Psyllid ID: psy16882


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKLLKGLFSLKMCPHILDEMKRHDGGYEETLHIPSDHVNTVYLEETQVLDDHDNSKKYIQQKFIKKEEPECQITTHHNMVQIDKSSRKWEQKQVQIRTLEGEFSVTMWASGGTDDDECSNPEFEQEHEYEDCILTEQEIKHEPIPGIDLSDPKQLAEFASVNNYRPGNNKIKVKRQVGLSAANEVVPNVQNNGSSGANSGNNLDRTIACPHKGCSKMFRDN
ccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
HHHHHHHHccccEEccccccEEccHHHHHHHHHHccccccEEccccccccEEccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHcccccccccHccHHHHHHHHHHHHHcccccccccccccccccEEcccccccEEcccccccccccccccEccccHHHHHHHHccccccccccHccHHHHHccccccccEccccccccccccccccccccEccccccHEHEEEcccccccccccccccEccccHHHHHHHccccccccccccccccEccccccHHcEEEEccccccccccEEccccccccEEccH
mrkhlhthgprvHVCAECGKAFVESSKLKRhqlvhtgekpfqctfegcgkrfsldfnlrthvrihtgdrpyvcpfdgcnkkfaqstnlksHILTHAKAKLLKGLFSLKMCPHILDEmkrhdggyeetlhipsdhvntvYLEEtqvlddhdnsKKYIQQKFikkeepecqitthhnmvqidkssrKWEQKQVQIRTLEGEFSVtmwasggtdddecsnpefeqeheyedcilteqeikhepipgidlsdpkqlaefasvnnyrpgnnkikVKRQVGLsaanevvpnvqnngssgansgnnldrtiacphkgcskmfrdn
mrkhlhthgprvhvcaECGKAFVESSKLKRHQLVHTgekpfqctfegCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKLLKGLFSLKMCPHILDEMKRHDGGYEETLHIPSDHVNTVYLEEtqvlddhdnsKKYIQQKFIKkeepecqitthhnmvqidkssrkWEQKQVQIRTLEGEFSVTMWASGGTDDDECSNPEFEQEHEYEDCILTEQEIKHEPIPGIDLSDPKQLAEFAsvnnyrpgnnKIKVKRQVGLSAANevvpnvqnngssgansgnnldrtiacphkgcskmfrdn
MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKLLKGLFSLKMCPHILDEMKRHDGGYEETLHIPSDHVNTVYLEETQVLDDHDNSKKYIQQKFIKKEEPECQITTHHNMVQIDKSSRKWEQKQVQIRTLEGEFSVTMWASGGTDDDECSNPEFEQEHEYEDCILTEQEIKHEPIPGIDLSDPKQLAEFASVNNYRPGNNKIKVKRQVGLSAANEVVPNVQnngssgansgnnLDRTIACPHKGCSKMFRDN
**********RVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKLLKGLFSLKMCPHILDEMKRHDGGYEETLHIPSDHVNTVYLEETQVLDDHDNSKKYIQQKFIKK***ECQITTHHNMVQI*********KQVQIRTLEGEFSVTMWA********************EDCILTE*************************************************************************************
MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKLLKGLFSLKMCPHILDEMKRHDGGYEETLHIPS**************DDHDNSKKYIQQKFIKKEEPECQITTHHNMVQIDKSSRKWEQKQVQIRTLEGEFSVTMWASGG***************EYEDCILTEQ*********************************************************************IACPHKGCSK*****
***********VHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKLLKGLFSLKMCPHILDEMKRHDGGYEETLHIPSDHVNTVYLEETQVLDDHDNSKKYIQQKFIKKEEPECQITTHHNMVQ************VQIRTLEGEFSVTMWASGGTDDDECSNPEFEQEHEYEDCILTEQEIKHEPIPGIDLSDPKQLAEFASVNNYRPGNNKIKVKRQVGLSAANEVVPNVQNNGSSGANSGNNLDRTIACPHKGCSKMFRDN
MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKLLKGLFSLKMCPHILDEMKRHDGGYEETLHIPSDHVNTVYLEETQVLDDHDNSKKYIQQKFIKKEEPECQITTHHNMVQIDKSSRKWEQKQVQIRTLEGEFSVTMWASGGTDDDECSNPEFEQEHEYEDCILTEQEIKHEPIPGIDLSDPKQLAEFASVNNYRPGNNKIKVKRQVGLSAANEVVPNVQNNGSSGANSGNNLDRTIACPHKGCSKMF***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKLLKGLFSLKMCPHILDEMKRHDGGYEETLHIPSDHVNTVYLEETQVLDDHDNSKKYIQQKFIKKEEPECQITTHHNMVQIDKSSRKWEQKQVQIRTLEGEFSVTMWASGGTDDDECSNPEFEQEHEYEDCILTEQEIKHEPIPGIDLSDPKQLAEFASVNNYRPGNNKIKVKRQVGLSAANEVVPNVQNNGSSGANSGNNLDRTIACPHKGCSKMFRDN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query318 2.2.26 [Sep-21-2011]
P25490414 Transcriptional repressor yes N/A 0.150 0.115 1.0 6e-56
Q00899414 Transcriptional repressor yes N/A 0.150 0.115 1.0 8e-56
Q8ST83520 Polycomb protein PHO OS=D yes N/A 0.226 0.138 0.979 9e-56
Q2FAY8376 Transcription factor YY2 N/A N/A 0.207 0.175 0.919 7e-52
P0C6P6376 Transcription factor YY2 no N/A 0.207 0.175 0.919 8e-52
Q3TTC2378 Transcription factor YY2 no N/A 0.194 0.164 0.919 9e-52
O15391372 Transcription factor YY2 no N/A 0.169 0.145 0.888 1e-50
Q96MM3310 Zinc finger protein 42 ho no N/A 0.198 0.203 0.833 3e-44
P22227288 Zinc finger protein 42 OS no N/A 0.298 0.329 0.816 4e-44
Q2V3L3387 Uncharacterized zinc fing yes N/A 0.298 0.245 0.525 3e-26
>sp|P25490|TYY1_HUMAN Transcriptional repressor protein YY1 OS=Homo sapiens GN=YY1 PE=1 SV=2 Back     alignment and function desciption
 Score =  218 bits (554), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 99/99 (100%), Positives = 99/99 (100%)

Query: 1   MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT 60
           MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT
Sbjct: 313 MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT 372

Query: 61  HVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 99
           HVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK
Sbjct: 373 HVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 411




Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair; proposed to target the INO80 complex to YY1-responsive elements.
Homo sapiens (taxid: 9606)
>sp|Q00899|TYY1_MOUSE Transcriptional repressor protein YY1 OS=Mus musculus GN=Yy1 PE=1 SV=1 Back     alignment and function description
>sp|Q8ST83|PHO_DROME Polycomb protein PHO OS=Drosophila melanogaster GN=pho PE=1 SV=2 Back     alignment and function description
>sp|Q2FAY8|TYY2_RATRT Transcription factor YY2 OS=Rattus rattus GN=Yy2 PE=3 SV=1 Back     alignment and function description
>sp|P0C6P6|TYY2_RAT Transcription factor YY2 OS=Rattus norvegicus GN=Yy2 PE=3 SV=1 Back     alignment and function description
>sp|Q3TTC2|TYY2_MOUSE Transcription factor YY2 OS=Mus musculus GN=Yy2 PE=2 SV=1 Back     alignment and function description
>sp|O15391|TYY2_HUMAN Transcription factor YY2 OS=Homo sapiens GN=YY2 PE=2 SV=1 Back     alignment and function description
>sp|Q96MM3|ZFP42_HUMAN Zinc finger protein 42 homolog OS=Homo sapiens GN=ZFP42 PE=1 SV=2 Back     alignment and function description
>sp|P22227|ZFP42_MOUSE Zinc finger protein 42 OS=Mus musculus GN=Zfp42 PE=1 SV=1 Back     alignment and function description
>sp|Q2V3L3|Y4634_ARATH Uncharacterized zinc finger protein At4g06634 OS=Arabidopsis thaliana GN=At4g06634 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
263359629 518 hypothetical protein DVIR88_6g0002 [Dros 0.333 0.204 0.900 1e-54
442759803383 Putative transcriptional repressor prote 0.254 0.211 1.0 1e-54
344254678371 Ena/VASP-like protein [Cricetulus griseu 0.311 0.266 1.0 1e-54
345478936402 PREDICTED: transcriptional repressor pro 0.185 0.146 0.934 1e-54
291225268378 PREDICTED: YY1 transcription factor-like 0.141 0.119 1.0 2e-54
395484813354 transcriptional repressor [Fenneropenaeu 0.191 0.172 1.0 2e-54
319803027388 pleiohomeotic [Bombyx mori] gi|317175911 0.226 0.185 0.961 2e-54
405975659353 Transcriptional repressor protein YY1 [C 0.220 0.198 1.0 2e-54
332843092 640 PREDICTED: transcriptional repressor pro 0.150 0.075 1.0 2e-54
195469439 516 GE14485 [Drosophila yakuba] gi|194185746 0.311 0.191 0.979 2e-54
>gi|263359629|gb|ACY70465.1| hypothetical protein DVIR88_6g0002 [Drosophila virilis] Back     alignment and taxonomy information
 Score =  219 bits (559), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 100/111 (90%), Positives = 101/111 (90%)

Query: 1   MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT 60
           MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT
Sbjct: 371 MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT 430

Query: 61  HVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKLLKGLFSLKMCP 111
           HVRIHTGDRP+VCPFD CNKKFAQSTNLKSHILTHAKAK   G      CP
Sbjct: 431 HVRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTHAKAKRNTGNPRHTTCP 481




Source: Drosophila virilis

Species: Drosophila virilis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|442759803|gb|JAA72060.1| Putative transcriptional repressor protein yy1-like isoform 1 [Ixodes ricinus] Back     alignment and taxonomy information
>gi|344254678|gb|EGW10782.1| Ena/VASP-like protein [Cricetulus griseus] Back     alignment and taxonomy information
>gi|345478936|ref|XP_001603501.2| PREDICTED: transcriptional repressor protein YY1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|291225268|ref|XP_002732622.1| PREDICTED: YY1 transcription factor-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|395484813|gb|AFN66651.1| transcriptional repressor [Fenneropenaeus chinensis] gi|395484815|gb|AFN66652.1| transcriptional repressor [Fenneropenaeus chinensis] Back     alignment and taxonomy information
>gi|319803027|ref|NP_001188362.1| pleiohomeotic [Bombyx mori] gi|317175911|dbj|BAJ54071.1| pleiohomeotic [Bombyx mori] Back     alignment and taxonomy information
>gi|405975659|gb|EKC40213.1| Transcriptional repressor protein YY1 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|332843092|ref|XP_510162.3| PREDICTED: transcriptional repressor protein YY1 [Pan troglodytes] Back     alignment and taxonomy information
>gi|195469439|ref|XP_002099645.1| GE14485 [Drosophila yakuba] gi|194185746|gb|EDW99357.1| GE14485 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query318
ZFIN|ZDB-GENE-030131-1117357 yy1a "YY1 transcription factor 0.311 0.277 1.0 1.5e-53
UNIPROTKB|F1MFX0344 YY1 "Uncharacterized protein" 0.311 0.287 1.0 1.5e-53
ZFIN|ZDB-GENE-040426-2127365 yy1b "YY1 transcription factor 0.311 0.271 1.0 1.5e-53
UNIPROTKB|E2RHE9410 YY1 "Uncharacterized protein" 0.311 0.241 1.0 1.5e-53
UNIPROTKB|P25490414 YY1 "Transcriptional repressor 0.311 0.239 1.0 1.5e-53
MGI|MGI:99150414 Yy1 "YY1 transcription factor" 0.311 0.239 1.0 1.5e-53
RGD|3982411 Yy1 "YY1 transcription factor" 0.311 0.240 1.0 1.5e-53
UNIPROTKB|F1NHV6189 YY1 "Uncharacterized protein" 0.311 0.523 1.0 1.5e-53
UNIPROTKB|F1NKJ0196 YY1 "Uncharacterized protein" 0.311 0.505 1.0 1.5e-53
UNIPROTKB|F1NKJ1173 YY1 "Uncharacterized protein" 0.311 0.572 1.0 1.5e-53
ZFIN|ZDB-GENE-030131-1117 yy1a "YY1 transcription factor a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 554 (200.1 bits), Expect = 1.5e-53, P = 1.5e-53
 Identities = 99/99 (100%), Positives = 99/99 (100%)

Query:     1 MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT 60
             MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT
Sbjct:   256 MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT 315

Query:    61 HVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 99
             HVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK
Sbjct:   316 HVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 354


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
UNIPROTKB|F1MFX0 YY1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2127 yy1b "YY1 transcription factor b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHE9 YY1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P25490 YY1 "Transcriptional repressor protein YY1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:99150 Yy1 "YY1 transcription factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3982 Yy1 "YY1 transcription factor" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHV6 YY1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKJ0 YY1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKJ1 YY1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 8e-06
COG5048 467 COG5048, COG5048, FOG: Zn-finger [General function 6e-05
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 5e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 6e-04
COG5189423 COG5189, SFP1, Putative transcriptional repressor 9e-04
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
 Score = 46.6 bits (110), Expect = 8e-06
 Identities = 27/83 (32%), Positives = 39/83 (46%), Gaps = 4/83 (4%)

Query: 13  HVCAECGKAFVESSKLKRHQ--LVHTGE--KPFQCTFEGCGKRFSLDFNLRTHVRIHTGD 68
               +C  +F  SS L RH   + H+GE  KPF C +  CGK FS +  L+ H+ +HT  
Sbjct: 290 IKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSI 349

Query: 69  RPYVCPFDGCNKKFAQSTNLKSH 91
            P        + KF+   N +  
Sbjct: 350 SPAKEKLLNSSSKFSPLLNNEPP 372


Length = 467

>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 318
KOG2462|consensus279 99.83
KOG2462|consensus279 99.75
KOG1074|consensus958 99.41
KOG3576|consensus267 99.35
KOG3623|consensus1007 99.33
KOG3576|consensus267 99.23
KOG3623|consensus 1007 99.16
KOG3608|consensus467 99.1
KOG3608|consensus467 99.07
KOG1074|consensus958 98.77
PHA00733128 hypothetical protein 98.68
PLN03086567 PRLI-interacting factor K; Provisional 98.48
PHA00733128 hypothetical protein 98.44
PHA0276855 hypothetical protein; Provisional 98.41
KOG3993|consensus500 98.24
PHA0276855 hypothetical protein; Provisional 98.18
PLN03086567 PRLI-interacting factor K; Provisional 98.18
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.05
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 97.85
PHA0061644 hypothetical protein 97.71
PHA0073279 hypothetical protein 97.55
PHA0061644 hypothetical protein 97.42
KOG3993|consensus500 97.34
COG5189423 SFP1 Putative transcriptional repressor regulating 97.22
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.14
PHA0073279 hypothetical protein 97.12
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.86
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.85
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.8
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 96.72
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.51
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.5
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.36
COG5189423 SFP1 Putative transcriptional repressor regulating 96.24
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.76
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 95.72
smart0035526 ZnF_C2H2 zinc finger. 95.46
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 94.85
smart0035526 ZnF_C2H2 zinc finger. 94.14
COG5048467 FOG: Zn-finger [General function prediction only] 93.8
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 93.65
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 92.92
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 92.54
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 92.3
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 92.22
COG5048467 FOG: Zn-finger [General function prediction only] 92.0
KOG4173|consensus253 89.68
PRK04860160 hypothetical protein; Provisional 89.29
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 86.43
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 85.34
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 82.72
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 82.27
>KOG2462|consensus Back     alignment and domain information
Probab=99.83  E-value=2.2e-21  Score=177.35  Aligned_cols=107  Identities=37%  Similarity=0.761  Sum_probs=97.9

Q ss_pred             Chhchhhh----CCCcccCCccCcccccchhhhhhhhhhcCCCceecccCCCCCcccchhhhhhhhhhcCCCCceeccCC
Q psy16882          1 MRKHLHTH----GPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFD   76 (318)
Q Consensus         1 Lr~HlrtH----g~k~f~C~~Cgk~F~~~~~L~~H~~~H~~~kpy~C~~~~Cgk~F~~~~~L~~H~r~H~gekpf~C~~~   76 (318)
                      |.+|..+|    ..+.+.|++|++.|.+...|+.|+++|+  .+++|.+  |||.|.+.+.|+.|+|+|+|||||.|++ 
T Consensus       146 LsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~i--CGKaFSRPWLLQGHiRTHTGEKPF~C~h-  220 (279)
T KOG2462|consen  146 LSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGI--CGKAFSRPWLLQGHIRTHTGEKPFSCPH-  220 (279)
T ss_pred             cchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCccccc--ccccccchHHhhcccccccCCCCccCCc-
Confidence            67899999    5688999999999999999999999997  6789988  9999999999999999999999999987 


Q ss_pred             CCCcccCChhHHHHHHHHhcccccccccccCCCchhHHHhh
Q psy16882         77 GCNKKFAQSTNLKSHILTHAKAKLLKGLFSLKMCPHILDEM  117 (318)
Q Consensus        77 ~C~k~F~~~~~L~~H~r~H~~~k~~~c~~~C~~C~~~~~~~  117 (318)
                       |+|.|..+++|+.|++||.+.|.|    .|..|++.|.-|
T Consensus       221 -C~kAFADRSNLRAHmQTHS~~K~~----qC~~C~KsFsl~  256 (279)
T KOG2462|consen  221 -CGKAFADRSNLRAHMQTHSDVKKH----QCPRCGKSFALK  256 (279)
T ss_pred             -ccchhcchHHHHHHHHhhcCCccc----cCcchhhHHHHH
Confidence             999999999999999999999864    577888877643



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 6e-55
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-19
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-18
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 4e-17
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 5e-14
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 7e-14
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-13
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-13
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-13
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-13
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 4e-13
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-13
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-13
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 6e-13
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 2e-12
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 2e-12
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 4e-12
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 5e-12
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 1e-11
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 6e-10
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 8e-10
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-09
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-09
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 2e-09
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 3e-09
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 5e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 1e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-04
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-08
1znm_A28 A Zinc Finger With An Artificial Beta-Turn, Origina 2e-08
1un6_B87 The Crystal Structure Of A Zinc Finger - Rna Comple 2e-08
2j7j_A85 Invariance Of The Zinc Finger Module: A Comparison 3e-08
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 1e-07
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-07
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 4e-07
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 1e-06
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 1e-05
2eq2_A46 Solution Structure Of The 16th C2h2 Type Zinc Finge 3e-05
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 3e-05
2ytr_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-05
2dlk_A79 Solution Structure Of The First And The Second Zf-C 1e-04
2emm_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2yts_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2yth_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eor_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2emh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2emj_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2eq0_A46 Solution Structure Of The 8th C2h2 Type Zinc Finger 4e-04
2ep3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 6e-04
2emp_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2en1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
2emi_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 9e-04
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure

Iteration: 1

Score = 211 bits (536), Expect = 6e-55, Method: Compositional matrix adjust. Identities = 99/99 (100%), Positives = 99/99 (100%) Query: 1 MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT 60 MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT Sbjct: 23 MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT 82 Query: 61 HVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 99 HVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK Sbjct: 83 HVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 121
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1ZNM|A Chain A, A Zinc Finger With An Artificial Beta-Turn, Original Sequence Taken From The Third Zinc Finger Domain Of The Human Transcriptional Repressor Protein Yy1 (Ying And Yang 1, A Delta Transcription Factor), Nmr, 34 Structures Length = 28 Back     alignment and structure
>pdb|1UN6|B Chain B, The Crystal Structure Of A Zinc Finger - Rna Complex Reveals Two Modes Of Molecular Recognition Length = 87 Back     alignment and structure
>pdb|2J7J|A Chain A, Invariance Of The Zinc Finger Module: A Comparison Of The Free Structure With Those In Nucleic-Acid Complexes Length = 85 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2EQ2|A Chain A, Solution Structure Of The 16th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2YTR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 760- 792) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2DLK|A Chain A, Solution Structure Of The First And The Second Zf-C2h2 Domains Of Zinc Finger Protein 692 Length = 79 Back     alignment and structure
>pdb|2EMM|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 544- 576) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2YTS|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 715- 747) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YTH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 479- 511) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EOR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 255- 287) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EMH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 491- 523) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EMJ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 612- 644) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EQ0|A Chain A, Solution Structure Of The 8th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EP3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 631- 663) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2EMP|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 536- 568) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EN1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 563- 595) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EMI|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 547- 579) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query318
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-52
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-27
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-16
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-37
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-30
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-24
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-19
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-35
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-32
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-30
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-19
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-12
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-32
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-20
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-32
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-29
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-24
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-32
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-21
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-17
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-32
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-31
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-22
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-29
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-20
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-18
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-28
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-28
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-23
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-27
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-25
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-27
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-20
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-27
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-22
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-21
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-26
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-26
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-26
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-20
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-19
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-26
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-17
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-25
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-24
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-17
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-25
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-25
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-23
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-16
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-24
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-19
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-22
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-21
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-22
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-22
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-20
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-21
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-18
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-21
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-20
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-20
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-17
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-17
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-19
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-19
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-19
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-19
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-17
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-14
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-14
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-14
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-14
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 7e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-14
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-14
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-14
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-14
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-14
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-14
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-11
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 8e-14
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-14
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 9e-14
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-10
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-13
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-13
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-10
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-13
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-10
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-13
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-10
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-13
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-10
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-10
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-13
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-13
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-10
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-13
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-13
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-13
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-13
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-10
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-13
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-13
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-10
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-13
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-13
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-10
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-13
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-13
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-13
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-13
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-11
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 8e-13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 5e-11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-13
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-13
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-12
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-12
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-12
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-11
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-12
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-10
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-12
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-12
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-12
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-11
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-12
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-11
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-10
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 9e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-10
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-10
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-10
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-08
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 1e-09
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 5e-07
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 5e-09
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 3e-06
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 4e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-08
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 6e-07
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 7e-06
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 2e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 7e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 5e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 6e-05
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 9e-05
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 9e-04
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
 Score =  166 bits (423), Expect = 4e-52
 Identities = 99/99 (100%), Positives = 99/99 (100%)

Query: 1   MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT 60
           MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT
Sbjct: 23  MRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRT 82

Query: 61  HVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 99
           HVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK
Sbjct: 83  HVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAK 121


>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 47 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 47 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 32 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Length = 30 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.88
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.81
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.8
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.78
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.77
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.77
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.76
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.76
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.75
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.75
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.75
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.74
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.74
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.74
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.74
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.73
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.73
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.72
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.71
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.71
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.71
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.69
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.69
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.68
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.65
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.61
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.58
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.57
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.56
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.55
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.54
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.52
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.48
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.45
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.44
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.44
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.44
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.41
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.41
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.39
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.38
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.37
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.37
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.37
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.37
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.36
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.36
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.36
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.36
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.36
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.36
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.34
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.34
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.34
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.34
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.34
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.33
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.31
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.3
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.29
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.29
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.28
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.27
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.26
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.26
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.26
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.26
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.26
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.25
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.21
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.2
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.2
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.19
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.18
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.17
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.17
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.17
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.16
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.11
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.1
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.09
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.07
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.02
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.02
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.01
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.01
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.0
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.0
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.99
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.98
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.98
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.98
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.96
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.95
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.95
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.94
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.94
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.94
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.93
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.93
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.92
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.92
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.92
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.92
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.91
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.91
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.91
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.9
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.9
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.9
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.9
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.9
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.89
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.88
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.86
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.86
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.86
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.85
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.85
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.85
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.84
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.84
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.84
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.84
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.84
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.84
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.84
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.83
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.83
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.83
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.83
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.82
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.82
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.82
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.82
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.82
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.82
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.81
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.81
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.8
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.8
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.79
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.79
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.78
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.78
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.77
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.77
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.77
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.76
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.76
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.76
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.75
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.75
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.75
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.74
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.73
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.73
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.73
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.73
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.73
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.72
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.72
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.71
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.7
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.68
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.68
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.67
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.67
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.67
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.67
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.66
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.66
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.65
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.65
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.64
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.63
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.57
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.57
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.47
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.4
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.36
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.3
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.28
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.28
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.27
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.26
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.26
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.25
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.24
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.22
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.22
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.22
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.18
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.15
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.14
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.12
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.11
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.1
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.1
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.09
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.09
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.08
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.07
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.07
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.06
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.01
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.01
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.97
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.95
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.92
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.88
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.88
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.87
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.86
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.84
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.83
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.81
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.8
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.79
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.79
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.78
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.77
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.75
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.74
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.74
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.92
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.91
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.7
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.7
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.67
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.66
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.63
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.63
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.62
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.61
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.6
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.58
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.73
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.57
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.56
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.55
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.53
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.52
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.5
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.46
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.42
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.54
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.53
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.33
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.25
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.23
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.25
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.14
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.79
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 93.25
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 91.47
2e72_A49 POGO transposable element with ZNF domain; zinc fi 89.45
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 88.69
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 88.54
2e72_A49 POGO transposable element with ZNF domain; zinc fi 81.34
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.88  E-value=6.1e-24  Score=177.14  Aligned_cols=115  Identities=27%  Similarity=0.439  Sum_probs=104.5

Q ss_pred             chhhh-CCCcccCCccCcccccchhhhhhhhhhcCCCceecccCCCCCcccchhhhhhhhhhcCCCCceeccCCCCCccc
Q psy16882          4 HLHTH-GPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKF   82 (318)
Q Consensus         4 HlrtH-g~k~f~C~~Cgk~F~~~~~L~~H~~~H~~~kpy~C~~~~Cgk~F~~~~~L~~H~r~H~gekpf~C~~~~C~k~F   82 (318)
                      |.++| |+++|+|++|++.|.+...|..|+++|++++||.|..  |++.|.....|..|+++|+++++|.|++  |++.|
T Consensus        13 ~~~~h~Gek~y~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~~--C~k~F~~~~~L~~H~~~H~~~k~~~C~~--C~k~F   88 (133)
T 2lt7_A           13 YELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRY--CEKVFPLAEYRTKHEIHHTGERRYQCLA--CGKSF   88 (133)
T ss_dssp             EEEEETTEEEEEETTTCCEESCHHHHHHHHHHHHCCSCEECSS--SSCEESSHHHHHHHHHHHHTCCCEEESS--SCCEE
T ss_pred             ceeecCCCcCeECCCCCCCcCCHHHHHHHHHHcCCCCCeeCCc--cCeecccccchhhhccccCCCccccCCC--CCCCc
Confidence            44567 9999999999999999999999999999999999988  9999999999999999999999999977  99999


Q ss_pred             CChhHHHHHHHHhcccccccc--cccCCCchhHHHhhhhccC
Q psy16882         83 AQSTNLKSHILTHAKAKLLKG--LFSLKMCPHILDEMKRHDG  122 (318)
Q Consensus        83 ~~~~~L~~H~r~H~~~k~~~c--~~~C~~C~~~~~~~~~h~~  122 (318)
                      .+...|..|+++|++++++.+  .+.|..|+.++.+...|.+
T Consensus        89 ~~~~~L~~H~~~hh~~~p~~~~k~~~C~~C~k~~~~~~~h~~  130 (133)
T 2lt7_A           89 INYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYLS  130 (133)
T ss_dssp             SSHHHHHHHHHHHTCCCTTSSSCCEEECCCCSSCCCCCHHHH
T ss_pred             CCHHHHHHHhHHhcCCCCCCCCCCeecCCCCchhhhcccccc
Confidence            999999999999999888765  4789999988876665543



>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 318
d1ubdc228 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger 6e-12
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 1e-10
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-09
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 5e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-10
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-05
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 9e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 9e-09
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-07
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 9e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-08
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-08
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 8e-06
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 4e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.003
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 2e-08
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 4e-08
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 4e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 3e-08
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 7e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.003
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.001
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-06
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 2e-07
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 6e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 7e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-06
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 9e-06
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 4e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 8e-04
d1ubdc128 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger 2e-04
d1tf3a230 g.37.1.1 (A:41-70) Transcription factor IIIA, TFII 7e-04
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Ying-yang 1 (yy1, zinc finger domain)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 56.9 bits (137), Expect = 6e-12
 Identities = 28/28 (100%), Positives = 28/28 (100%)

Query: 11 RVHVCAECGKAFVESSKLKRHQLVHTGE 38
          RVHVCAECGKAFVESSKLKRHQLVHTGE
Sbjct: 1  RVHVCAECGKAFVESSKLKRHQLVHTGE 28


>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Length = 30 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query318
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.43
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.36
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.23
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.93
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.89
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.86
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.84
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.83
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.78
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.78
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.77
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.77
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.72
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.71
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.69
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.68
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.66
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.63
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.62
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.61
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.59
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.57
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.57
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.56
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.55
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.54
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.54
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.53
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.51
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.49
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.47
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.47
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.41
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.4
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.4
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.35
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.34
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.31
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.29
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.29
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.08
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.92
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.64
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.58
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.57
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.41
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.39
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.35
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.34
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.32
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.18
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.16
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.15
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.11
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.06
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.05
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.03
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.99
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.91
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.83
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.83
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.77
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.42
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.34
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.33
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 96.28
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.07
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.03
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.96
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.93
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.63
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.59
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.52
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 95.52
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.43
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 95.3
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.04
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.99
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.83
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 94.82
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 94.79
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 94.78
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 94.6
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.36
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 94.02
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.95
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.83
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.64
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.61
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.38
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 93.32
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.0
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.82
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.65
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 92.61
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 90.97
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 88.57
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 87.18
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 87.18
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 86.78
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 86.31
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 85.27
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 84.23
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 83.35
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 82.94
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 81.3
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 80.96
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 80.36
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.43  E-value=3e-14  Score=98.40  Aligned_cols=52  Identities=38%  Similarity=0.916  Sum_probs=26.9

Q ss_pred             CcccCCccCcccccchhhhhhhhhhcCCCceecccCCCCCcccchhhhhhhhhhc
Q psy16882         11 RVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIH   65 (318)
Q Consensus        11 k~f~C~~Cgk~F~~~~~L~~H~~~H~~~kpy~C~~~~Cgk~F~~~~~L~~H~r~H   65 (318)
                      +||+|+ ||+.|.....|..|+++|++++||.|..  |+++|.....|..|+++|
T Consensus         2 K~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~--C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           2 KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGV--CGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTT--TSCEESSSHHHHHHHTTT
T ss_pred             cCCCCC-CCCeECCHHHhHHHhhccccccCCcCCC--cCCEecCHHHHHHHHhcC
Confidence            455552 5555555555555555555555555544  555555555555555444



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure