Psyllid ID: psy168


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MILLGTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAITDWRTTTLISSVVPILAFAMILFLPESPTWLIYKGRMVDAEKSLRWLRGWSKKDKVMVEFEQLKVEWWMLRNR
ccHHHHHHHHHHccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcc
ccHHHHHHHHHHHEEEEEEcEEEHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcc
MILLGTIMLgagmgfcegpimsylgevceprirgsltllsgvsgnggaLGIFFLNAITDWRTTTLISSVVPILAFAMILflpesptwliykgrmvDAEKSLRWLRGWSKKDKVMVEFEQLKVEWWMLRNR
MILLGTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAITDWRTTTLISSVVPILAFAMILFLPESPTWLIYKGRMVDAEKSLrwlrgwskkdkvmVEFEqlkvewwmlrnr
MILLGTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAITDWRTTTLISSVVPILAFAMILFLPESPTWLIYKGRMVDAEKSLRWLRGWSKKDKVMVEFEQLKVEWWMLRNR
*ILLGTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAITDWRTTTLISSVVPILAFAMILFLPESPTWLIYKGRMVDAEKSLRWLRGWSKKDKVMVEFEQLKVEWWML***
MILLGTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAITDWRTTTLISSVVPILAFAMILFLPESPTWLIYKGRMVDAEKSLRWLRGWSKKDKVMVEFEQLKV*W******
MILLGTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAITDWRTTTLISSVVPILAFAMILFLPESPTWLIYKGRMVDAEKSLRWLRGWSKKDKVMVEFEQLKVEWWMLRNR
MILLGTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAITDWRTTTLISSVVPILAFAMILFLPESPTWLIYKGRMVDAEKSLRWLRGWSKKDKVMVEFEQLKVEWWMLRN*
iHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooo
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILLGTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAITDWRTTTLISSVVPILAFAMILFLPESPTWLIYKGRMVDAEKSLRWLRGWSKKDKVMVEFEQLKVEWWMLRNR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
A9ZSY2 502 Facilitated trehalose tra N/A N/A 0.946 0.245 0.358 3e-16
A9ZSY3 505 Facilitated trehalose tra N/A N/A 0.815 0.209 0.349 4e-15
B3MG58 866 Facilitated trehalose tra N/A N/A 0.815 0.122 0.339 7e-15
Q291H8 868 Facilitated trehalose tra no N/A 0.815 0.122 0.339 7e-15
B4GAP7 869 Facilitated trehalose tra N/A N/A 0.815 0.121 0.339 7e-15
Q17NV8 806 Facilitated trehalose tra N/A N/A 0.815 0.131 0.349 1e-14
B3NSE1 856 Facilitated trehalose tra N/A N/A 0.815 0.123 0.330 2e-14
B4P624 856 Facilitated trehalose tra N/A N/A 0.815 0.123 0.330 2e-14
B4J913 929 Facilitated trehalose tra N/A N/A 0.815 0.114 0.339 4e-14
B4KR05 863 Facilitated trehalose tra N/A N/A 0.815 0.122 0.339 4e-14
>sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 Back     alignment and function desciption
 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 70/131 (53%), Gaps = 8/131 (6%)

Query: 1   MILLGTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAITDW 60
           MIL+G  + G  +G     +  YLGE  +P +RGSL LL  V GN G L  F       W
Sbjct: 138 MILVGRSICGFCVGVASLSLPVYLGESIQPEVRGSLGLLPTVFGNSGILMCFTAGMYLAW 197

Query: 61  RTTTLISSVVPILAFAMILFLPESPTWLIYKGRMVDAEKSLRWLRGWSKK--------DK 112
           R   L+ + +PI+   ++  +PE+P W I KG++ +A KSL+WLRG +           K
Sbjct: 198 RNLALLGACIPIIFLILMFLIPETPRWYISKGKIKEARKSLQWLRGKTADISEELDSIQK 257

Query: 113 VMVEFEQLKVE 123
           + +E E++  E
Sbjct: 258 MHIESERIATE 268




Moderate-capacity facilitative transporter for trehalose. Does not transport maltose, sucrose or lactose. Mediates the bidirectional transfer of trehalose. Responsible for the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source, thereby regulating trehalose levels in the hemolymph.
Apis mellifera ligustica (taxid: 7469)
>sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 Back     alignment and function description
>sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 Back     alignment and function description
>sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
347965559 577 AGAP001236-PA [Anopheles gambiae str. PE 0.9 0.202 0.470 2e-24
157125518 570 sugar transporter [Aedes aegypti] gi|108 0.907 0.207 0.457 2e-24
170043906 566 sugar transporter [Culex quinquefasciatu 0.907 0.208 0.432 9e-23
291461573 507 sugar transporter 7 [Nilaparvata lugens] 0.869 0.222 0.451 2e-22
193669080 515 PREDICTED: facilitated trehalose transpo 0.969 0.244 0.436 3e-21
193697617 475 PREDICTED: facilitated trehalose transpo 0.892 0.244 0.422 5e-21
193688235 560 PREDICTED: facilitated trehalose transpo 0.915 0.212 0.420 7e-21
91082977 1252 PREDICTED: similar to sugar transporter 0.915 0.095 0.403 1e-20
270007037 1229 hypothetical protein TcasGA2_TC013484 [T 0.915 0.096 0.403 1e-20
328713668 502 PREDICTED: facilitated trehalose transpo 0.923 0.239 0.383 2e-20
>gi|347965559|ref|XP_321919.5| AGAP001236-PA [Anopheles gambiae str. PEST] gi|333470456|gb|EAA01784.5| AGAP001236-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 75/117 (64%)

Query: 5   GTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAITDWRTTT 64
             I+LG G+GF E PI++Y+GE+C+P IRG LT  +GV+   G   ++ L  +T WRTT 
Sbjct: 158 AAILLGLGVGFMEAPIVTYVGEICQPSIRGILTSCAGVAVMLGFFMVYLLGTVTTWRTTA 217

Query: 65  LISSVVPILAFAMILFLPESPTWLIYKGRMVDAEKSLRWLRGWSKKDKVMVEFEQLK 121
            I  V+PI     I F+PE+P WL+ K R  DA KSL+WLRGW     V  EF+++K
Sbjct: 218 AICGVIPIATMIAICFVPETPMWLLSKNRADDALKSLQWLRGWVSPKAVEQEFQEMK 274




Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157125518|ref|XP_001654366.1| sugar transporter [Aedes aegypti] gi|108873601|gb|EAT37826.1| AAEL010219-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170043906|ref|XP_001849608.1| sugar transporter [Culex quinquefasciatus] gi|167867183|gb|EDS30566.1| sugar transporter [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|291461573|dbj|BAI83421.1| sugar transporter 7 [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|193669080|ref|XP_001943832.1| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193697617|ref|XP_001943575.1| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193688235|ref|XP_001945235.1| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91082977|ref|XP_974017.1| PREDICTED: similar to sugar transporter [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270007037|gb|EFA03485.1| hypothetical protein TcasGA2_TC013484 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328713668|ref|XP_001950346.2| PREDICTED: facilitated trehalose transporter Tret1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
FB|FBgn0051100 716 CG31100 [Drosophila melanogast 0.869 0.157 0.398 7.2e-20
UNIPROTKB|A9ZSY2 502 Tret1 "Facilitated trehalose t 0.815 0.211 0.405 7.7e-17
UNIPROTKB|A9ZSY3 505 Tret1 "Facilitated trehalose t 0.923 0.237 0.327 7.4e-16
UNIPROTKB|A5LGM7 504 Tret1 "Facilitated trehalose t 0.892 0.230 0.364 1.5e-14
UNIPROTKB|B4MYA4 872 Tret1 "Facilitated trehalose t 0.807 0.120 0.373 6.1e-14
UNIPROTKB|B0WC46 517 Tret1 "Facilitated trehalose t 0.838 0.210 0.366 6.9e-14
FB|FBgn0033644 488 Tret1-2 "Trehalose transporter 0.907 0.241 0.316 7.9e-14
UNIPROTKB|Q17NV8 806 Tret1 "Facilitated trehalose t 0.838 0.135 0.375 8.9e-14
UNIPROTKB|Q291H8 868 Tret1 "Facilitated trehalose t 0.807 0.120 0.364 1.3e-13
UNIPROTKB|B4GAP7 869 Tret1 "Facilitated trehalose t 0.807 0.120 0.364 1.3e-13
FB|FBgn0051100 CG31100 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 246 (91.7 bits), Expect = 7.2e-20, P = 7.2e-20
 Identities = 45/113 (39%), Positives = 66/113 (58%)

Query:     8 MLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAITDWRTTTLIS 67
             + G G G  E P+++Y+ E+ EP+ RG L+ L       G    F L ++ DWR+   +S
Sbjct:   158 LAGLGGGLMEAPVLTYVAEITEPKYRGILSALGTTCVITGVFIQFILGSLMDWRSVAAVS 217

Query:    68 SVVPILAFAMILFLPESPTWLIYKGRMVDAEKSLRWLRGWSKKDKVMVEFEQL 120
             S  P++   M+ F+PESP WLI + R  +A KSL+WLRGW  +  +  EF QL
Sbjct:   218 SAFPVITIIMLCFVPESPVWLIREQRFREAVKSLQWLRGWVPEHMIEAEFNQL 270




GO:0016021 "integral to membrane" evidence=ISS
GO:0015145 "monosaccharide transmembrane transporter activity" evidence=ISS
GO:0015749 "monosaccharide transport" evidence=ISS
GO:0055085 "transmembrane transport" evidence=IEA
UNIPROTKB|A9ZSY2 Tret1 "Facilitated trehalose transporter Tret1" [Apis mellifera ligustica (taxid:7469)] Back     alignment and assigned GO terms
UNIPROTKB|A9ZSY3 Tret1 "Facilitated trehalose transporter Tret1" [Bombyx mori (taxid:7091)] Back     alignment and assigned GO terms
UNIPROTKB|A5LGM7 Tret1 "Facilitated trehalose transporter Tret1" [Polypedilum vanderplanki (taxid:319348)] Back     alignment and assigned GO terms
UNIPROTKB|B4MYA4 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila willistoni (taxid:7260)] Back     alignment and assigned GO terms
UNIPROTKB|B0WC46 Tret1 "Facilitated trehalose transporter Tret1" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
FB|FBgn0033644 Tret1-2 "Trehalose transporter 1-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q17NV8 Tret1 "Facilitated trehalose transporter Tret1" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|Q291H8 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms
UNIPROTKB|B4GAP7 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila persimilis (taxid:7234)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
pfam00083 449 pfam00083, Sugar_tr, Sugar (and other) transporter 1e-14
TIGR00879 481 TIGR00879, SP, MFS transporter, sugar porter (SP) 5e-13
TIGR00898 505 TIGR00898, 2A0119, cation transport protein 2e-07
PRK10077 479 PRK10077, xylE, D-xylose transporter XylE; Provisi 4e-05
>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
 Score = 68.9 bits (169), Expect = 1e-14
 Identities = 37/123 (30%), Positives = 61/123 (49%), Gaps = 7/123 (5%)

Query: 1   MILLGTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAITD- 59
           M+++G +++G G+G     +  Y+ E+   ++RG+L  L  +    G L    +    + 
Sbjct: 103 MLIVGRVIVGLGVGGISVLVPMYISEIAPKKLRGALGSLYQLGITFGILVAAIIGLGLNK 162

Query: 60  ------WRTTTLISSVVPILAFAMILFLPESPTWLIYKGRMVDAEKSLRWLRGWSKKDKV 113
                 WR    +  V  IL    +LFLPESP WL+ KG++ +A   L  LRG S  D+ 
Sbjct: 163 YSNSDGWRIPLGLQFVPAILLLIGLLFLPESPRWLVLKGKLEEARAVLAKLRGVSDVDQE 222

Query: 114 MVE 116
           + E
Sbjct: 223 IQE 225


Length = 449

>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
>gnl|CDD|233176 TIGR00898, 2A0119, cation transport protein Back     alignment and domain information
>gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
KOG0569|consensus 485 99.85
KOG0254|consensus 513 99.76
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.72
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.7
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.69
KOG0255|consensus 521 99.67
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.66
TIGR00898 505 2A0119 cation transport protein. 99.65
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.51
KOG0253|consensus 528 99.49
PRK10642 490 proline/glycine betaine transporter; Provisional 99.48
KOG2533|consensus 495 99.4
PRK09952 438 shikimate transporter; Provisional 99.38
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.35
PRK10642490 proline/glycine betaine transporter; Provisional 99.34
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.3
TIGR00891 405 2A0112 putative sialic acid transporter. 99.29
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.29
KOG2532|consensus 466 99.25
KOG0252|consensus 538 99.23
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.14
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.12
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.11
PRK15075 434 citrate-proton symporter; Provisional 99.1
TIGR00805 633 oat sodium-independent organic anion transporter. 99.1
PRK12307 426 putative sialic acid transporter; Provisional 99.1
TIGR00893 399 2A0114 d-galactonate transporter. 99.1
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.08
TIGR00895 398 2A0115 benzoate transport. 99.08
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.08
PRK03545 390 putative arabinose transporter; Provisional 99.03
PRK11663 434 regulatory protein UhpC; Provisional 99.01
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.0
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.99
KOG1330|consensus 493 98.98
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 98.95
PRK03893 496 putative sialic acid transporter; Provisional 98.95
PRK14995 495 methyl viologen resistance protein SmvA; Provision 98.94
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 98.91
PRK10091 382 MFS transport protein AraJ; Provisional 98.9
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 98.89
TIGR00880141 2_A_01_02 Multidrug resistance protein. 98.86
TIGR00900 365 2A0121 H+ Antiporter protein. 98.86
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 98.86
PTZ00207 591 hypothetical protein; Provisional 98.81
PRK10473 392 multidrug efflux system protein MdtL; Provisional 98.8
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 98.79
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 98.78
PRK12382 392 putative transporter; Provisional 98.78
PRK11010 491 ampG muropeptide transporter; Validated 98.77
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 98.76
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 98.75
PRK11195 393 lysophospholipid transporter LplT; Provisional 98.74
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 98.73
PRK05122 399 major facilitator superfamily transporter; Provisi 98.72
PRK11646 400 multidrug resistance protein MdtH; Provisional 98.71
PRK10504 471 putative transporter; Provisional 98.69
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 98.67
PRK11043 401 putative transporter; Provisional 98.65
PRK11652 394 emrD multidrug resistance protein D; Provisional 98.65
PRK10489 417 enterobactin exporter EntS; Provisional 98.65
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 98.64
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 98.63
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 98.62
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 98.62
PLN00028 476 nitrate transmembrane transporter; Provisional 98.61
PRK11902 402 ampG muropeptide transporter; Reviewed 98.59
PRK03699 394 putative transporter; Provisional 98.58
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 98.53
PRK09705 393 cynX putative cyanate transporter; Provisional 98.53
PRK09874 408 drug efflux system protein MdtG; Provisional 98.51
TIGR00901 356 2A0125 AmpG-related permease. 98.51
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 98.5
PRK10207 489 dipeptide/tripeptide permease B; Provisional 98.5
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.46
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 98.44
KOG2615|consensus 451 98.43
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 98.43
TIGR00889418 2A0110 nucleoside transporter. This family of prot 98.42
TIGR00892455 2A0113 monocarboxylate transporter 1. 98.37
TIGR00892 455 2A0113 monocarboxylate transporter 1. 98.37
PRK10133 438 L-fucose transporter; Provisional 98.32
KOG3764|consensus 464 98.32
PRK10054 395 putative transporter; Provisional 98.3
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.29
TIGR00897 402 2A0118 polyol permease family. This family of prot 98.25
PRK05122399 major facilitator superfamily transporter; Provisi 98.24
PRK15011 393 sugar efflux transporter B; Provisional 98.22
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 98.21
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 98.2
PRK09584 500 tppB putative tripeptide transporter permease; Rev 98.19
KOG3626|consensus 735 98.19
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 98.18
PRK15011393 sugar efflux transporter B; Provisional 98.15
TIGR00896 355 CynX cyanate transporter. This family of proteins 98.13
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 98.12
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 98.12
PRK10077479 xylE D-xylose transporter XylE; Provisional 98.07
PRK12382392 putative transporter; Provisional 98.03
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 98.03
TIGR00898505 2A0119 cation transport protein. 98.0
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 97.96
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 97.96
PRK03633 381 putative MFS family transporter protein; Provision 97.95
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 97.91
PRK09874408 drug efflux system protein MdtG; Provisional 97.91
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 97.87
PRK09528420 lacY galactoside permease; Reviewed 97.83
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 97.79
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 97.77
PRK10489417 enterobactin exporter EntS; Provisional 97.73
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 97.72
PRK09952438 shikimate transporter; Provisional 97.71
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 97.7
PRK09584500 tppB putative tripeptide transporter permease; Rev 97.7
KOG2325|consensus 488 97.68
TIGR00893399 2A0114 d-galactonate transporter. 97.66
PRK03633381 putative MFS family transporter protein; Provision 97.64
PRK15462 493 dipeptide/tripeptide permease D; Provisional 97.62
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 97.48
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 97.46
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 97.46
PRK11663434 regulatory protein UhpC; Provisional 97.45
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 97.36
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 97.35
PRK09705393 cynX putative cyanate transporter; Provisional 97.3
PRK03545390 putative arabinose transporter; Provisional 97.22
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 97.19
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 97.16
KOG0569|consensus485 97.12
TIGR00897402 2A0118 polyol permease family. This family of prot 97.09
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 97.09
KOG2504|consensus 509 97.08
PRK03893496 putative sialic acid transporter; Provisional 97.08
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 97.07
TIGR00788 468 fbt folate/biopterin transporter. The only functio 97.05
PRK11646400 multidrug resistance protein MdtH; Provisional 97.03
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 97.03
TIGR00891405 2A0112 putative sialic acid transporter. 97.0
TIGR00902382 2A0127 phenyl proprionate permease family protein. 96.98
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 96.98
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 96.97
TIGR00881379 2A0104 phosphoglycerate transporter family protein 96.96
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 96.92
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 96.9
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 96.82
PRK10504471 putative transporter; Provisional 96.81
TIGR00788468 fbt folate/biopterin transporter. The only functio 96.79
TIGR00895398 2A0115 benzoate transport. 96.77
TIGR00900365 2A0121 H+ Antiporter protein. 96.76
PRK11010491 ampG muropeptide transporter; Validated 96.76
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 96.7
COG0477 338 ProP Permeases of the major facilitator superfamil 96.7
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 96.68
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 96.66
PRK03699394 putative transporter; Provisional 96.64
PRK10054395 putative transporter; Provisional 96.64
PF05977524 MFS_3: Transmembrane secretion effector; InterPro: 96.6
PRK12307426 putative sialic acid transporter; Provisional 96.59
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 96.57
PRK11902402 ampG muropeptide transporter; Reviewed 96.54
PRK09528 420 lacY galactoside permease; Reviewed 96.53
PF13347 428 MFS_2: MFS/sugar transport protein 96.44
KOG0252|consensus538 96.3
PRK10207489 dipeptide/tripeptide permease B; Provisional 96.29
KOG2816|consensus 463 96.22
PRK09669 444 putative symporter YagG; Provisional 96.2
KOG0253|consensus528 96.19
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 96.12
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 96.07
PRK09848448 glucuronide transporter; Provisional 96.07
PRK10406432 alpha-ketoglutarate transporter; Provisional 96.01
PRK10213394 nepI ribonucleoside transporter; Reviewed 95.98
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 95.97
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 95.82
KOG2504|consensus509 95.74
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 95.73
PRK11462 460 putative transporter; Provisional 95.5
KOG3762|consensus618 95.48
PLN00028476 nitrate transmembrane transporter; Provisional 95.47
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 95.47
PRK15075434 citrate-proton symporter; Provisional 95.43
PRK15402406 multidrug efflux system translocase MdfA; Provisio 95.43
PRK11195393 lysophospholipid transporter LplT; Provisional 95.37
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 95.3
KOG0255|consensus521 95.26
PRK11652394 emrD multidrug resistance protein D; Provisional 95.21
PRK09669444 putative symporter YagG; Provisional 95.08
PRK10429473 melibiose:sodium symporter; Provisional 95.0
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 94.97
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 94.93
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 94.87
PRK15462493 dipeptide/tripeptide permease D; Provisional 94.86
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 94.69
PRK10429 473 melibiose:sodium symporter; Provisional 94.55
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 94.46
KOG2532|consensus466 94.46
KOG0254|consensus513 94.42
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 94.29
PRK14995495 methyl viologen resistance protein SmvA; Provision 94.16
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 94.16
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 94.11
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 93.89
KOG4686|consensus459 93.72
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 93.64
TIGR00901356 2A0125 AmpG-related permease. 93.6
COG2270438 Permeases of the major facilitator superfamily [Ge 93.55
COG2211 467 MelB Na+/melibiose symporter and related transport 93.25
PTZ00207591 hypothetical protein; Provisional 93.05
KOG2563|consensus 480 92.96
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 92.7
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 91.73
PRK10091382 MFS transport protein AraJ; Provisional 91.72
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 91.68
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 91.67
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 91.57
COG2807395 CynX Cyanate permease [Inorganic ion transport and 91.38
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 90.83
PRK11462460 putative transporter; Provisional 90.39
PRK11043401 putative transporter; Provisional 89.67
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 89.67
KOG3764|consensus464 89.62
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 89.56
PRK15403413 multidrug efflux system protein MdtM; Provisional 89.16
TIGR01272310 gluP glucose/galactose transporter. Disruption of 88.48
PRK09848 448 glucuronide transporter; Provisional 87.39
KOG2615|consensus451 87.28
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 86.78
TIGR00896355 CynX cyanate transporter. This family of proteins 86.11
PF13347428 MFS_2: MFS/sugar transport protein 84.1
TIGR00926654 2A1704 Peptide:H+ symporter (also transports b-lac 83.74
PF0664576 SPC12: Microsomal signal peptidase 12 kDa subunit 83.41
COG2211467 MelB Na+/melibiose symporter and related transport 83.18
TIGR00939437 2a57 Equilibrative Nucleoside Transporter (ENT). 83.1
KOG3098|consensus461 82.64
KOG1479|consensus406 82.36
>KOG0569|consensus Back     alignment and domain information
Probab=99.85  E-value=1.4e-20  Score=136.17  Aligned_cols=110  Identities=30%  Similarity=0.506  Sum_probs=100.9

Q ss_pred             ChHHHHHHHHhhhhcccchhhhhhhhccCCcchhHHHHHHHHHHHhHHHHHHHhhhhh------hhHHHHHHHHHHHHHH
Q psy168            1 MILLGTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAIT------DWRTTTLISSVVPILA   74 (130)
Q Consensus         1 ~l~~~R~l~G~~~g~~~~~~~~~~~e~~~~~~r~~~~~~~~~~~~~g~~~~~~~~~~~------~wr~~~~~~~~~~~~~   74 (130)
                      +++++|+++|+..|......+.|+.|++|.+.||....+.+++.++|.+++..++..-      .|++.+.+..++.++.
T Consensus       118 ~li~GR~i~Gl~~gl~~~~~pmyl~E~sP~~~RG~~g~~~~~~~~~g~ll~~~~~l~~ilGt~~~W~~l~~~~~i~~~~~  197 (485)
T KOG0569|consen  118 MLILGRLIVGLACGLSTGLVPMYLTEISPKNLRGALGTLLQIGVVIGILLGQVLGLPSLLGTEDLWPYLLAFPLIPALLQ  197 (485)
T ss_pred             HHHHHHHHHHHHhHHHHHHHHHHHhhcChhhhccHHHHHHHHHHHHHHHHHHHHccHHhcCCCcchHHHHHHHHHHHHHH
Confidence            3678999999999999999999999999999999999999999999999997764432      7999999999999999


Q ss_pred             HHHHhhcccchhHHHh-cCChHHHHHHHHHhhCCCCc
Q psy168           75 FAMILFLPESPTWLIY-KGRMVDAEKSLRWLRGWSKK  110 (130)
Q Consensus        75 ~~~~~~~pes~~~~~~-~~~~~~a~~~l~~~~~~~~~  110 (130)
                      .+..+++||||+|+.. |++.++|+++++.+++.+++
T Consensus       198 l~~l~~~PESPk~Ll~~k~~~~~A~~sl~~y~G~~~~  234 (485)
T KOG0569|consen  198 LALLPFLPESPKYLLIKKGDEEEARKALKFYRGKEDV  234 (485)
T ss_pred             HHHHhcCCCCcchHHHHcCCHHHHHHHHHHHhCCCcc
Confidence            9999999999999977 89999999999999998653



>KOG0254|consensus Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PF06645 SPC12: Microsomal signal peptidase 12 kDa subunit (SPC12); InterPro: IPR009542 This family consists of several microsomal signal peptidase 12 kDa subunit proteins Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>KOG1479|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
4gby_A 491 The Structure Of The Mfs (Major Facilitator Superfa 6e-05
>pdb|4GBY|A Chain A, The Structure Of The Mfs (Major Facilitator Superfamily) Proton:xylose Symporter Xyle Bound To D-Xylose Length = 491 Back     alignment and structure

Iteration: 1

Score = 42.7 bits (99), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 34/125 (27%), Positives = 55/125 (44%), Gaps = 12/125 (9%) Query: 7 IMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAI------TDW 60 I+ G G+G Y+ E+ IRG L + + G L ++ +N W Sbjct: 134 IIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVNYFIARSGDASW 193 Query: 61 RTTT-----LISSVVPILAFAMILF-LPESPTWLIYKGRMVDAEKSLRWLRGWSKKDKVM 114 T S +P L F M+L+ +PESP WL+ +G+ AE LR + G + + + Sbjct: 194 LNTDGWRYMFASECIPALLFLMLLYTVPESPRWLMSRGKQEQAEGILRKIMGNTLATQAV 253 Query: 115 VEFEQ 119 E + Sbjct: 254 QEIKH 258

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.78
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.15
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.12
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 98.96
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 98.88
2xut_A 524 Proton/peptide symporter family protein; transport 98.69
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 98.29
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 98.1
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 98.08
2xut_A524 Proton/peptide symporter family protein; transport 97.87
2cfq_A417 Lactose permease; transport, transport mechanism, 97.72
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 96.64
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 96.43
2cfq_A 417 Lactose permease; transport, transport mechanism, 95.88
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.78  E-value=1.2e-18  Score=125.15  Aligned_cols=106  Identities=26%  Similarity=0.454  Sum_probs=96.2

Q ss_pred             hHHHHHHHHhhhhcccchhhhhhhhccCCcchhHHHHHHHHHHHhHHHHHHHhhhhh------------hhHHHHHHHHH
Q psy168            2 ILLGTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAIT------------DWRTTTLISSV   69 (130)
Q Consensus         2 l~~~R~l~G~~~g~~~~~~~~~~~e~~~~~~r~~~~~~~~~~~~~g~~~~~~~~~~~------------~wr~~~~~~~~   69 (130)
                      ++++|+++|++.|+..+..+.+++|++|++.|++..++.+.++..|.++++.++...            .||+.+.+..+
T Consensus       129 l~~~R~l~G~g~G~~~~~~~~~i~E~~p~~~rg~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  208 (491)
T 4gc0_A          129 FVIYRIIGGIGVGLASMLSPMYIAELAPAHIRGKLVSFNQFAIIFGQLLVYCVNYFIARSGDASWLNTDGWRYMFASECI  208 (491)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTSCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCTTTTTTTHHHHHHHTTHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhCCHHhhhhhHHhhhhhhhhhhhhhhhcchhhccccccccccchhhHHHhhhhhh
Confidence            678999999999999999999999999999999999999999999999988876543            68888888888


Q ss_pred             HHHHHHHHHhhcccchhHHHhcCChHHHHHHHHHhhCC
Q psy168           70 VPILAFAMILFLPESPTWLIYKGRMVDAEKSLRWLRGW  107 (130)
Q Consensus        70 ~~~~~~~~~~~~pes~~~~~~~~~~~~a~~~l~~~~~~  107 (130)
                      +.++..+..++.||||+|+..+++.+++++.+++..+.
T Consensus       209 ~~~~~~~~~~~~peSp~~L~~~~~~~~a~~~l~~~~~~  246 (491)
T 4gc0_A          209 PALLFLMLLYTVPESPRWLMSRGKQEQAEGILRKIMGN  246 (491)
T ss_dssp             HHHHHHHHGGGSCCCHHHHHHTTCHHHHHHHHHHHHHH
T ss_pred             hhhhhhhhhhcCCCChHHHHHcCchhHHHHhHHHhcCC
Confidence            88888888899999999999999999999999887664



>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.05
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 98.42
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 97.89
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 94.47
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.05  E-value=3.5e-11  Score=83.08  Aligned_cols=85  Identities=15%  Similarity=0.185  Sum_probs=72.5

Q ss_pred             hHHHHHHHHhhhhcccchhhhhhhhccCCcchhHHHHHHHHHHHhHHHHHHHhhhhh-----hhHHHHHHHHHHHHHHHH
Q psy168            2 ILLGTIMLGAGMGFCEGPIMSYLGEVCEPRIRGSLTLLSGVSGNGGALGIFFLNAIT-----DWRTTTLISSVVPILAFA   76 (130)
Q Consensus         2 l~~~R~l~G~~~g~~~~~~~~~~~e~~~~~~r~~~~~~~~~~~~~g~~~~~~~~~~~-----~wr~~~~~~~~~~~~~~~   76 (130)
                      ++++|++.|++.|...+....+++|++|+++|++..++.+.+..+|..+++.+....     +||+.+++.+++..+..+
T Consensus       119 ~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~  198 (447)
T d1pw4a_         119 MFVLLFLCGWFQGMGWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAILVAL  198 (447)
T ss_dssp             HHHHHHHHHHHHHHTHHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhhhhhhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHHHHHH
Confidence            567999999999999999999999999999999999999999999998888765543     899999988877777665


Q ss_pred             -HHhhcccchh
Q psy168           77 -MILFLPESPT   86 (130)
Q Consensus        77 -~~~~~pes~~   86 (130)
                       .+.+.+++|.
T Consensus       199 ~~~~~~~~~~~  209 (447)
T d1pw4a_         199 FAFAMMRDTPQ  209 (447)
T ss_dssp             HHHHHCCCSST
T ss_pred             HHHHhcccchh
Confidence             6666666664



>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure