTRHIAAVHSGKEYPCEQCDRKFTNGYKLKQHMLTHMQKDTSISIDVISEIKKFKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQILTHGAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKVHMRKHQ
*****************KYIKVECPVCGKVLSR*************************************************VECSYCGKVLSRKDKLTRHIAAVHSGKEYPCEQCDRKFTNGYKLKQHMLTHMQKDTSISIDVISEIKKFKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQILTHGAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKV******
*VVISLSDTEAIEPKPSKYIKVECPVCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAPVECSYCGKVLSRKDKLTRHIAAVHSGKEYPCEQCDRKFTNGYKLKQHMLTHMQKDTSISIDVISEIKKFKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQILTHGAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKVHMRK**
MVVISLSDTEAIEPKPSKYIKVECPVCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLD***********CSYCGKVLSRKDKLTRHIAAVHSGKEYPCEQCDRKFTNGYKLKQHMLTHMQKDTSISIDVISEIKKFKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQILTHGAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKVHMRKHQ
*****LSDTEAIEPKPSKYIKVECPVCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAPVECSYCGKVLSRKDKLTRHIAAVHSGKEYPCEQCDRKFTNGYKLKQHMLTHMQKDTSISIDVISEIKKFKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQILTHGAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKVH*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVISLSDTEAIEPKPSKYIKVECPVCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAPVECSYCGKVLSRKDKLTRHIAAVHSGKEYPCEQCDRKFTNGYKLKQHMLTHMQKDTSISIDVISEIKKFKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQILTHGAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTDFRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKVHMRKHQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query372 2.2.26 [Sep-21-2011]
P10076 861 Zinc finger protein 26 OS no N/A 0.881 0.380 0.327 8e-41
Q80W31679 Zinc finger protein 569 O no N/A 0.881 0.483 0.323 1e-39
Q5MCW4686 Zinc finger protein 569 O yes N/A 0.881 0.478 0.320 5e-39
A2VDQ7 687 Zinc finger protein 420 O no N/A 0.879 0.475 0.323 6e-39
Q8TAQ5 688 Zinc finger protein 420 O no N/A 0.879 0.475 0.321 2e-38
P51523738 Zinc finger protein 84 OS no N/A 0.884 0.445 0.305 4e-38
Q02386682 Zinc finger protein 45 OS no N/A 0.903 0.492 0.300 2e-37
Q3ZCX4644 Zinc finger protein 568 O no N/A 0.922 0.532 0.293 2e-37
Q9HCG1 818 Zinc finger protein 160 O no N/A 0.879 0.399 0.301 4e-37
Q9UJW8692 Zinc finger protein 180 O no N/A 0.806 0.433 0.319 5e-37
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function desciption
 Score =  167 bits (424), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 115/351 (32%), Positives = 159/351 (45%), Gaps = 23/351 (6%)

Query: 23  ECPVCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAP 82
           EC  CGK   + S+L  HMRS HT   P       D  G+     + L    +      P
Sbjct: 303 ECKECGKTFIQPSRLTEHMRS-HTGEKPY----QCDQCGNAFASSSYLTTHLRTHTGEKP 357

Query: 83  VECSYCGKVLSRKDKLTRHIAAVHSGKEYPCEQCDRKFTNGYKLKQHMLTHMQKDTSISI 142
            EC+ CGK  +R   L  HI      K Y C+ C + F+    L  H+  H  +      
Sbjct: 358 FECNICGKAFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTGE------ 411

Query: 143 DVISEIKKFKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQILT 202
                 + + C +C+ A      L  HIK  HT E    C  C      +  L+ H  + 
Sbjct: 412 ------RPYPCTECEKAFTSFAQLTEHIKT-HTGEKPFRCKVCARTFRNSSCLKTHFRIH 464

Query: 203 HGAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLA 262
            G +PY C YC K FT R  +  H  + H   KPYEC  C K   +   L EH+ ++H  
Sbjct: 465 TGIKPYKCNYCGKAFTARSGLTKH-VLIHNGEKPYECKECGKAFSTSSGLVEHI-RIHTG 522

Query: 263 QR-FECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPT 321
           ++ FEC  C K +    +   H+  H+  KPF CN C K F    Y+ +HMRTHT  +P 
Sbjct: 523 EKPFECYQCGKALAHSSSLVGHLRTHTGEKPFECNQCDKTFTRSSYLRIHMRTHTGEKP- 581

Query: 322 FECDVCHQIFPT-DFRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKVHMRKH 371
           +EC  C + FP     TKH+  H  E+ + C  CG GF++ A L VH++ H
Sbjct: 582 YECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTH 632




May be involved in transcriptional regulation.
Mus musculus (taxid: 10090)
>sp|Q80W31|ZN569_MOUSE Zinc finger protein 569 OS=Mus musculus GN=Znf569 PE=2 SV=2 Back     alignment and function description
>sp|Q5MCW4|ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens GN=ZNF569 PE=2 SV=1 Back     alignment and function description
>sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 Back     alignment and function description
>sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=2 SV=1 Back     alignment and function description
>sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 Back     alignment and function description
>sp|Q02386|ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens GN=ZNF45 PE=2 SV=2 Back     alignment and function description
>sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 Back     alignment and function description
>sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 Back     alignment and function description
>sp|Q9UJW8|ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens GN=ZNF180 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query372
334327315 1486 PREDICTED: hypothetical protein LOC10061 0.881 0.220 0.327 7e-42
334327291 1137 PREDICTED: zinc finger protein 184-like 0.876 0.286 0.318 1e-41
334349670 1109 PREDICTED: zinc finger protein 850-like 0.879 0.294 0.335 4e-41
395540052 718 PREDICTED: zinc finger protein 850-like 0.911 0.472 0.326 4e-40
334327353 1783 PREDICTED: hypothetical protein LOC10001 0.879 0.183 0.303 4e-40
334325100 752 PREDICTED: zinc finger protein 160-like 0.911 0.450 0.315 7e-40
334327357 764 PREDICTED: zinc finger protein 420-like 0.879 0.428 0.328 9e-40
326678763452 PREDICTED: zinc finger protein 420-like 0.868 0.714 0.326 2e-39
334349402 791 PREDICTED: zinc finger protein 160-like 0.913 0.429 0.305 2e-39
334313269 509 PREDICTED: zinc finger protein 420-like 0.927 0.677 0.335 3e-39
>gi|334327315|ref|XP_003340863.1| PREDICTED: hypothetical protein LOC100617363 [Monodelphis domestica] Back     alignment and taxonomy information
 Score =  177 bits (449), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 115/351 (32%), Positives = 154/351 (43%), Gaps = 23/351 (6%)

Query: 23   ECPVCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRAP 82
            EC  CGK  +R S L  H R  HT   P        T    S     L +  +      P
Sbjct: 877  ECKQCGKTFTRTSSLAIHQR-IHTGEKPYECTQCGKTFNQRSH----LTVHQRIHTGEKP 931

Query: 83   VECSYCGKVLSRKDKLTRHIAAVHSGKEYPCEQCDRKFTNGYKLKQHMLTHMQKDTSISI 142
             +C  CGK  +++  L  H       K Y C+QC + FT    L  H   H  +      
Sbjct: 932  YKCKQCGKTFTQRSGLFVHQRMYTGEKPYECKQCGKTFTRTSSLAIHQRIHTGE------ 985

Query: 143  DVISEIKKFKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGCYTNRELEEHQILT 202
                  K ++C QC      K++L  H +R HT E    C QCG        L  HQ + 
Sbjct: 986  ------KPYECKQCGKTFNQKFHLALH-QRLHTGEKPYECKQCGKTFNQRSHLAIHQRIH 1038

Query: 203  HGAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLA 262
             G +PY CK C KTF +R ++  H+RM H   KPYEC  C K    R  L  H  ++H  
Sbjct: 1039 TGEKPYECKQCGKTFIQRSSLAVHQRM-HTGEKPYECKQCGKTFKRRSYLAVH-QRMHTG 1096

Query: 263  QR-FECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPT 321
            ++ +ECK C KT         H+ +H+  KP+ CN CGK F     + +H R HT  +P 
Sbjct: 1097 EKLYECKQCGKTFKRRSYLAVHLRIHTGEKPYECNQCGKTFTSTSSLAVHQRMHTGEKP- 1155

Query: 322  FECDVCHQIFP-TDFRTKHMLVHDVEKSHLCFVCGAGFVNDAGLKVHMRKH 371
            +EC+ C + F  T     H  +H  EK + C  CG  F   + L VH R H
Sbjct: 1156 YECNQCGKTFACTSSLAVHQRMHTGEKPYECNQCGNTFNQRSYLVVHQRIH 1206




Source: Monodelphis domestica

Species: Monodelphis domestica

Genus: Monodelphis

Family: Didelphidae

Order: Didelphimorphia

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota

>gi|334327291|ref|XP_001369311.2| PREDICTED: zinc finger protein 184-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|334349670|ref|XP_001368486.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|395540052|ref|XP_003771975.1| PREDICTED: zinc finger protein 850-like [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|334327353|ref|XP_001371662.2| PREDICTED: hypothetical protein LOC100018428 [Monodelphis domestica] Back     alignment and taxonomy information
>gi|334325100|ref|XP_003340603.1| PREDICTED: zinc finger protein 160-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|334327357|ref|XP_003340882.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|326678763|ref|XP_003201162.1| PREDICTED: zinc finger protein 420-like [Danio rerio] Back     alignment and taxonomy information
>gi|334349402|ref|XP_003342200.1| PREDICTED: zinc finger protein 160-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|334313269|ref|XP_003339868.1| PREDICTED: zinc finger protein 420-like [Monodelphis domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query372
ZFIN|ZDB-GENE-110913-159733 si:ch211-197f20.2 "si:ch211-19 0.911 0.462 0.316 7.3e-48
UNIPROTKB|J9NRJ4 688 ZNF420 "Uncharacterized protei 0.879 0.475 0.326 7.7e-48
UNIPROTKB|J9NW95 685 ZNF420 "Uncharacterized protei 0.879 0.477 0.326 7.7e-48
UNIPROTKB|A2VDQ7 687 ZNF420 "Zinc finger protein 42 0.879 0.475 0.323 6.9e-47
UNIPROTKB|F1MML9 687 ZNF420 "Zinc finger protein 42 0.879 0.475 0.323 6.9e-47
ZFIN|ZDB-GENE-071004-26471 zgc:171727 "zgc:171727" [Danio 0.930 0.734 0.316 6.9e-47
ZFIN|ZDB-GENE-110914-160 1003 si:dkey-240n22.7 "si:dkey-240n 0.908 0.336 0.330 9.6e-47
ZFIN|ZDB-GENE-110913-145656 si:ch211-209n20.58 "si:ch211-2 0.908 0.515 0.316 1.4e-46
UNIPROTKB|Q8TAQ5 688 ZNF420 "Zinc finger protein 42 0.879 0.475 0.321 2.3e-46
UNIPROTKB|P17035 718 ZNF28 "Zinc finger protein 28" 0.911 0.472 0.312 4.1e-46
ZFIN|ZDB-GENE-110913-159 si:ch211-197f20.2 "si:ch211-197f20.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 502 (181.8 bits), Expect = 7.3e-48, P = 7.3e-48
 Identities = 117/370 (31%), Positives = 175/370 (47%)

Query:    22 VECPVCGKVLSRKSKLVSHMRSFHTSVTPEAGGDNNDTSGHMSQIQTMLMLDHKKPKSRA 81
             + C  CGK   + S L  HMR  HT   P        +   +S +   +M+ H   K   
Sbjct:   373 ITCTQCGKSFHQSSSLYKHMR-IHTGEKPFTCTQCGKSFSRLSHLNRHMMI-HTGEK--- 427

Query:    82 PVECSYCGKVLSRKDKLTRHIAAVHSG-KEYPCEQCDRKFTNGYKLKQHMLTH------- 133
             P  C+ CGK  SR   L RH+  +H+G K + C QC + F+N   L +HM  H       
Sbjct:   428 PFTCTQCGKSFSRLSHLIRHMM-IHTGEKPFTCSQCRKSFSNLSSLYRHMRIHTGEKPFT 486

Query:   134 -------MQKDTSISIDVI--SEIKKFKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQ 184
                     ++ +++++ ++  +E K FKC QC  +     +L  HI   HT E    CTQ
Sbjct:   487 CTQCGKSFRQSSNLNLHMMIHTEEKPFKCTQCGKSFSQSSHLNQHIMI-HTGEKPFKCTQ 545

Query:   185 CGFGCYTNRELEEHQILTHGAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNK 244
             CG     +  L +H ++  G +P+ C  C K+F K  ++  H RM H   KP+ C  C  
Sbjct:   546 CGKSFIQSSSLNQHMMIHTGEKPFTCPKCGKSFRKSSSLNEH-RMIHTGEKPFTCPKCEM 604

Query:   245 ILVSRGRLNEHLNQVHLAQR-FECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFK 303
                    LN+H+ ++H  ++ F C  C K+     + K HM +H+  KPF C  CGK F 
Sbjct:   605 SFSQSSSLNKHM-RIHTGEKPFTCTQCGKSFNQTSSLKDHMRIHTGEKPFTCPKCGKSFN 663

Query:   304 LKYYVNLHMRTHTRIRPTFECDVCHQIF--PTDFRTKHMLVHDVEKSHLCFVCGAGFVND 361
                ++N HMR HT  +P F C  C + F  P+    KHM +H   ++++C  C   F+  
Sbjct:   664 QSSHLNHHMRIHTGEKP-FTCTQCGKSFSRPSSLN-KHMKIHTGVRAYMCLKCKKTFITA 721

Query:   362 AGLKVHMRKH 371
               LK H R H
Sbjct:   722 EDLKRHQRIH 731


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
UNIPROTKB|J9NRJ4 ZNF420 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NW95 ZNF420 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A2VDQ7 ZNF420 "Zinc finger protein 420" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MML9 ZNF420 "Zinc finger protein 420" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-26 zgc:171727 "zgc:171727" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-160 si:dkey-240n22.7 "si:dkey-240n22.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-145 si:ch211-209n20.58 "si:ch211-209n20.58" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TAQ5 ZNF420 "Zinc finger protein 420" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P17035 ZNF28 "Zinc finger protein 28" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 372
KOG1074|consensus958 99.95
KOG1074|consensus 958 99.95
KOG2462|consensus279 99.94
KOG2462|consensus279 99.94
KOG3608|consensus467 99.94
KOG3608|consensus467 99.93
KOG3623|consensus 1007 99.89
KOG3623|consensus1007 99.82
KOG3576|consensus267 99.72
KOG3576|consensus267 99.62
PLN03086567 PRLI-interacting factor K; Provisional 99.34
PLN03086567 PRLI-interacting factor K; Provisional 99.34
PHA00733128 hypothetical protein 99.13
KOG3993|consensus500 99.0
PHA00733128 hypothetical protein 98.97
PHA0276855 hypothetical protein; Provisional 98.89
KOG3993|consensus500 98.84
PHA0276855 hypothetical protein; Provisional 98.77
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.68
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.53
PHA0061644 hypothetical protein 98.38
PHA0061644 hypothetical protein 98.36
PHA0073279 hypothetical protein 98.28
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.23
PHA0073279 hypothetical protein 98.21
KOG1146|consensus 1406 98.1
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.04
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.02
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.02
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.97
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.81
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.76
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.72
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.64
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.58
COG5189423 SFP1 Putative transcriptional repressor regulating 97.21
COG5236493 Uncharacterized conserved protein, contains RING Z 97.14
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.09
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.97
smart0035526 ZnF_C2H2 zinc finger. 96.97
KOG2231|consensus 669 96.96
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.95
COG5189423 SFP1 Putative transcriptional repressor regulating 96.94
smart0035526 ZnF_C2H2 zinc finger. 96.86
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.82
KOG2482|consensus423 96.77
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.71
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.64
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.64
KOG2785|consensus390 96.31
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.28
COG5236493 Uncharacterized conserved protein, contains RING Z 96.22
PRK04860160 hypothetical protein; Provisional 96.11
KOG2893|consensus341 96.11
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.78
KOG1146|consensus 1406 95.75
KOG2482|consensus423 95.72
KOG2785|consensus390 95.62
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.48
PRK04860160 hypothetical protein; Provisional 95.08
KOG2231|consensus 669 94.9
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 94.67
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.34
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.05
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 93.98
COG5048467 FOG: Zn-finger [General function prediction only] 93.37
COG5048467 FOG: Zn-finger [General function prediction only] 92.33
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 92.17
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 91.75
COG404965 Uncharacterized protein containing archaeal-type C 90.89
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 90.67
KOG4173|consensus253 89.7
KOG2893|consensus 341 89.25
KOG4173|consensus253 89.12
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 88.65
COG404965 Uncharacterized protein containing archaeal-type C 88.21
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 86.95
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 86.64
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 86.42
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 85.31
PHA0062659 hypothetical protein 84.94
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 84.5
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 84.1
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 83.89
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 83.37
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 83.19
KOG2186|consensus276 82.76
COG1592166 Rubrerythrin [Energy production and conversion] 82.58
PF09986214 DUF2225: Uncharacterized protein conserved in bact 82.38
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 82.33
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 82.31
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 81.74
PF1371937 zinc_ribbon_5: zinc-ribbon domain 81.44
PF04959214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 81.06
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 80.86
>KOG1074|consensus Back     alignment and domain information
Probab=99.95  E-value=1e-29  Score=226.65  Aligned_cols=164  Identities=24%  Similarity=0.561  Sum_probs=131.3

Q ss_pred             cccccchhhhcChhhhHhhhhhhccCCCCcccccccccccccchHHhHHhhhhcc----Cccccc---ccccccCChHHH
Q psy16828        208 YHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLA----QRFECK---LCHKTIVSEKTF  280 (372)
Q Consensus       208 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~----~~~~C~---~C~~~f~~~~~l  280 (372)
                      ..|-+|.+...-++.|+.|++. |+||+||+|.+|++.|.++.+|+.|+..|-..    -++.|+   +|-+.|...-.|
T Consensus       606 NqCiiC~rVlSC~saLqmHyrt-HtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRT-HTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             cceeeeeecccchhhhhhhhhc-ccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccc
Confidence            6788888888888888888888 88888888888888888888888888776543    347788   888888888888


Q ss_pred             HHHHhhhcCC-C------------CcccCcccccccchhhHHHHHhhhcCCCC---------------------------
Q psy16828        281 KKHMALHSDA-K------------PFVCNICGKDFKLKYYVNLHMRTHTRIRP---------------------------  320 (372)
Q Consensus       281 ~~H~~~h~~~-~------------~~~C~~C~~~f~~~~~l~~H~~~h~~~~~---------------------------  320 (372)
                      ..|++.|.+. .            .-+|..|.+.|.....+..++..+.+...                           
T Consensus       685 pQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~  764 (958)
T KOG1074|consen  685 PQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCG  764 (958)
T ss_pred             cceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCccccccc
Confidence            8888887632 1            13578888888777777777655511100                           


Q ss_pred             --------------------------------------------------------------------------------
Q psy16828        321 --------------------------------------------------------------------------------  320 (372)
Q Consensus       321 --------------------------------------------------------------------------------  320 (372)
                                                                                                      
T Consensus       765 ~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~  844 (958)
T KOG1074|consen  765 RELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATK  844 (958)
T ss_pred             cccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhcccccccccccccc
Confidence                                                                                            


Q ss_pred             ----------------------------------CccCCCCCCcCCCC-ccccccccccCCCceeCcccCCcccChhhHH
Q psy16828        321 ----------------------------------TFECDVCHQIFPTD-FRTKHMLVHDVEKSHLCFVCGAGFVNDAGLK  365 (372)
Q Consensus       321 ----------------------------------~~~C~~C~~~f~~~-~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~  365 (372)
                                                        ...|.+|++.|... .|..|+|+|+|+|||.|.+|++.|..+.+|+
T Consensus       845 ~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLK  924 (958)
T KOG1074|consen  845 TNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLK  924 (958)
T ss_pred             cccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhh
Confidence                                              26799999999877 9999999999999999999999999999999


Q ss_pred             HHHhhcC
Q psy16828        366 VHMRKHQ  372 (372)
Q Consensus       366 ~H~~~h~  372 (372)
                      .||.+|.
T Consensus       925 vHMgtH~  931 (958)
T KOG1074|consen  925 VHMGTHM  931 (958)
T ss_pred             hhhcccc
Confidence            9999884



>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query372
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-20
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 8e-20
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-09
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 7e-09
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-08
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 9e-08
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-07
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-06
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-07
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 9e-07
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-07
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-07
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-07
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 4e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 6e-07
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 6e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 7e-07
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 9e-07
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 1e-06
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-06
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 4e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-05
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 8e-05
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 1e-04
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 6e-04
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 7e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 96.7 bits (239), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 56/188 (29%), Positives = 89/188 (47%), Gaps = 5/188 (2%) Query: 131 LTHMQKDTSISIDVISEIKK-FKCDQCDYATKDKYNLGTHIKRRHTKEYSVLCTQCGFGC 189 ++ +S++ + +K + C +C + +L H +R HT E C +CG Sbjct: 1 ISEFGSSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEH-QRTHTGEKPYKCPECGKSF 59 Query: 190 YTNRELEEHQILTHGAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSR 249 ++L HQ G +PY C C K+F++R N++ H+R H KPY C C K Sbjct: 60 SDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRT-HTGEKPYACPECGKSFSQL 118 Query: 250 GRLNEHLNQVHLAQR-FECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYV 308 L H + H ++ ++C C K+ E H H+ KP+ C CGK F + + Sbjct: 119 AHLRAH-QRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDAL 177 Query: 309 NLHMRTHT 316 N+H RTHT Sbjct: 178 NVHQRTHT 185
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query372
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-22
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-21
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-19
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-16
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-16
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-14
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-11
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-15
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-12
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-14
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-14
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-13
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-08
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-13
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-12
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-10
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-12
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-07
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-09
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 8e-08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 9e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 8e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 9e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 8e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 5e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score = 91.7 bits (229), Expect = 4e-22
 Identities = 54/186 (29%), Positives = 77/186 (41%), Gaps = 19/186 (10%)

Query: 195 LEEHQILTH-GAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLN 253
                     G +PY C  C K+F++  ++  H+R  H   KPY+C  C K    +  L 
Sbjct: 9   SVAQAA-LEPGEKPYACPECGKSFSRSDHLAEHQRT-HTGEKPYKCPECGKSFSDKKDLT 66

Query: 254 EHLNQVHLAQR-------FECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKY 306
            H       QR       ++C  C K+       + H   H+  KP+ C  CGK F    
Sbjct: 67  RH-------QRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLA 119

Query: 307 YVNLHMRTHTRIRPTFECDVCHQIFPTDFR-TKHMLVHDVEKSHLCFVCGAGFVNDAGLK 365
           ++  H RTHT  +P ++C  C + F  +     H   H  EK + C  CG  F     L 
Sbjct: 120 HLRAHQRTHTGEKP-YKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALN 178

Query: 366 VHMRKH 371
           VH R H
Sbjct: 179 VHQRTH 184


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query372
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.9
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.86
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.83
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.79
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.79
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.78
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.78
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.77
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.76
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.76
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.75
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.74
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.74
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.72
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.71
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.7
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.69
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.69
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.69
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.67
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.63
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.63
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.63
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.62
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.61
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.61
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.6
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.59
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.58
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.56
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.55
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.53
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.52
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.51
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.51
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.5
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.5
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.5
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.5
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.48
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.47
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.47
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.46
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.46
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.46
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.45
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.45
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.41
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.41
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.39
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.38
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.38
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.38
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.37
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.35
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.35
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.33
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.31
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.31
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.3
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.3
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.27
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.26
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.24
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.22
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.2
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.2
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.2
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.19
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.19
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.19
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.18
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.17
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.14
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.14
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.12
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.1
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.08
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.02
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.02
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.01
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.01
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.01
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.0
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.0
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.99
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.99
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.99
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.99
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.99
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.98
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.98
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.98
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.98
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.95
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.95
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.94
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.93
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.93
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.93
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.92
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.91
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.91
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.91
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.9
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.9
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.9
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.89
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.89
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.87
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.86
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.86
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.85
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.84
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.84
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.82
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.81
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.78
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.77
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.7
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.65
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.62
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.61
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.56
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.56
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.55
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.53
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.49
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.48
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.47
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.46
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.45
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.42
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.41
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.41
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.39
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.36
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.31
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.3
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.26
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.24
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.23
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.23
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.22
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.22
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.51
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.2
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.18
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.18
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.16
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.16
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.16
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.16
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.15
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.15
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.14
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.13
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.11
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.1
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.09
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.09
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.07
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.06
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.06
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.06
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.32
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.05
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.29
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.27
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.01
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.0
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.25
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.23
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.96
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.96
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.95
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.93
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.86
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.84
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.73
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.13
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.13
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.09
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.97
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.81
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.76
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.3
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.81
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.67
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.51
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.33
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 93.91
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 92.3
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 91.23
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 90.99
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 90.82
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.11
2k5c_A95 Uncharacterized protein PF0385; structural genomic 88.93
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 88.6
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 88.42
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 87.6
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.09
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 83.25
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 81.62
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 81.62
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=2.3e-38  Score=253.95  Aligned_cols=177  Identities=30%  Similarity=0.622  Sum_probs=92.8

Q ss_pred             HHHHHHHHhcCCCCcccccchhhhcChhhhHhhhhhhccCCCCcccccccccccccchHHhHHhhhhccCcccccccccc
Q psy16828        194 ELEEHQILTHGAEPYHCKYCDKTFTKRMNVKTHERMKHENHKPYECYICNKILVSRGRLNEHLNQVHLAQRFECKLCHKT  273 (372)
Q Consensus       194 ~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~  273 (372)
                      .|..|+..+.+.++|.|+.|++.|.+...|..|++. |.++++|.|++|++.|.+...|..|++.++++++|.|++|++.
T Consensus         8 ~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   86 (190)
T 2i13_A            8 SSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRT-HTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKS   86 (190)
T ss_dssp             -----------------------CCSSHHHHHGGGC-C---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCE
T ss_pred             cchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHH-cCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCc
Confidence            344555555555556666666666666666666555 5555566666666666666666666666666666666666666


Q ss_pred             cCChHHHHHHHhhhcCCCCcccCcccccccchhhHHHHHhhhcCCCCCccCCCCCCcCCCC-ccccccccccCCCceeCc
Q psy16828        274 IVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTHTRIRPTFECDVCHQIFPTD-FRTKHMLVHDVEKSHLCF  352 (372)
Q Consensus       274 f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~C~~~f~~~-~l~~h~~~h~~~~~~~C~  352 (372)
                      |.+...|..|++.|.++++|.|+.|++.|.+.+.|..|+++|+++++ |.|+.|++.|... .|..|++.|++++||.|+
T Consensus        87 f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~-~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~  165 (190)
T 2i13_A           87 FSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKP-YKCPECGKSFSREDNLHTHQRTHTGEKPYKCP  165 (190)
T ss_dssp             ESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCC-EECTTTCCEESCHHHHHHHHHHHHCCCCEECT
T ss_pred             cCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCC-eECCCCCcccCCHHHHHHHHHhcCCCCCeECC
Confidence            66666666666666666666666666666666666666666665555 6666666666554 555566666666666666


Q ss_pred             ccCCcccChhhHHHHHhhcC
Q psy16828        353 VCGAGFVNDAGLKVHMRKHQ  372 (372)
Q Consensus       353 ~C~~~f~~~~~l~~H~~~h~  372 (372)
                      +|++.|.....|..|+++|+
T Consensus       166 ~C~~~f~~~~~L~~H~~~H~  185 (190)
T 2i13_A          166 ECGKSFSRRDALNVHQRTHT  185 (190)
T ss_dssp             TTCCEESSHHHHHHHHTTC-
T ss_pred             CCCCccCCHHHHHHHHHhcC
Confidence            66666666666666666653



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 372
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 9e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.002
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.002
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.004
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.004
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 8e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 8e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.001
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.002
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 41.5 bits (98), Expect = 3e-06
 Identities = 10/33 (30%), Positives = 20/33 (60%)

Query: 207 PYHCKYCDKTFTKRMNVKTHERMKHENHKPYEC 239
           PY C+ C K F++  ++  H +  H + +P++C
Sbjct: 5   PYICQSCGKGFSRPDHLNGHIKQVHTSERPHKC 37


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query372
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.63
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.49
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.32
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.31
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.25
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.24
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.24
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.18
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.16
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.16
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.15
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.15
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.08
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.07
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.05
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.03
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.02
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.96
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.94
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.92
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.9
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.87
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.86
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.85
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.81
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.72
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.69
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.67
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.63
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.62
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.59
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.57
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.54
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.51
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.5
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.46
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.43
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.41
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.39
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.36
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.14
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.12
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.11
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.07
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.99
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.97
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.95
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.91
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.88
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.86
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.85
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.85
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.77
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.77
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.76
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.72
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.6
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.56
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.55
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.55
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.52
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.49
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.49
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.49
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.46
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.45
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.41
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.4
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.36
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.35
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.29
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.04
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.01
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.97
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.94
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.91
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.69
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.66
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.61
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.56
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.53
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.52
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.51
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.51
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.49
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.49
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.15
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.05
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.82
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.71
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.29
d1y0jb136 U-shaped transcription factor, different fingers { 95.28
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.96
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.78
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.66
d1y0jb136 U-shaped transcription factor, different fingers { 93.92
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.73
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.07
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 92.97
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 92.72
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 92.62
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 92.09
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.98
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 91.83
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 91.74
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 91.41
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 91.07
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 90.69
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.45
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 90.19
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 89.43
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 88.99
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 88.62
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 88.42
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 86.69
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 84.65
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 83.83
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 83.31
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 83.15
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 81.74
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 81.36
d1wjpa226 Zinc finger protein 295, ZNF295 {Human (Homo sapie 80.98
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 80.39
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.63  E-value=1.1e-16  Score=95.78  Aligned_cols=53  Identities=32%  Similarity=0.785  Sum_probs=48.5

Q ss_pred             cCcccccccccccCChHHHHHHHhhhcCCCCcccCcccccccchhhHHHHHhhh
Q psy16828        262 AQRFECKLCHKTIVSEKTFKKHMALHSDAKPFVCNICGKDFKLKYYVNLHMRTH  315 (372)
Q Consensus       262 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  315 (372)
                      ++||+|. ||++|....+|..|+++|+|++||.|++||++|.+.+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            4789994 9999999999999999999999999999999999999999999876



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure