Psyllid ID: psy16834


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------49
MEHSQEDTEKFSCSLCSYSVTIKRNLIMHIKRKHTDEFSILCPECGRGFFNEKELAAHKIEIHGADPFLCIPCNKPFSKIENYRLHQRRYHLNSVNKECKICHKVLRTARLSEHMKQVHYAKLFDCHICGKTVVTEKNYKKHMQLHSDDKPFECQFCRKAFKLKYYLTLHLRTHTGVRPMFECDICHKVLKTKSKKSSGISKNENLRPCTLCDKKLASERKLKEHIRKQHPTSVEADLIRREKYEREKVQCPYCAKFLSRKEKLNRHIRTVHTDVNYKCEICGEEFLSKTRYNRHVVTHEEKQKFECECGYVTCNKYRLTEHVRRTHLKDYKVLCPICGYGCFRNAELEEHFISAHSADRFKCVFCEKSFARNCNLKLHIRRYHDKSDNTECPLCGKSFPSRGRLNEHLIQVHPAQKHQCHICNKIVVSEKTLKKHLLLHTNSEPFHCPECGKAFKFKRYVTLHMRTHTGNWPTFVCKICNATISSEY
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccEccccHHHHHHHHHccccccccccccccEEccccHHHHHcHccccccccccccccccEccccHHHHHHHHHcccccccccccccccccHcHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHccccccccccccccccEccccHHHHHHHHcccccccccccccEccccHHHHHHHHccccccccHcccEccccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccEccccccEccccHHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHHcccccccEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccccEcccccccccccc
mehsqedtekfscslcsysvTIKRNLIMHIKRkhtdefsilcpecgrgffnekELAAHKIeihgadpflcipcnkpfskienYRLHQRRYHLNSVNKECKICHKVLRTARLSEHMKQVHYAKLfdchicgktvvteKNYKKHmqlhsddkpfecQFCRKAFKLKYYLTLHLRthtgvrpmfecdichkvlktkskkssgisknenlrpctlcdKKLASERKLKEHIrkqhptsveADLIRREkyerekvqcpycakfLSRKEKLNRHIRTvhtdvnykceicgeeflsktrynrhvvtheekqkfececgyvtcnkyrltEHVRRthlkdykvlcpicgygcfrnaeLEEHFISahsadrfkcvfceksfarncNLKLHIrryhdksdntecplcgksfpsrgrlnehliqvhpaqkhqchiCNKIVVSEKTLKKHLLLhtnsepfhcpecgkafkfkRYVTLHMrthtgnwptFVCKICnatissey
mehsqedtekfscslcsySVTIKRNLIMHIKRKHTDEFSILCPECGRGFFNEKELAAHKIEIHGADPFLCIPCNKPFSKIENYRLHQRRYHLNSVNKECKICHKVLRTARLSEHMKQVHYAKLFDCHICGKTVVTEKNYKKHMqlhsddkpfECQFCRKAFKLKYYLTLHLRTHTGVRPMFECDICHKVLktkskkssgisknenlrpctlcdKKLASErklkehirkqhptsveadlirrekyerekvqcpycakflsrkeklnrhirtvhtdvnykceICGEeflsktrynRHVVtheekqkfececgYVTCNKYRLTEHVRRTHLKDYKVLCPICGYGCFRNAELEEHFISAHSADRFKCVFCEKSFARNCNLKLHIrryhdksdntecPLCGKSFPSRGRLNEHLIQVhpaqkhqcHICNKIVVSEKTLKKHLLLHTnsepfhcpecgKAFKFKRYVTLHMrthtgnwptfvCKICNATISSEY
MEHSQEDTEKFSCSLCSYSVTIKRNLIMHIKRKHTDEFSILCPECGRGFFNEKELAAHKIEIHGADPFLCIPCNKPFSKIENYRLHQRRYHLNSVNKECKICHKVLRTARLSEHMKQVHYAKLFDCHICGKTVVTEKNYKKHMQLHSDDKPFECQFCRKAFKLKYYLTLHLRTHTGVRPMFECDICHKVLktkskkssgiskNENLRPCTLCDKKLASERKLKEHIRKQHPTSVEADLIRREKYEREKVQCPYCAKFLSRKEKLNRHIRTVHTDVNYKCEICGEEFLSKTRYNRHVVTHEEKQKFECECGYVTCNKYRLTEHVRRTHLKDYKVLCPICGYGCFRNAELEEHFISAHSADRFKCVFCEKSFARNCNLKLHIRRYHDKSDNTECPLCGKSFPSRGRLNEHLIQVHPAQKHQCHICNKIVVSEktlkkhlllhtNSEPFHCPECGKAFKFKRYVTLHMRTHTGNWPTFVCKICNATISSEY
**********FSCSLCSYSVTIKRNLIMHIKRKHTDEFSILCPECGRGFFNEKELAAHKIEIHGADPFLCIPCNKPFSKIENYRLHQRRYHLNSVNKECKICHKVLRTARLSEHMKQVHYAKLFDCHICGKTVVTEKNYKKHMQLHSDDKPFECQFCRKAFKLKYYLTLHLRTHTGVRPMFECDICHKVLK**********************************************LIRREKYEREKVQCPYCAKFLSRKEKLNRHIRTVHTDVNYKCEICGEEFLSKTRYNRHVVTHEEKQKFECECGYVTCNKYRLTEHVRRTHLKDYKVLCPICGYGCFRNAELEEHFISAHSADRFKCVFCEKSFARNCNLKLHIRRYHDKSDNTECPLCGKSFPSRGRLNEHLIQVHPAQKHQCHICNKIVVSEKTLKKHLLLHTNSEPFHCPECGKAFKFKRYVTLHMRTHTGNWPTFVCKICNATI****
MEHSQEDTEKFSCSLCSYSVTIKRNLIMHIKRKHTDEFSILCPECGRGFFNEKELAAHKIEIHGADPFLCIPCNKPFSKIENYRLHQRRYHLNSVNKECKICHKVLRTARLSEHMKQVHYAKLFDCHICGKTVVTEKNYKKHMQLHSDDKPFECQFCRKAFKLKYYLTLHLRTHTGVRPMFECDICHKVLKTKSKKSSGISKNENLRPCTLCDKKLASERKLKEHIRKQHPTSVEADLIRREKYEREKVQCPYCAKFLSRKEKLNRHIRTVHTDVNYKCEICGEEFLSKTRYNRHVVTHEEKQKFECECGYVTCNKYRLTEHVRRTHLKDYKVLCPICGYGCFRNAELEEHFISAHSADRFKCVFCEKSFARNCNLKLHIRRYHDKSDNTECPLCGKSFPSRGRLNEHLIQVHPAQKHQCHICNKIVVSEKTLKKHLLLHTNSEPFHCPECGKAFKFKRYVTLHMRTHTGNWPTFVCKICNATIS***
***********SCSLCSYSVTIKRNLIMHIKRKHTDEFSILCPECGRGFFNEKELAAHKIEIHGADPFLCIPCNKPFSKIENYRLHQRRYHLNSVNKECKICHKVLRTARLSEHMKQVHYAKLFDCHICGKTVVTEKNYKKHMQLHSDDKPFECQFCRKAFKLKYYLTLHLRTHTGVRPMFECDICHKVLK**********KNENLRPCTLCDKKLASERKLKEHIRKQHPTSVEADLIRREKYEREKVQCPYCAKFLSRKEKLNRHIRTVHTDVNYKCEICGEEFLSKTRYNRHVVTHEEKQKFECECGYVTCNKYRLTEHVRRTHLKDYKVLCPICGYGCFRNAELEEHFISAHSADRFKCVFCEKSFARNCNLKLHIRRYHDKSDNTECPLCGKSFPSRGRLNEHLIQVHPAQKHQCHICNKIVVSEKTLKKHLLLHTNSEPFHCPECGKAFKFKRYVTLHMRTHTGNWPTFVCKICNATISSEY
*****EDTEKFSCSLCSYSVTIKRNLIMHIKRKHTDEFSILCPECGRGFFNEKELAAHKIEIHGADPFLCIPCNKPFSKIENYRLHQRRYHLNSVNKECKICHKVLRTARLSEHMKQVHYAKLFDCHICGKTVVTEKNYKKHMQLHSDDKPFECQFCRKAFKLKYYLTLHLRTHTGVRPMFECDICHKVLKTKSKKSSGISKNENLRPCTLCDKKLASERKLKEHIRKQHPTSVEADLIRREKYEREKVQCPYCAKFLSRKEKLNRHIRTVHTDVNYKCEICGEEFLSKTRYNRHVVTHEEKQKFECECGYVTCNKYRLTEHVRRTHLKDYKVLCPICGYGCFRNAELEEHFISAHSADRFKCVFCEKSFARNCNLKLHIRRYHDKSDNTECPLCGKSFPSRGRLNEHLIQVHPAQKHQCHICNKIVVSEKTLKKHLLLHTNSEPFHCPECGKAFKFKRYVTLHMRTHTGNWPTFVCKICNATI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHSQEDTEKFSCSLCSYSVTIKRNLIMHIKRKHTDEFSILCPECGRGFFNEKELAAHKIEIHGADPFLCIPCNKPFSKIENYRLHQRRYHLNSVNKECKICHKVLRTARLSEHMKQVHYAKLFDCHICGKTVVTEKNYKKHMQLHSDDKPFECQFCRKAFKLKYYLTLHLRTHTGVRPMFECDICHKVLKTKSKKSSGISKNENLRPCTLCDKKLASERKLKEHIRKQHPTSVEADLIRREKYEREKVQCPYCAKFLSRKEKLNRHIRTVHTDVNYKCEICGEEFLSKTRYNRHVVTHEEKQKFECECGYVTCNKYRLTEHVRRTHLKDYKVLCPICGYGCFRNAELEEHFISAHSADRFKCVFCEKSFARNCNLKLHIRRYHDKSDNTECPLCGKSFPSRGRLNEHLIQVHPAQKHQCHICNKIVVSEKTLKKHLLLHTNSEPFHCPECGKAFKFKRYVTLHMRTHTGNWPTFVCKICNATISSEY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query488 2.2.26 [Sep-21-2011]
P10076861 Zinc finger protein 26 OS no N/A 0.952 0.540 0.296 2e-52
P51523738 Zinc finger protein 84 OS yes N/A 0.959 0.634 0.323 5e-50
Q06732778 Zinc finger protein 33B O no N/A 0.907 0.569 0.326 5e-50
Q86UE3 836 Zinc finger protein 546 O no N/A 0.915 0.534 0.317 3e-47
Q9N003741 Zinc finger protein 425 ( N/A N/A 0.950 0.626 0.306 4e-46
A2VDQ7 687 Zinc finger protein 420 O no N/A 0.950 0.675 0.302 1e-45
Q8TAQ5688 Zinc finger protein 420 O no N/A 0.954 0.677 0.298 2e-45
A8MQ141090 Zinc finger protein 850 O no N/A 0.928 0.415 0.303 2e-45
Q32M78642 Zinc finger protein 699 O no N/A 0.891 0.677 0.314 1e-44
Q6IV72752 Zinc finger protein 425 O no N/A 0.926 0.601 0.298 1e-44
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function desciption
 Score =  207 bits (526), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 155/523 (29%), Positives = 230/523 (43%), Gaps = 58/523 (11%)

Query: 11  FSCSLCSYSVTIKRNLIMHIKRKHTDEFSILCPECGRGFFNEKELAAHKIEIHGADPFLC 70
           + C  C  + T + +LI+H+ R+HT E S  C ECG+ F     L  H     G  P+ C
Sbjct: 274 YDCKECGKAFTERSSLIVHL-RQHTREKSYECKECGKTFIQPSRLTEHMRSHTGEKPYQC 332

Query: 71  IPCNKPFSKIENYRLHQRRYHLNSVNKECKICHKVL-RTARLSEHMKQVHYAKLFDCHIC 129
             C   F+   +Y     R H      EC IC K   R++ L  H++     K ++C +C
Sbjct: 333 DQCGNAFAS-SSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECKVC 391

Query: 130 GKTVVTEKNYKKHMQLHSDDKPFECQFCRKAFKLKYYLTLHLRTHTGVRPMFECDICHKV 189
           GK          H++ H+ ++P+ C  C KAF     LT H++THTG +P F C +C + 
Sbjct: 392 GKAFSGRSWLTIHLRKHTGERPYPCTECEKAFTSFAQLTEHIKTHTGEKP-FRCKVCART 450

Query: 190 LKTKS------------------------KKSSGISK------NENLRPCTLCDKKLASE 219
            +  S                           SG++K       E    C  C K  ++ 
Sbjct: 451 FRNSSCLKTHFRIHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTS 510

Query: 220 RKLKEHIR----------------KQHPTSVEADLIRREKYEREKVQCPYCAKFLSRKEK 263
             L EHIR                  H +S+   L  R     +  +C  C K  +R   
Sbjct: 511 SGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHL--RTHTGEKPFECNQCDKTFTRSSY 568

Query: 264 LNRHIRTVHTDVNYKCEICGEEFLSKTRYNRHVVTHEEKQKFEC-ECGYVTCNKYRLTEH 322
           L  H+RT   +  Y+C+ CG+ F  ++   +H+ TH  ++ +EC ECG    +  +LT H
Sbjct: 569 LRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVH 628

Query: 323 VRRTHLKDYKVLCPICGYGCFRNAELEEHFISAHSADRFKCVFCEKSFARNCNLKLHIRR 382
           + +TH  +    C +C      ++ LE HF        +KC +C K+F     L +H+R 
Sbjct: 629 I-KTHSSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRN 687

Query: 383 YHDKSDNTECPLCGKSFPSRGRLNEHLIQVHPAQK-HQCHICNKIVVSEKTLKKHLLLHT 441
            H    +  C  CGK+F +   L  H I+ H  +K  +C  C K   S   L  HL +HT
Sbjct: 688 -HTGEKSYACQECGKAFSTSSGLIAH-IRSHKGEKPFECDHCGKAFASSSYLNVHLKIHT 745

Query: 442 NSEPFHCPECGKAFKFKRYVTLHMRTHTGNWPTFVCKICNATI 484
             +PF C  CGK F    Y+ +HMRTHTG  P F C IC  + 
Sbjct: 746 GEKPFQCTVCGKTFTCSSYLPVHMRTHTGEKP-FQCIICGKSF 787




May be involved in transcriptional regulation.
Mus musculus (taxid: 10090)
>sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 Back     alignment and function description
>sp|Q06732|ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens GN=ZNF33B PE=2 SV=2 Back     alignment and function description
>sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 Back     alignment and function description
>sp|Q9N003|ZN425_MACFA Zinc finger protein 425 (Fragment) OS=Macaca fascicularis GN=ZNF425 PE=2 SV=2 Back     alignment and function description
>sp|A2VDQ7|ZN420_BOVIN Zinc finger protein 420 OS=Bos taurus GN=ZNF420 PE=2 SV=1 Back     alignment and function description
>sp|Q8TAQ5|ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens GN=ZNF420 PE=2 SV=1 Back     alignment and function description
>sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 Back     alignment and function description
>sp|Q32M78|ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens GN=ZNF699 PE=2 SV=1 Back     alignment and function description
>sp|Q6IV72|ZN425_HUMAN Zinc finger protein 425 OS=Homo sapiens GN=ZNF425 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query488
332028292 1642 Zinc finger protein 91 [Acromyrmex echin 0.963 0.286 0.321 1e-56
326680593 592 PREDICTED: zinc finger protein 721-like, 0.926 0.763 0.319 2e-54
395539648 844 PREDICTED: zinc finger protein 850-like 0.932 0.539 0.344 2e-53
383856780 2186 PREDICTED: uncharacterized protein LOC10 0.954 0.213 0.296 3e-53
328702649 724 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.948 0.639 0.326 5e-53
291413280 867 PREDICTED: zinc finger protein 26-like [ 0.930 0.523 0.320 2e-52
326667465 2943 PREDICTED: hypothetical protein LOC57172 0.930 0.154 0.324 2e-52
326667255 908 PREDICTED: zinc finger protein 91-like [ 0.954 0.513 0.312 3e-52
432912348 1168 PREDICTED: zinc finger protein Xfin-like 0.954 0.398 0.315 4e-52
351700784 779 Zinc finger protein 26, partial [Heteroc 0.868 0.544 0.319 5e-52
>gi|332028292|gb|EGI68339.1| Zinc finger protein 91 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  227 bits (579), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 161/501 (32%), Positives = 237/501 (47%), Gaps = 31/501 (6%)

Query: 3    HSQEDTEKFSCSLCSYSVTIKRNLIMHIKRKHTDEFSILCPECGRGFFNEKELAAHKIEI 62
            H ++  ++F+C +C  S     +L +H K+KH  E+ I C  C +GF+  + L  H +  
Sbjct: 809  HLKQHNKRFTCDICGVSKVSGYDLRLH-KKKHNQEYVIHCETCNKGFYTNQTLERHLLTH 867

Query: 63   HGADPFLCIPCNKPFSKIENYRLHQRRYHLNSVNKECKICH-KVLRTARLSEHMKQVHYA 121
             G  PF+C  CN P++      +H R  H      +C IC  +    A L  H+K     
Sbjct: 868  TGEKPFICKICNTPYASAAYLNMHMRS-HGEREKHKCNICDFESYWKAALKVHLKIHTGE 926

Query: 122  KLFDCHICGKTVVTEKNYKKHMQLHSDDKPFECQFCRKAFKLKYYLTLHLRTHTGVRPMF 181
                C +CGK+V ++   + HM++HS +KP  C+ C KAF ++ YLT+HLRTHTG +P +
Sbjct: 927  NQITCEVCGKSVSSKTYLQIHMRIHSGEKPHVCEVCGKAFSVRKYLTVHLRTHTGEKP-Y 985

Query: 182  ECDICHKVLKTKSKKSSGIS---------KNENLRPCTLCDKKLA---SERKLKEHIRKQ 229
            EC +C K    +   +S +          KN NLR   L +  L    SE+     I  Q
Sbjct: 986  ECKVCQKRFTQQGSLNSHMKSHNESNVQYKNINLRH-ELSEDPLTQKESEKAANGGITHQ 1044

Query: 230  HPTSVEADLIRREKYEREKVQCPYCAKFLSRKEKLNRHIRTVHTDVN-YKCEICGEEFLS 288
            + + ++    R+  YE     C  C K    K     H+   H+D   Y+C++CG+ F  
Sbjct: 1045 NYSGMKKQFNRQTFYE-----CSICTKLFRSKNLFEGHL-VAHSDARPYQCDVCGKCFKR 1098

Query: 289  KTRYNRHVVTHEEKQKFECE-CGYVTCNKYRLTEHVRRTHLKDYKVLCPICGYGCFRNAE 347
                  H   H  ++ F C+ CG+      +L  H +R H + Y   C IC  G F NAE
Sbjct: 1099 TNTLAVHKRIHTHEKNFVCDVCGHAFIQASQLATHYKR-HFEKYTTHCEICNKGFFTNAE 1157

Query: 348  LEEHFISAHSADRFKCVFCEKSFARNCNLKLHIRRYHD---KSDNTECPLCGKSFPSRGR 404
            L  H    H A    C  C KSF  N  L  H+ + HD   K    +C  CGK F  +  
Sbjct: 1158 LHGHMNVKHGAKEHVCTACNKSFPNNHTLARHL-KIHDPNFKPVKHQCEFCGKIFAYKNS 1216

Query: 405  LNEHLIQVHPAQKHQCHICNKIVVSEKTLKKHLLLHTNSEPFHCPECGKAFKFKRYVTLH 464
            L  H+       K+ CH+C K V S+ +L+ HL LH   +   C  CGKAF  +  + +H
Sbjct: 1217 LVVHVKSHTGENKYDCHLCGKSVSSKGSLQDHLRLHGGEKSLVCDVCGKAFHKRTTLVVH 1276

Query: 465  MRTHTGNWPTFVCKICNATIS 485
             RTHTG  P + C  C  + +
Sbjct: 1277 KRTHTGEKP-YSCDACGKSFT 1296




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|326680593|ref|XP_003201566.1| PREDICTED: zinc finger protein 721-like, partial [Danio rerio] Back     alignment and taxonomy information
>gi|395539648|ref|XP_003771779.1| PREDICTED: zinc finger protein 850-like [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|383856780|ref|XP_003703885.1| PREDICTED: uncharacterized protein LOC100882515 [Megachile rotundata] Back     alignment and taxonomy information
>gi|328702649|ref|XP_003241967.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein Xfin [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|291413280|ref|XP_002722904.1| PREDICTED: zinc finger protein 26-like [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|326667465|ref|XP_700431.5| PREDICTED: hypothetical protein LOC571721 [Danio rerio] Back     alignment and taxonomy information
>gi|326667255|ref|XP_003198540.1| PREDICTED: zinc finger protein 91-like [Danio rerio] Back     alignment and taxonomy information
>gi|432912348|ref|XP_004078886.1| PREDICTED: zinc finger protein Xfin-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|351700784|gb|EHB03703.1| Zinc finger protein 26, partial [Heterocephalus glaber] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query488
UNIPROTKB|J9NT49778 ZNF33A "Uncharacterized protei 0.922 0.578 0.318 3.8e-62
UNIPROTKB|I3LSS6 977 I3LSS6 "Uncharacterized protei 0.948 0.473 0.313 7.9e-62
MGI|MGI:99173861 Zfp26 "zinc finger protein 26" 0.928 0.526 0.321 5.5e-61
UNIPROTKB|F1RHD5 799 ZNF546 "Uncharacterized protei 0.946 0.578 0.315 5.5e-61
ZFIN|ZDB-GENE-110913-173 819 si:dkey-78k22.1 "si:dkey-78k22 0.926 0.551 0.324 9e-61
ZFIN|ZDB-GENE-110913-39639 si:dkey-202n8.1 "si:dkey-202n8 0.965 0.737 0.304 1.2e-60
UNIPROTKB|I3L5E8713 ZNF248 "Uncharacterized protei 0.918 0.628 0.315 1.2e-60
ZFIN|ZDB-GENE-110913-157981 si:ch211-245n8.1 "si:ch211-245 0.956 0.476 0.318 1.7e-60
UNIPROTKB|H9L2G0 736 ZNF555 "Uncharacterized protei 0.950 0.630 0.31 2.4e-60
UNIPROTKB|Q06732778 ZNF33B "Zinc finger protein 33 0.922 0.578 0.316 2.4e-60
UNIPROTKB|J9NT49 ZNF33A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 635 (228.6 bits), Expect = 3.8e-62, P = 3.8e-62
 Identities = 153/481 (31%), Positives = 226/481 (46%)

Query:     1 MEHSQEDTEKFSCSLCSYSVTIKRNLIMHIKRKHTDEFSILCPECGRGFFNEKELAAHKI 60
             ++ + +  + F C+ C  +   K +L  H +R HT E    C ECG+ F+ +  L  H+ 
Sbjct:   319 LQKTHKGEKHFECNECRKAFWEKSHLTRH-QRIHTGEKRFQCNECGKTFWEKSNLTKHQR 377

Query:    61 EIHGADPFLCIPCNKPFSKIENYRLHQRRYHLNSVNKECKICHKVL-RTARLSEHMKQVH 119
                G  P++C  C K FS     RLHQR  H      +C  C K   + + L++H +   
Sbjct:   378 SHTGEKPYVCNDCGKAFSHKSALRLHQRT-HTGEKPYQCNACGKTFYQKSDLTKHQRTHT 436

Query:   120 YAKLFDCHICGKTVVTEKNYKKHMQLHSDDKPFECQFCRKAFKLKYYLTLHLRTHTGVRP 179
               K ++C+ CGK+     +   H + H+ +KPFEC  C K+F  K +LT H RTH G +P
Sbjct:   437 GLKPYECYECGKSFCMNSHLTVHQRTHTGEKPFECPDCGKSFCQKSHLTQHQRTHVGNKP 496

Query:   180 MFECDICHKVLXXXXXXXXXXXXNENLRP--CTLCDKKLASERKLKEHIRKQHPTSVEAD 237
              +EC+ C K              +  L+P  C  C K    +  L  H ++ H T     
Sbjct:   497 -YECNACGKTFYHKSVLTRHQIIHTGLKPYECYECGKTFCLKSDLTVH-QRTH-TG---- 549

Query:   238 LIRREKYEREKVQCPYCAKFLSRKEKLNRHIRTVHT-DVNYKCEICGEEFLSKTRYNRHV 296
                 EK       CP C KF S K  L++H RT HT +  ++C  CG+ F +K+   +H 
Sbjct:   550 ----EK----PFACPECGKFFSHKSTLSQHYRT-HTGEKPFECHECGKIFYNKSYLTKHN 600

Query:   297 VTHEEKQKFEC-ECGYVTCNKYRLTEHVRRTHLKDYKVLCPICGYG-CFRNAELEEHFIS 354
              TH  ++ +EC ECG   C K +LT+H +R H+ +    C  CG   C ++A +      
Sbjct:   601 RTHTGEKPYECNECGKTFCQKSQLTQH-QRIHIGEKPYECHECGKAFCHKSALIVHQ--R 657

Query:   355 AHSADR-FKCVFCEKSFARNCNLKLHIRRYHDKSDNTECPLCGKSFPSRGRLNEHLIQVH 413
              H+ ++ +KC  C KSF     L LH R+ H      EC  CGK F  +  L  H  + H
Sbjct:   658 THTEEKPYKCNECGKSFCVKSGLILHQRK-HTGEKPYECNECGKCFSHKSSLTVHH-RAH 715

Query:   414 PAQKH-QCHICNKIVVSEXXXXXXXXXXXNSEPFHCPECGKAFKFKRYVTLHMRTHTGNW 472
               +K  QC+ C KI   +             +P+ C  CGK F  K  + +H RTHTG  
Sbjct:   716 TGEKSCQCNECGKIFYRKSDLAKHQRSHTGEKPYECNTCGKTFSQKSNLIVHQRTHTGEK 775

Query:   473 P 473
             P
Sbjct:   776 P 776


GO:0008270 "zinc ion binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|I3LSS6 I3LSS6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:99173 Zfp26 "zinc finger protein 26" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RHD5 ZNF546 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-173 si:dkey-78k22.1 "si:dkey-78k22.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-39 si:dkey-202n8.1 "si:dkey-202n8.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3L5E8 ZNF248 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-157 si:ch211-245n8.1 "si:ch211-245n8.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H9L2G0 ZNF555 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q06732 ZNF33B "Zinc finger protein 33B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P51523ZNF84_HUMANNo assigned EC number0.32380.95900.6341yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 488
KOG1074|consensus958 99.98
KOG2462|consensus279 99.96
KOG2462|consensus279 99.96
KOG1074|consensus958 99.96
KOG3608|consensus467 99.95
KOG3608|consensus467 99.93
KOG3623|consensus 1007 99.89
KOG3623|consensus 1007 99.87
KOG3576|consensus267 99.68
KOG3576|consensus267 99.68
PLN03086567 PRLI-interacting factor K; Provisional 99.39
PLN03086567 PRLI-interacting factor K; Provisional 99.26
PHA00733128 hypothetical protein 99.24
PHA00733128 hypothetical protein 99.17
PHA0276855 hypothetical protein; Provisional 99.15
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.96
KOG3993|consensus500 98.89
PHA0276855 hypothetical protein; Provisional 98.88
KOG3993|consensus500 98.85
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.76
PHA0061644 hypothetical protein 98.65
PHA0073279 hypothetical protein 98.56
PHA0061644 hypothetical protein 98.55
PHA0073279 hypothetical protein 98.42
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.26
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.16
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.03
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.85
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.81
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.7
COG5189423 SFP1 Putative transcriptional repressor regulating 97.6
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.57
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.56
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.48
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.44
COG5189423 SFP1 Putative transcriptional repressor regulating 97.21
smart0035526 ZnF_C2H2 zinc finger. 97.09
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.07
PRK04860160 hypothetical protein; Provisional 96.99
smart0035526 ZnF_C2H2 zinc finger. 96.88
KOG2231|consensus669 96.86
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.85
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.77
KOG2785|consensus390 96.59
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.37
KOG2231|consensus 669 96.29
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.24
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.07
PRK04860160 hypothetical protein; Provisional 95.91
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.87
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.85
KOG1146|consensus 1406 95.71
KOG2482|consensus423 95.7
COG5236493 Uncharacterized conserved protein, contains RING Z 95.58
COG5236493 Uncharacterized conserved protein, contains RING Z 95.51
KOG1146|consensus 1406 95.32
KOG2482|consensus423 95.23
KOG2785|consensus390 95.08
COG5048467 FOG: Zn-finger [General function prediction only] 95.0
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.54
KOG4173|consensus253 94.11
KOG4173|consensus253 93.86
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.79
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.18
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.92
COG5048467 FOG: Zn-finger [General function prediction only] 92.7
KOG2893|consensus341 92.37
KOG2893|consensus 341 91.59
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 91.57
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 91.53
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 89.68
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 88.21
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 87.4
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 85.12
KOG2186|consensus 276 84.92
COG404965 Uncharacterized protein containing archaeal-type C 84.92
COG404965 Uncharacterized protein containing archaeal-type C 83.52
PF09986214 DUF2225: Uncharacterized protein conserved in bact 82.36
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 81.11
>KOG1074|consensus Back     alignment and domain information
Probab=99.98  E-value=1.3e-33  Score=273.85  Aligned_cols=226  Identities=24%  Similarity=0.450  Sum_probs=171.2

Q ss_pred             CCCCCcchHHhhcCHHHHHHHHhhhccCceeecccccccccCHHHHHhHHhhhccCCc----eeec----CCcccCChhH
Q psy16834        247 EKVQCPYCAKFLSRKEKLNRHIRTVHTDVNYKCEICGEEFLSKTRYNRHVVTHEEKQK----FECE----CGYVTCNKYR  318 (488)
Q Consensus       247 ~~~~C~~C~~~f~~~~~L~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~~~----~~C~----C~~~~~~~~~  318 (488)
                      .+.+|-+|.+...-++.|+-|.++|+|++||+|.|||+.|.++.+|+.||.+|....+    +.|.    |...|.+...
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~  683 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVT  683 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccc
Confidence            4679999999999999999999999999999999999999999999999999977654    4563    8888999999


Q ss_pred             HHHHHHhhcc-CC------------CcccCCCCCCccCChHHHHHHHHhhcC----------------C----Ccccccc
Q psy16834        319 LTEHVRRTHL-KD------------YKVLCPICGYGCFRNAELEEHFISAHS----------------A----DRFKCVF  365 (488)
Q Consensus       319 l~~H~~~~h~-~~------------~~~~C~~C~~~f~~~~~l~~H~~~~~~----------------~----~~~~C~~  365 (488)
                      |..|++ .|+ +.            ..-+|..|.++|.....+..++..+-+                +    .+..+..
T Consensus       684 lpQhIr-iH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~  762 (958)
T KOG1074|consen  684 LPQHIR-IHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENS  762 (958)
T ss_pred             ccceEE-eecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCccccc
Confidence            999865 443 21            124688999999888877777654411                1    1567888


Q ss_pred             ccccccChhHHHHHHh----------------------hhcCCCCCc-cCCccCCcCCCchHHH----hh--------hh
Q psy16834        366 CEKSFARNCNLKLHIR----------------------RYHDKSDNT-ECPLCGKSFPSRGRLN----EH--------LI  410 (488)
Q Consensus       366 C~k~F~~~~~l~~H~~----------------------~~H~~~~~~-~C~~C~k~F~~~~~L~----~H--------~~  410 (488)
                      |+..+.....+..+--                      ..++.+++. .+..++..-...-...    .-        ..
T Consensus       763 ~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~  842 (958)
T KOG1074|consen  763 CGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLA  842 (958)
T ss_pred             cccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhcccccccccccc
Confidence            8888888776665421                      113345555 5666665443322111    00        00


Q ss_pred             h----hc-----------c---------------CCcccccccccccCChHHHHHHHHhhcCCCCcCCcchhhccCChhh
Q psy16834        411 Q----VH-----------P---------------AQKHQCHICNKIVVSEKTLKKHLLLHTNSEPFHCPECGKAFKFKRY  460 (488)
Q Consensus       411 ~----~h-----------~---------------~~~~~C~~C~k~f~~~~~L~~H~~~H~~~~~~~C~~C~~~F~~~~~  460 (488)
                      .    ..           +               .....|.+||+.|.+.++|..||++|+|+|||.|.+|+++|.++.+
T Consensus       843 t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgn  922 (958)
T KOG1074|consen  843 TKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGN  922 (958)
T ss_pred             cccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhh
Confidence            0    00           0               0127899999999999999999999999999999999999999999


Q ss_pred             HhccccccccCcC
Q psy16834        461 VTLHMRTHTGNWP  473 (488)
Q Consensus       461 L~~H~~~H~~~~~  473 (488)
                      |+.||.+|.+..|
T Consensus       923 LKvHMgtH~w~q~  935 (958)
T KOG1074|consen  923 LKVHMGTHMWVQP  935 (958)
T ss_pred             hhhhhccccccCC
Confidence            9999999988755



>KOG2462|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query488
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-21
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-18
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 5e-16
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-13
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 3e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 5e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 3e-08
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 3e-08
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 4e-05
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 9e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 8e-04
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-07
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-07
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-07
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-07
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-06
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-07
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 2e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 2e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 2e-07
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 9e-07
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-05
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 3e-05
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 6e-05
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 8e-05
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-04
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 6e-04
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 9e-05
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-04
2ytq_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-04
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 4e-04
2ytf_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 7e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 99.8 bits (247), Expect = 3e-21, Method: Compositional matrix adjust. Identities = 59/169 (34%), Positives = 84/169 (49%), Gaps = 3/169 (1%) Query: 11 FSCSLCSYSVTIKRNLIMHIKRKHTDEFSILCPECGRGFFNEKELAAHKIEIHGADPFLC 70 ++C C S + +L H +R HT E CPECG+ F ++K+L H+ G P+ C Sbjct: 22 YACPECGKSFSRSDHLAEH-QRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKC 80 Query: 71 IPCNKPFSKIENYRLHQRRYHLNSVNKECKICHKVL-RTARLSEHMKQVHYAKLFDCHIC 129 C K FS+ N R HQ R H C C K + A L H + K + C C Sbjct: 81 PECGKSFSQRANLRAHQ-RTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPEC 139 Query: 130 GKTVVTEKNYKKHMQLHSDDKPFECQFCRKAFKLKYYLTLHLRTHTGVR 178 GK+ E N H + H+ +KP++C C K+F + L +H RTHTG + Sbjct: 140 GKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKK 188
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2YTQ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 775- 807) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2YTF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 607- 639) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query488
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-15
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-15
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-14
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-07
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 2e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-14
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-13
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-12
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-12
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-11
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 8e-08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-10
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-08
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-10
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 9e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 8e-08
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 5e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 8e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 8e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 6e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 6e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 4e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score = 72.9 bits (180), Expect = 3e-15
 Identities = 63/181 (34%), Positives = 88/181 (48%), Gaps = 20/181 (11%)

Query: 9   EK-FSCSLCSYSVTIKRNLIMHIKRKHTDEFSILCPECGRGFFNEKELAAHKIEIH-GAD 66
           EK ++C  C  S +   +L  H +R HT E    CPECG+ F ++K+L  H+   H G  
Sbjct: 19  EKPYACPECGKSFSRSDHLAEH-QRTHTGEKPYKCPECGKSFSDKKDLTRHQR-THTGEK 76

Query: 67  PFLCIPCNKPFSKIENYRLHQRR------YHLNSVNKECKICHKVL-RTARLSEHMKQVH 119
           P+ C  C K FS+  N R HQR       Y        C  C K   + A L  H +  H
Sbjct: 77  PYKCPECGKSFSQRANLRAHQRTHTGEKPY-------ACPECGKSFSQLAHLRAHQR-TH 128

Query: 120 YA-KLFDCHICGKTVVTEKNYKKHMQLHSDDKPFECQFCRKAFKLKYYLTLHLRTHTGVR 178
              K + C  CGK+   E N   H + H+ +KP++C  C K+F  +  L +H RTHTG +
Sbjct: 129 TGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKK 188

Query: 179 P 179
            
Sbjct: 189 T 189


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query488
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.98
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.94
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.94
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.93
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.93
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.91
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.9
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.85
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.85
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.84
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.84
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.83
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.83
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.83
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.82
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.82
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.81
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.8
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.8
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.8
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.79
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.79
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.78
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.77
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.77
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.75
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.73
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.73
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.73
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.72
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.71
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.71
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.71
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.7
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.68
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.68
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.68
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.67
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.67
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.67
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.66
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.66
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.65
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.64
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.63
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.63
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.63
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.62
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.62
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.62
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.61
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.61
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.6
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.59
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.59
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.58
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.56
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.56
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.55
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.54
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.54
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.54
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.5
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.5
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.49
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.49
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.49
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.48
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.48
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.47
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.45
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.45
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.43
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.42
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.41
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.41
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.4
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.4
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.4
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.39
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.39
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.39
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.39
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.39
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.38
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.38
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.38
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.38
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.37
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.37
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.37
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.36
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.35
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.35
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.35
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.35
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.35
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.35
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.34
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.34
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.34
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.33
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.33
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.33
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.32
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.32
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.32
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.3
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.3
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.3
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.3
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.29
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.29
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.28
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.28
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.27
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.26
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.26
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.26
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.26
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.26
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.24
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.24
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.23
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.23
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.23
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.23
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.22
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.21
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.21
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.21
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.19
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.18
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.18
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.18
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.18
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.17
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.17
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.16
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.16
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.16
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.15
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.15
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.15
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.13
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.12
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.1
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.1
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.1
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.01
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.98
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.95
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.91
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.9
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.9
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.89
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.87
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.84
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.83
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.77
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.75
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.72
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.72
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.71
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.7
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.68
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.67
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.66
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.65
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.62
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.59
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.59
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.58
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.53
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.46
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.45
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.44
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.44
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.43
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.42
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.42
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.41
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.41
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.78
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.4
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.4
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.76
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.39
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.39
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.38
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.38
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.38
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.37
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.37
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.36
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.36
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.36
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.35
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.34
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.69
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.33
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.33
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.31
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.3
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.63
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.63
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.29
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.29
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.27
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.22
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.42
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.99
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.98
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.52
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.52
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.45
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.39
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.85
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.55
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.54
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.89
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.75
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.94
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.18
2k5c_A95 Uncharacterized protein PF0385; structural genomic 92.45
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.63
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 90.06
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.24
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.96
2k5c_A95 Uncharacterized protein PF0385; structural genomic 84.82
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 84.71
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 84.43
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 82.96
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 82.37
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 80.37
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=5.8e-41  Score=294.44  Aligned_cols=184  Identities=30%  Similarity=0.576  Sum_probs=142.2

Q ss_pred             HHHHHHHHhhhccCceeecccccccccCHHHHHhHHhhhccCCceeecCCcccCChhHHHHHHHhhccCCCcccCCCCCC
Q psy16834        261 KEKLNRHIRTVHTDVNYKCEICGEEFLSKTRYNRHVVTHEEKQKFECECGYVTCNKYRLTEHVRRTHLKDYKVLCPICGY  340 (488)
Q Consensus       261 ~~~L~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~H~~~~~~~C~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~  340 (488)
                      ...|..|++.+.++++|.|++|++.|.+...|..|+++|.+++                            +|.|++||+
T Consensus         6 ~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~----------------------------~~~C~~C~~   57 (190)
T 2i13_A            6 SSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEK----------------------------PYKCPECGK   57 (190)
T ss_dssp             -------------------------CCSSHHHHHGGGCC---C----------------------------CEECTTTCC
T ss_pred             hccchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCC----------------------------CccCCCcCc
Confidence            4568889999999999999999999999999999988877654                            457888999


Q ss_pred             ccCChHHHHHHHHhhcCCCccccccccccccChhHHHHHHhhhcCCCCCccCCccCCcCCCchHHHhhhhhhccCCcccc
Q psy16834        341 GCFRNAELEEHFISAHSADRFKCVFCEKSFARNCNLKLHIRRYHDKSDNTECPLCGKSFPSRGRLNEHLIQVHPAQKHQC  420 (488)
Q Consensus       341 ~f~~~~~l~~H~~~~~~~~~~~C~~C~k~F~~~~~l~~H~~~~H~~~~~~~C~~C~k~F~~~~~L~~H~~~~h~~~~~~C  420 (488)
                      .|.+...|..|+..++++++|.|++|++.|.+..+|..|++ .|.++++|.|++||+.|.+.+.|..|++.|++++||+|
T Consensus        58 ~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C  136 (190)
T 2i13_A           58 SFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQR-THTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKC  136 (190)
T ss_dssp             EESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHH-HHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEEC
T ss_pred             hhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHHHHHH-hcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeEC
Confidence            99999999999999999999999999999999999999987 57888999999999999999999999999999999999


Q ss_pred             cccccccCChHHHHHHHHhhcCCCCcCCcchhhccCChhhHhccccccccCcC
Q psy16834        421 HICNKIVVSEKTLKKHLLLHTNSEPFHCPECGKAFKFKRYVTLHMRTHTGNWP  473 (488)
Q Consensus       421 ~~C~k~f~~~~~L~~H~~~H~~~~~~~C~~C~~~F~~~~~L~~H~~~H~~~~~  473 (488)
                      ++|++.|.++..|..|+++|+|++||.|++|+++|.++.+|..|+++|+|++|
T Consensus       137 ~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~  189 (190)
T 2i13_A          137 PECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKT  189 (190)
T ss_dssp             TTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC-----
T ss_pred             CCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCC
Confidence            99999999999999999999999999999999999999999999999999987



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 488
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 8e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 6e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.001
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 7e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.001
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.001
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.001
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.002
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.004
d2dmda329 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 { 0.004
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 24
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 41.8 bits (99), Expect = 2e-06
 Identities = 14/31 (45%), Positives = 18/31 (58%)

Query: 440 HTNSEPFHCPECGKAFKFKRYVTLHMRTHTG 470
           H+  +P+ C ECGKAF     +  H R HTG
Sbjct: 2   HSGEKPYGCVECGKAFSRSSILVQHQRVHTG 32


>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query488
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.74
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.63
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.48
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.45
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.38
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.38
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.33
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.3
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.29
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.25
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.24
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.22
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.22
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.22
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.19
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.18
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.18
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.14
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.11
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.11
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.11
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.09
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.02
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.0
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.98
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.98
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.96
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.96
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.95
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.94
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.94
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.92
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.77
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.74
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.7
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.7
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.64
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.63
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.62
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.54
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.49
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.42
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.4
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.36
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.3
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.29
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.17
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.1
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.1
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.07
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.9
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.82
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.8
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.71
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.71
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.69
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.67
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.64
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.59
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.59
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.45
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.45
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.45
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.41
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.4
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.37
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.36
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.27
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.22
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.17
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.17
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.16
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.07
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.05
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.01
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.99
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.97
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.95
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.93
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.89
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.55
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.42
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.37
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.3
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.04
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.02
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.01
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.89
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.81
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.71
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.51
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.34
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.34
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.2
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.31
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.07
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.16
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.93
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.77
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.72
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 92.3
d1y0jb136 U-shaped transcription factor, different fingers { 91.8
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.21
d1y0jb136 U-shaped transcription factor, different fingers { 91.2
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 91.13
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 90.63
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 89.53
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 89.07
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 87.84
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 87.65
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 87.58
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 87.54
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 87.33
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 86.69
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.64
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 86.47
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 85.73
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 84.16
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 82.46
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 81.48
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.74  E-value=3e-19  Score=117.15  Aligned_cols=53  Identities=30%  Similarity=0.674  Sum_probs=50.1

Q ss_pred             CCcccccccccccCChHHHHHHHHhhcCCCCcCCcchhhccCChhhHhcccccc
Q psy16834        415 AQKHQCHICNKIVVSEKTLKKHLLLHTNSEPFHCPECGKAFKFKRYVTLHMRTH  468 (488)
Q Consensus       415 ~~~~~C~~C~k~f~~~~~L~~H~~~H~~~~~~~C~~C~~~F~~~~~L~~H~~~H  468 (488)
                      ++||+|+ ||++|..+.+|+.|+++|+|++||.|++||++|.+.++|..||++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            5799995 9999999999999999999999999999999999999999999987



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure