Psyllid ID: psy16923


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MFSRFKTKYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGIVHKEKKKFDVSLHPPPQPPEDHNVQLKVTPLVLCCNYWIVLEFV
cccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccc
ccccEccccHHHHHHHHcccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccccccccHccHHcHHHHHHHHHHccccccccccHccccEccccHHHHHEHHcccc
MFSRFKTKYRLKLHldthgetpygcphcpmklntrRTLRMHLVVhrdtkayqcvtcgksfrrskdlknhhnlhtgkrpytcpwcsrtfangsncrshkrrmhpeeLKLYESSLGIvhkekkkfdvslhpppqppedhnvqlkvTPLVLCCNYWIVLEFV
mfsrfktkYRLKlhldthgetpygcpHCPMKLNTRRTLRMHLVvhrdtkayqCVTCGKsfrrskdlknhhnlhtgkrpytcpwcsRTFANGSNCRSHKRRMHPEELKLYESSLGIVHKEKKKFDVSLHPPPQPpedhnvqlkVTPLVLCCNYWIVLEFV
MFSRFKTKYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGIVHKEKKKFDVSLHPPPQPPEDHNVQLKVTPLVLCCNYWIVLEFV
******TKYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANG***********************************************VQLKVTPLVLCCNYWIVLEF*
*FSRFKTKYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGIVHK*KKKFDVSLHPPPQPPEDHNVQLKVTPLVLCCNYWIVLEF*
MFSRFKTKYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGIVHKEKKKFDVSLHPPPQPPEDHNVQLKVTPLVLCCNYWIVLEFV
MFSRFKTKYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGIVHKEKKKFDVSLHPPPQPPEDHNVQLKVTPLVLCCNYWIV****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSRFKTKYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGIVHKEKKKFDVSLHPPPQPPEDHNVQLKVTPLVLCCNYWIVLEFV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query159 2.2.26 [Sep-21-2011]
Q9VJN5470 Zinc finger protein weckl no N/A 0.591 0.2 0.47 8e-20
Q5EBL2 1055 Zinc finger protein 628 O yes N/A 0.597 0.090 0.437 5e-18
Q8CJ78 1038 Zinc finger protein 628 O yes N/A 0.597 0.091 0.437 7e-16
Q7TNK3368 Zinc finger protein 24 OS no N/A 0.641 0.277 0.388 9e-16
Q91VN1368 Zinc finger protein 24 OS no N/A 0.641 0.277 0.388 1e-15
Q5RAE6368 Zinc finger protein 24 OS yes N/A 0.641 0.277 0.388 1e-15
P17028368 Zinc finger protein 24 OS no N/A 0.641 0.277 0.388 1e-15
Q3B7N9581 Myoneurin OS=Bos taurus G no N/A 0.691 0.189 0.369 3e-15
Q5JNZ3 666 Zinc finger protein 311 O no N/A 0.597 0.142 0.427 6e-15
Q80X44 710 Zinc finger and BTB domai no N/A 0.943 0.211 0.322 6e-15
>sp|Q9VJN5|WEK_DROME Zinc finger protein weckle OS=Drosophila melanogaster GN=wek PE=1 SV=1 Back     alignment and function desciption
 Score = 96.3 bits (238), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 59/100 (59%)

Query: 5   FKTKYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSK 64
           FK K RL++H  THGE  + C  C  KL TR  L  H  VH D + ++C  CG   + S 
Sbjct: 337 FKNKARLRVHSQTHGEPKFECNVCGKKLQTRAILNKHKYVHTDERRFKCEVCGSGCKNST 396

Query: 65  DLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPE 104
            LK H   HTG RPY C +C + FA+ +NCRSHK + HPE
Sbjct: 397 ALKIHLLGHTGLRPYVCKYCGKAFASNTNCRSHKWKKHPE 436




Acts as an adapter to assemble/stabilize a Toll/wek/Myd88/tube complex; required for efficient recruitment of Myd88 to Toll. Dispensable for innate immune response; plays a minimal role, if any, in the immune defense against Gram-positive bacteria and fungi. Involved in dorsoventral axis determination.
Drosophila melanogaster (taxid: 7227)
>sp|Q5EBL2|ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens GN=ZNF628 PE=2 SV=2 Back     alignment and function description
>sp|Q8CJ78|ZN628_MOUSE Zinc finger protein 628 OS=Mus musculus GN=Znf628 PE=2 SV=2 Back     alignment and function description
>sp|Q7TNK3|ZNF24_RAT Zinc finger protein 24 OS=Rattus norvegicus GN=Znf24 PE=2 SV=1 Back     alignment and function description
>sp|Q91VN1|ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus GN=Znf24 PE=1 SV=1 Back     alignment and function description
>sp|Q5RAE6|ZNF24_PONAB Zinc finger protein 24 OS=Pongo abelii GN=ZNF24 PE=2 SV=1 Back     alignment and function description
>sp|P17028|ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens GN=ZNF24 PE=1 SV=4 Back     alignment and function description
>sp|Q3B7N9|MYNN_BOVIN Myoneurin OS=Bos taurus GN=MYNN PE=2 SV=1 Back     alignment and function description
>sp|Q5JNZ3|ZN311_HUMAN Zinc finger protein 311 OS=Homo sapiens GN=ZNF311 PE=2 SV=2 Back     alignment and function description
>sp|Q80X44|ZBT24_MOUSE Zinc finger and BTB domain-containing protein 24 OS=Mus musculus GN=Zbtb24 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
242025650 738 zinc finger protein, putative [Pediculus 0.685 0.147 0.781 2e-47
312379353 297 hypothetical protein AND_08820 [Anophele 0.710 0.380 0.619 8e-34
170049176 636 conserved hypothetical protein [Culex qu 0.591 0.147 0.594 3e-33
157134662 526 hypothetical protein AaeL_AAEL013154 [Ae 0.654 0.197 0.596 1e-32
158299706 433 AGAP009010-PA [Anopheles gambiae str. PE 0.685 0.251 0.6 1e-32
195112770 572 GI22252 [Drosophila mojavensis] gi|19391 0.660 0.183 0.572 1e-29
195054158 569 GH22499 [Drosophila grimshawi] gi|193895 0.647 0.181 0.583 2e-29
195395296 593 GJ10855 [Drosophila virilis] gi|19414298 0.716 0.192 0.547 2e-29
195499722 631 GE24700 [Drosophila yakuba] gi|194183168 0.622 0.156 0.583 3e-29
40882475 634 RE70312p [Drosophila melanogaster] 0.641 0.160 0.570 2e-28
>gi|242025650|ref|XP_002433237.1| zinc finger protein, putative [Pediculus humanus corporis] gi|212518778|gb|EEB20499.1| zinc finger protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 100/110 (90%)

Query: 5   FKTKYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSK 64
           FKTKYRLK+H+DTH ET Y CP C + LNTRRTLRMHL+VH+D KA+QC TCGK+F+RSK
Sbjct: 456 FKTKYRLKIHMDTHVETRYQCPVCTLTLNTRRTLRMHLLVHKDDKAFQCTTCGKAFKRSK 515

Query: 65  DLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLG 114
           DLKNH+NLHTG+RPYTCP+C RTFANGSNCRSHKRRMHPEELK+YE++L 
Sbjct: 516 DLKNHYNLHTGRRPYTCPFCQRTFANGSNCRSHKRRMHPEELKMYEAALA 565




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312379353|gb|EFR25654.1| hypothetical protein AND_08820 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|170049176|ref|XP_001854343.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167871059|gb|EDS34442.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157134662|ref|XP_001663336.1| hypothetical protein AaeL_AAEL013154 [Aedes aegypti] gi|108870396|gb|EAT34621.1| AAEL013154-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|158299706|ref|XP_319758.4| AGAP009010-PA [Anopheles gambiae str. PEST] gi|157013646|gb|EAA15157.4| AGAP009010-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195112770|ref|XP_002000945.1| GI22252 [Drosophila mojavensis] gi|193917539|gb|EDW16406.1| GI22252 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195054158|ref|XP_001993993.1| GH22499 [Drosophila grimshawi] gi|193895863|gb|EDV94729.1| GH22499 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195395296|ref|XP_002056272.1| GJ10855 [Drosophila virilis] gi|194142981|gb|EDW59384.1| GJ10855 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195499722|ref|XP_002097067.1| GE24700 [Drosophila yakuba] gi|194183168|gb|EDW96779.1| GE24700 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|40882475|gb|AAR96149.1| RE70312p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
FB|FBgn0037794634 CG6254 [Drosophila melanogaste 0.691 0.173 0.558 5.9e-30
FB|FBgn0032814607 CG10366 [Drosophila melanogast 0.691 0.181 0.536 1.4e-29
FB|FBgn0032763513 CG17568 [Drosophila melanogast 0.647 0.200 0.485 8.1e-24
FB|FBgn0001990470 wek "weckle" [Drosophila melan 0.628 0.212 0.47 4.3e-22
UNIPROTKB|H9KZ43371 H9KZ43 "Uncharacterized protei 0.805 0.345 0.371 9.2e-21
UNIPROTKB|H9L089327 H9L089 "Uncharacterized protei 0.597 0.290 0.447 1e-20
UNIPROTKB|H9L2R2315 H9L2R2 "Uncharacterized protei 0.597 0.301 0.447 1e-20
UNIPROTKB|H9L2R3356 H9L2R3 "Uncharacterized protei 0.597 0.266 0.447 1e-20
RGD|2323809 1039 Zfp628 "zinc finger protein 62 0.622 0.095 0.43 4.7e-20
ZFIN|ZDB-GENE-071004-59217 zgc:173620 "zgc:173620" [Danio 0.805 0.589 0.348 5.7e-20
FB|FBgn0037794 CG6254 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 338 (124.0 bits), Expect = 5.9e-30, P = 5.9e-30
 Identities = 62/111 (55%), Positives = 75/111 (67%)

Query:     5 FKTKYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSK 64
             FK   RLK+HLDTH    Y C  C +KL TRRT   H +VH DT+ ++C  CG +F+RSK
Sbjct:   459 FKNNARLKIHLDTHSAEIYECTVCGLKLKTRRTFNKHKLVHSDTRQFKCEVCGSAFKRSK 518

Query:    65 DLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGI 115
              LK H  LHTG RPY C +C R FANGSNCRSHKR+ HP+EL   E + G+
Sbjct:   519 TLKAHLILHTGIRPYKCNFCGRDFANGSNCRSHKRQAHPKELA-EEEARGV 568


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
FB|FBgn0032814 CG10366 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032763 CG17568 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0001990 wek "weckle" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZ43 H9KZ43 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H9L089 H9L089 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H9L2R2 H9L2R2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H9L2R3 H9L2R3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|2323809 Zfp628 "zinc finger protein 628" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-59 zgc:173620 "zgc:173620" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 159
KOG2462|consensus279 99.92
KOG2462|consensus279 99.9
KOG1074|consensus 958 99.74
KOG1074|consensus958 99.71
KOG3576|consensus267 99.67
KOG3576|consensus267 99.66
KOG3623|consensus 1007 99.63
KOG3623|consensus1007 99.59
KOG3608|consensus467 99.56
KOG3608|consensus467 99.54
PHA00733128 hypothetical protein 99.36
PLN03086567 PRLI-interacting factor K; Provisional 99.2
PHA00733128 hypothetical protein 99.16
PHA0276855 hypothetical protein; Provisional 99.07
PHA0276855 hypothetical protein; Provisional 99.06
PLN03086567 PRLI-interacting factor K; Provisional 98.91
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.87
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.8
PHA0061644 hypothetical protein 98.71
KOG3993|consensus500 98.62
KOG3993|consensus500 98.6
PHA0073279 hypothetical protein 98.52
PHA0061644 hypothetical protein 98.49
PHA0073279 hypothetical protein 98.41
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.26
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.17
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.08
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.05
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.04
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.99
COG5189423 SFP1 Putative transcriptional repressor regulating 97.91
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.91
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.89
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.86
COG5189423 SFP1 Putative transcriptional repressor regulating 97.81
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.79
smart0035526 ZnF_C2H2 zinc finger. 97.4
KOG1146|consensus 1406 97.16
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.16
smart0035526 ZnF_C2H2 zinc finger. 97.08
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.04
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.99
PRK04860160 hypothetical protein; Provisional 96.94
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.93
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.88
PRK04860160 hypothetical protein; Provisional 96.77
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.52
KOG4173|consensus253 96.48
KOG1146|consensus 1406 96.42
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.41
KOG2482|consensus423 96.2
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.01
KOG2893|consensus 341 95.88
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.56
KOG2482|consensus423 95.23
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.1
COG5048467 FOG: Zn-finger [General function prediction only] 94.32
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.15
KOG2231|consensus 669 94.14
KOG2231|consensus 669 94.06
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 94.05
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 93.71
COG404965 Uncharacterized protein containing archaeal-type C 93.19
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 93.07
KOG2186|consensus 276 92.38
COG5236 493 Uncharacterized conserved protein, contains RING Z 92.24
KOG2893|consensus 341 92.13
COG5236 493 Uncharacterized conserved protein, contains RING Z 90.88
COG404965 Uncharacterized protein containing archaeal-type C 90.71
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 90.64
PF09986214 DUF2225: Uncharacterized protein conserved in bact 90.39
COG5048467 FOG: Zn-finger [General function prediction only] 90.2
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 89.95
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 89.75
PF1371937 zinc_ribbon_5: zinc-ribbon domain 89.15
COG1592166 Rubrerythrin [Energy production and conversion] 88.68
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 88.55
KOG2785|consensus390 88.26
PRK06266178 transcription initiation factor E subunit alpha; V 88.16
PF1371736 zinc_ribbon_4: zinc-ribbon domain 87.99
PF15135278 UPF0515: Uncharacterised protein UPF0515 87.26
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 86.74
PF09986214 DUF2225: Uncharacterized protein conserved in bact 86.44
smart00531147 TFIIE Transcription initiation factor IIE. 86.3
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 85.83
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 85.53
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 84.29
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 83.68
KOG2186|consensus 276 83.11
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 83.06
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 82.83
PF04959214 ARS2: Arsenite-resistance protein 2; InterPro: IPR 82.33
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 81.8
PRK06266178 transcription initiation factor E subunit alpha; V 81.5
>KOG2462|consensus Back     alignment and domain information
Probab=99.92  E-value=1.1e-25  Score=155.01  Aligned_cols=117  Identities=30%  Similarity=0.547  Sum_probs=104.4

Q ss_pred             CCCCCHHHHHHHHHhh----CCCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhcCCCCC
Q psy16923          3 SRFKTKYRLKLHLDTH----GETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRP   78 (159)
Q Consensus         3 ~~f~~~~~l~~H~~~h----~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~   78 (159)
                      |.+.+.++|.+|.++|    ..+.+.|+.|++.|.+...|..|+++|.  -+++|.+||+.|.+...|+.|+|.|+|+||
T Consensus       138 k~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKP  215 (279)
T KOG2462|consen  138 KSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKP  215 (279)
T ss_pred             cccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCC
Confidence            5677888999999999    4788999999999999999999999997  688999999999999999999999999999


Q ss_pred             cccccCcccccCchhHHHhHHhhCCchhhhhhhccccccccccc
Q psy16923         79 YTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGIVHKEKKK  122 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~~~~~~~~~~~~~~  122 (159)
                      |.|+.|++.|.++++|+.|+++|-. .....|..|+..+....-
T Consensus       216 F~C~hC~kAFADRSNLRAHmQTHS~-~K~~qC~~C~KsFsl~Sy  258 (279)
T KOG2462|consen  216 FSCPHCGKAFADRSNLRAHMQTHSD-VKKHQCPRCGKSFALKSY  258 (279)
T ss_pred             ccCCcccchhcchHHHHHHHHhhcC-CccccCcchhhHHHHHHH
Confidence            9999999999999999999997654 447778887776664433



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>PF15135 UPF0515: Uncharacterised protein UPF0515 Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04959 ARS2: Arsenite-resistance protein 2; InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity [] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-15
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 6e-14
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 1e-11
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 3e-10
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-09
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 3e-09
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-09
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 5e-09
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 5e-09
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-09
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-09
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 6e-09
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-08
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-08
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 8e-08
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 6e-07
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-06
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 1e-06
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 2e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 4e-06
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 7e-06
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 9e-05
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 1e-05
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-05
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-05
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 5e-05
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 8e-05
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 4e-04
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 4e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 6e-04
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 6e-04
2eon_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 79.0 bits (193), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 40/96 (41%), Positives = 50/96 (52%), Gaps = 1/96 (1%) Query: 5 FKTKYRLKLHLDTH-GETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRS 63 F K L H TH GE PY CP C + R LR H H K Y C CGKSF + Sbjct: 59 FSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQL 118 Query: 64 KDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKR 99 L+ H HTG++PY CP C ++F+ N +H+R Sbjct: 119 AHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQR 154
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2EON|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 397- 429) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-20
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-14
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-20
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-15
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-18
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-18
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 7e-18
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-17
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-10
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-18
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-15
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-17
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-17
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-17
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-14
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-12
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-14
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-12
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-10
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-16
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-15
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-11
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-15
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-12
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-15
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-14
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-10
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-10
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-13
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-13
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-11
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-13
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-12
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 9e-12
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-10
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 8e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 5e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 8e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 8e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-04
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
 Score = 80.3 bits (199), Expect = 2e-20
 Identities = 35/99 (35%), Positives = 50/99 (50%), Gaps = 4/99 (4%)

Query: 5   FKTKYRLKLHLDTHGETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVT--CGKSFRR 62
           F+    ++ HL THG   + C  C         L+ H +VH   K +QC    CGK F  
Sbjct: 17  FRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSL 76

Query: 63  SKDLKNHHNLHTGKRPYTCPW--CSRTFANGSNCRSHKR 99
             +L+ H  +HTG RPY CP+  C++ FA  +N +SH  
Sbjct: 77  DFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHIL 115


>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.91
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.91
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.9
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.9
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.88
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.88
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.87
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.87
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.87
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.87
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.87
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.87
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.86
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.86
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.86
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.86
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.82
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.82
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.81
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.81
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.81
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.81
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.79
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.79
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.78
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.77
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.77
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.76
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.75
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.75
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.74
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.73
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.73
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.71
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.71
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.7
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.7
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.69
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.69
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.68
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.68
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.67
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.65
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.65
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.64
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.64
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.64
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.64
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.63
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.63
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.63
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.61
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.61
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.61
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.61
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.6
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.6
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.6
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.6
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.59
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.58
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.58
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.58
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.57
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.55
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.55
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.55
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.55
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.54
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.54
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.54
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.51
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.5
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.45
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.44
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.44
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.4
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.4
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.39
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.39
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.39
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.39
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.39
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.38
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.38
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.38
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.37
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.37
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.37
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.37
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.37
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.37
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.36
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.36
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.36
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.36
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.35
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.35
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.35
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.35
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.35
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.35
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.35
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.34
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.34
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.34
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.34
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.34
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.33
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.32
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.31
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.3
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.3
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.29
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.28
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.28
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.26
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.26
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.26
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.26
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.24
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.23
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.23
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.23
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.22
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.22
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.22
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.22
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.22
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.22
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.21
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.2
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.2
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.2
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.2
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.19
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.18
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.18
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.18
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.18
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.17
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.16
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.16
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.15
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.14
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.14
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.14
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.14
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.12
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.11
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.09
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.07
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.02
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.01
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.95
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.92
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.91
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.87
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.87
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.86
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.86
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.82
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.82
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.82
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.76
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.75
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.71
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.68
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.68
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.68
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.68
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.65
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.61
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.59
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.57
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.57
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.56
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.56
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.52
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.52
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.51
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.49
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.49
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.49
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.48
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.48
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.48
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.46
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.45
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.44
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.44
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.44
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.43
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.42
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.79
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.78
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.39
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.38
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.35
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.35
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.34
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.33
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.66
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.3
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.29
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.29
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.26
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.25
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.24
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.23
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.22
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.21
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.19
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.18
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.45
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.45
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.14
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.41
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.08
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.05
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.04
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.9
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.31
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.97
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.75
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.64
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.28
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.48
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.31
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.09
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 93.81
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.33
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 92.52
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.86
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 88.9
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 88.11
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 87.92
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 87.81
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 87.25
2k5c_A95 Uncharacterized protein PF0385; structural genomic 86.74
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 86.53
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 85.03
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 84.82
2ct5_A73 Zinc finger BED domain containing protein 1; DREF 84.63
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 82.72
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 81.77
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 81.27
2czr_A226 TBP-interacting protein; tata-binding protein (TBP 80.95
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
Probab=99.92  E-value=7.5e-25  Score=138.25  Aligned_cols=103  Identities=34%  Similarity=0.714  Sum_probs=97.1

Q ss_pred             CCCCCHHHHHHHHHhh-CCCcccCCCCcccCCCHHHHHHHHHh---cCCCCceeccccccccCCHHhHHhHHhhcCCCCC
Q psy16923          3 SRFKTKYRLKLHLDTH-GETPYGCPHCPMKLNTRRTLRMHLVV---HRDTKAYQCVTCGKSFRRSKDLKNHHNLHTGKRP   78 (159)
Q Consensus         3 ~~f~~~~~l~~H~~~h-~~~~~~C~~C~~~f~~~~~l~~H~~~---h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~   78 (159)
                      +.|.+...|..|++.| ++++|.|+.|++.|.+...|..|++.   +.+.++|.|..|++.|.+...|..|++.|+++++
T Consensus        15 ~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~   94 (124)
T 2dlq_A           15 KKFLSKYYLKVHNRKHTGEKPFECPKCGKCYFRKENLLEHEARNCMNRSEQVFTCSVCQETFRRRMELRLHMVSHTGEMP   94 (124)
T ss_dssp             CCCSSHHHHHHHHHHHSSCCSCBCTTTCCBCSSHHHHHHHHHHCCCCSCCCCEECSSSCCEESSHHHHHHHHHHHSSSCS
T ss_pred             CcCCCHHHHHHHHHhCCCCCCeECCCCCchhcCHHHHHHHHhhhhcCCCCCCeECCCCCCccCCHHHHHHHHHHcCCCCC
Confidence            5789999999999999 79999999999999999999999986   5678999999999999999999999999999999


Q ss_pred             cccccCcccccCchhHHHhHHhhCCch
Q psy16923         79 YTCPWCSRTFANGSNCRSHKRRMHPEE  105 (159)
Q Consensus        79 ~~C~~C~~~f~~~~~l~~H~~~~h~~~  105 (159)
                      |.|.+|++.|.+...|..|++.+|.++
T Consensus        95 ~~C~~C~~~f~~~~~l~~H~~~~H~~~  121 (124)
T 2dlq_A           95 YKCSSCSQQFMQKKDLQSHMIKLHSGP  121 (124)
T ss_dssp             EECSSSCCEESSHHHHHHHHHHTSSCS
T ss_pred             ccCCCccchhCCHHHHHHHHHHHCCCC
Confidence            999999999999999999999888654



>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2ct5_A Zinc finger BED domain containing protein 1; DREF homolog, putative C-like transposable element, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.6 Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>2czr_A TBP-interacting protein; tata-binding protein (TBP), hyperthermophilic archaeon, Zn-finger motif, transcription; 2.30A {Thermococcus kodakarensis} SCOP: c.52.4.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 159
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 5e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.002
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.001
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.001
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.001
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.001
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 0.001
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.001
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.003
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.004
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 43.0 bits (102), Expect = 2e-07
 Identities = 10/34 (29%), Positives = 16/34 (47%)

Query: 73  HTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEEL 106
           H+G++PY C  C   F      + H  + H E +
Sbjct: 3   HSGEKPYECYICHARFTQSGTMKMHILQKHTENV 36


>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.73
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.7
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.38
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.29
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.27
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.27
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.27
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.25
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.24
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.24
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.23
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.22
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.21
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.19
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.16
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.15
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.12
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.07
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.03
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.01
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.01
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.0
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.99
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.96
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.96
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.94
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.88
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.87
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.86
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.84
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.75
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.74
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.72
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.68
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.68
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.66
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.63
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.6
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.56
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.54
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.48
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.47
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.46
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.34
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.28
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.25
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.16
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 98.06
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.03
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.0
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.98
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.95
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.89
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.89
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.86
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.84
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.8
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.79
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.77
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.75
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.7
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.65
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.64
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.63
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.63
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.6
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.53
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.47
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.46
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.45
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.36
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.35
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.26
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.21
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.11
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.07
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.06
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.06
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.03
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.03
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.97
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.91
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.8
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.76
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.74
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.63
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.53
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.5
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.45
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.42
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.33
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.57
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 95.54
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.49
d1y0jb136 U-shaped transcription factor, different fingers { 95.38
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.26
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.24
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.02
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 94.18
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.71
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.7
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.28
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.95
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 92.63
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.47
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 92.31
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.9
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 91.46
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 91.44
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.21
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 91.11
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 91.02
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 90.78
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 90.29
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 86.72
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 86.31
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 86.27
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 84.89
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 83.91
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 81.98
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 80.96
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.73  E-value=1.9e-18  Score=91.57  Aligned_cols=53  Identities=26%  Similarity=0.667  Sum_probs=35.1

Q ss_pred             CCcccCCCCcccCCCHHHHHHHHHhcCCCCceeccccccccCCHHhHHhHHhhc
Q psy16923         20 ETPYGCPHCPMKLNTRRTLRMHLVVHRDTKAYQCVTCGKSFRRSKDLKNHHNLH   73 (159)
Q Consensus        20 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h   73 (159)
                      |+||.| .||+.|....+|..|+++|++++||.|..|++.|.....|..|++.|
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            466666 36666666666666666666666666666666666666666666654



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure