Psyllid ID: psy16925


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MYLQHFLGIRAAGFRNASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGKIFLYGKMKNV
ccccccccHHHHHHHcccccccccccccccccccccHHHHHHcccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccHHcccccccccccccccccccccccccccccc
ccEEccccHHHHHHHHccccccccccccccccccccHHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccEccccccEEcccccccccccEccccHHHHHHHHccccccccccccccccccccHHHHHHHHHcccccccccccccccEccccEEEc
MYLQHFLGIRAAGFRNASTLGKYSLALMVTRfssrsavtahtkavhlgerpfvchecgqsfaskgilqehltihsddapwkcdicskkslklsnvscgwypdeskdlknhhnlhtgkrpytcpwcsrtfangsncrshkrrmhpeeLKLYESSLGKIFLYGKMKNV
MYLQHFLGIRAAGFRNASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFangsncrshkrrmhpeelklyesslgkiflygkmknv
MYLQHFLGIRAAGFRNASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGKIFLYGKMKNV
**LQHFLGIRAAGFRNASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGS**************KLYESSLGKIFLYG*****
MYLQHFLGIRAAGFRNASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGKIFLYGKMKN*
MYLQHFLGIRAAGFRNASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGKIFLYGKMKNV
MYLQHFLGIRAAGFRNASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGKIFLYGKMKN*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLQHFLGIRAAGFRNASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGKIFLYGKMKNV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query166 2.2.26 [Sep-21-2011]
Q14588 700 Zinc finger protein 234 O yes N/A 0.765 0.181 0.358 7e-17
P18715337 Gastrula zinc finger prot N/A N/A 0.710 0.350 0.353 1e-16
Q4V348 819 Zinc finger protein 658B no N/A 0.807 0.163 0.357 3e-16
Q5TYW1 1059 Zinc finger protein 658 O no N/A 0.753 0.118 0.372 3e-16
Q8TD23 568 Zinc finger protein 675 O no N/A 0.680 0.198 0.354 3e-16
Q9NYT6803 Zinc finger protein 226 O no N/A 0.650 0.134 0.376 3e-16
Q8BJ90317 Zinc finger protein 771 O no N/A 0.753 0.394 0.335 5e-16
P35789 620 Zinc finger protein 93 OS no N/A 0.783 0.209 0.317 6e-16
D3ZUU2707 GDNF-inducible zinc finge no N/A 0.644 0.151 0.354 6e-16
Q7L2R6523 Zinc finger protein 765 O no N/A 0.680 0.216 0.354 6e-16
>sp|Q14588|ZN234_HUMAN Zinc finger protein 234 OS=Homo sapiens GN=ZNF234 PE=2 SV=3 Back     alignment and function desciption
 Score = 86.3 bits (212), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 74/145 (51%), Gaps = 18/145 (12%)

Query: 32  FSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLK 91
           FS RS +T H K +H GE+P+ C ECG++F     LQEH  IH+ + P+KCD C K   +
Sbjct: 241 FSRRSTLTVHCK-LHSGEKPYNCEECGRAFIHASHLQEHQRIHTGEKPFKCDTCGKNFRR 299

Query: 92  LSNVS----------------CGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNC 135
            S ++                CG     S +L+ H  +HTG++PY C  C + F   S  
Sbjct: 300 RSALNNHCMVHTGEKPYKCEDCGKCFTCSSNLRIHQRVHTGEKPYKCEECGKCFIQPSQF 359

Query: 136 RSHKRRMHPEELKLYESSLGKIFLY 160
           ++H RR+H  E        GK F+Y
Sbjct: 360 QAH-RRIHTGEKPYVCKVCGKGFIY 383




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|P18715|ZG26_XENLA Gastrula zinc finger protein XlCGF26.1 (Fragment) OS=Xenopus laevis PE=3 SV=1 Back     alignment and function description
>sp|Q4V348|Z658B_HUMAN Zinc finger protein 658B OS=Homo sapiens GN=ZNF658B PE=2 SV=1 Back     alignment and function description
>sp|Q5TYW1|ZN658_HUMAN Zinc finger protein 658 OS=Homo sapiens GN=ZNF658 PE=2 SV=2 Back     alignment and function description
>sp|Q8TD23|ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens GN=ZNF675 PE=1 SV=3 Back     alignment and function description
>sp|Q9NYT6|ZN226_HUMAN Zinc finger protein 226 OS=Homo sapiens GN=ZNF226 PE=1 SV=2 Back     alignment and function description
>sp|Q8BJ90|ZN771_MOUSE Zinc finger protein 771 OS=Mus musculus GN=Znf771 PE=2 SV=1 Back     alignment and function description
>sp|P35789|ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens GN=ZNF93 PE=2 SV=4 Back     alignment and function description
>sp|D3ZUU2|GZF1_RAT GDNF-inducible zinc finger protein 1 OS=Rattus norvegicus GN=Gzf1 PE=3 SV=1 Back     alignment and function description
>sp|Q7L2R6|ZN765_HUMAN Zinc finger protein 765 OS=Homo sapiens GN=ZNF765 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
242025650 738 zinc finger protein, putative [Pediculus 0.759 0.170 0.491 4e-38
157134662 526 hypothetical protein AaeL_AAEL013154 [Ae 0.740 0.233 0.427 3e-28
170049176 636 conserved hypothetical protein [Culex qu 0.716 0.187 0.432 9e-28
158299706 433 AGAP009010-PA [Anopheles gambiae str. PE 0.807 0.309 0.361 2e-23
312379353 297 hypothetical protein AND_08820 [Anophele 0.897 0.501 0.343 1e-21
195053099 605 GH13825 [Drosophila grimshawi] gi|193900 0.753 0.206 0.341 1e-19
195433986 665 GK14921 [Drosophila willistoni] gi|19416 0.746 0.186 0.356 2e-19
195385012 622 GJ13556 [Drosophila virilis] gi|19414765 0.753 0.200 0.335 3e-19
194879352 583 GG21202 [Drosophila erecta] gi|190657410 0.801 0.228 0.327 1e-18
194760481 579 GF14427 [Drosophila ananassae] gi|190616 0.753 0.215 0.352 1e-18
>gi|242025650|ref|XP_002433237.1| zinc finger protein, putative [Pediculus humanus corporis] gi|212518778|gb|EEB20499.1| zinc finger protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 106/169 (62%), Gaps = 43/169 (25%)

Query: 31  RFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSD-------------- 76
           +F S+SAV+AH +AVH GERPFVC +CG SF SKGIL EHLTIHSD              
Sbjct: 398 KFCSKSAVSAHVRAVHFGERPFVCDQCGHSFTSKGILHEHLTIHSDVYNFHCKDCNKSFK 457

Query: 77  -------------DAPWKCDICS-----KKSLKL-----------SNVSCGWYPDESKDL 107
                        +  ++C +C+     +++L++              +CG     SKDL
Sbjct: 458 TKYRLKIHMDTHVETRYQCPVCTLTLNTRRTLRMHLLVHKDDKAFQCTTCGKAFKRSKDL 517

Query: 108 KNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGK 156
           KNH+NLHTG+RPYTCP+C RTFANGSNCRSHKRRMHPEELK+YE++L +
Sbjct: 518 KNHYNLHTGRRPYTCPFCQRTFANGSNCRSHKRRMHPEELKMYEAALAQ 566




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157134662|ref|XP_001663336.1| hypothetical protein AaeL_AAEL013154 [Aedes aegypti] gi|108870396|gb|EAT34621.1| AAEL013154-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170049176|ref|XP_001854343.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167871059|gb|EDS34442.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158299706|ref|XP_319758.4| AGAP009010-PA [Anopheles gambiae str. PEST] gi|157013646|gb|EAA15157.4| AGAP009010-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312379353|gb|EFR25654.1| hypothetical protein AND_08820 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|195053099|ref|XP_001993468.1| GH13825 [Drosophila grimshawi] gi|193900527|gb|EDV99393.1| GH13825 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195433986|ref|XP_002064987.1| GK14921 [Drosophila willistoni] gi|194161072|gb|EDW75973.1| GK14921 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195385012|ref|XP_002051202.1| GJ13556 [Drosophila virilis] gi|194147659|gb|EDW63357.1| GJ13556 [Drosophila virilis] Back     alignment and taxonomy information
>gi|194879352|ref|XP_001974223.1| GG21202 [Drosophila erecta] gi|190657410|gb|EDV54623.1| GG21202 [Drosophila erecta] Back     alignment and taxonomy information
>gi|194760481|ref|XP_001962468.1| GF14427 [Drosophila ananassae] gi|190616165|gb|EDV31689.1| GF14427 [Drosophila ananassae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
FB|FBgn0032814607 CG10366 [Drosophila melanogast 0.614 0.168 0.417 5.2e-20
UNIPROTKB|F1NL13333 F1NL13 "Uncharacterized protei 0.686 0.342 0.414 1.5e-19
UNIPROTKB|H9KZ43 371 H9KZ43 "Uncharacterized protei 0.680 0.304 0.370 7.2e-19
UNIPROTKB|H9L1N3 436 H9L1N3 "Uncharacterized protei 0.680 0.259 0.377 1.5e-18
UNIPROTKB|J9P857 927 J9P857 "Uncharacterized protei 0.795 0.142 0.368 1.7e-18
ZFIN|ZDB-GENE-110913-156308 si:dkey-179k24.6 "si:dkey-179k 0.680 0.366 0.354 1.7e-18
UNIPROTKB|H9L099407 ZNF599 "Uncharacterized protei 0.686 0.280 0.414 1.9e-18
UNIPROTKB|H9KZ11494 LOC100857852 "Uncharacterized 0.692 0.232 0.356 2.8e-18
UNIPROTKB|Q4V348 819 ZNF658B "Zinc finger protein 6 0.746 0.151 0.375 2.9e-18
UNIPROTKB|J9NYQ6 717 ZNF677 "Uncharacterized protei 0.807 0.186 0.350 3e-18
FB|FBgn0032814 CG10366 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 246 (91.7 bits), Expect = 5.2e-20, P = 5.2e-20
 Identities = 48/115 (41%), Positives = 65/115 (56%)

Query:    41 HTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKLSNVSCGWY 100
             H K  H     ++C ECG    S+  L  H  +H+D    KCD C ++  +         
Sbjct:   409 HHKETH-DPHKYICPECGMQLNSRTTLNRHRLVHTDQMQHKCDYCGREFKR--------- 458

Query:   101 PDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLG 155
                +K LKNH  LHTG +PY+C +C RTFANGSNCR+HK++ HPEEL   E++ G
Sbjct:   459 ---AKALKNHLILHTGLKPYSCDFCDRTFANGSNCRTHKKKSHPEELAAQEAAGG 510


GO:0005634 "nucleus" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IDA
UNIPROTKB|F1NL13 F1NL13 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZ43 H9KZ43 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H9L1N3 H9L1N3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9P857 J9P857 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-156 si:dkey-179k24.6 "si:dkey-179k24.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H9L099 ZNF599 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZ11 LOC100857852 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q4V348 ZNF658B "Zinc finger protein 658B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYQ6 ZNF677 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 166
KOG2462|consensus279 99.96
KOG2462|consensus279 99.9
KOG3623|consensus1007 99.84
KOG1074|consensus 958 99.83
KOG1074|consensus 958 99.72
KOG3623|consensus 1007 99.64
KOG3576|consensus267 99.63
KOG3576|consensus267 99.62
KOG3608|consensus 467 99.56
KOG3608|consensus467 99.5
KOG3993|consensus500 99.14
PLN03086567 PRLI-interacting factor K; Provisional 99.08
PLN03086567 PRLI-interacting factor K; Provisional 99.07
PHA00733128 hypothetical protein 99.06
PHA00733128 hypothetical protein 98.88
PHA0276855 hypothetical protein; Provisional 98.86
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.82
PHA0276855 hypothetical protein; Provisional 98.76
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.41
PHA0061644 hypothetical protein 98.32
PHA0073279 hypothetical protein 98.18
KOG3993|consensus500 98.1
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.98
PHA0073279 hypothetical protein 97.9
PHA0061644 hypothetical protein 97.87
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.85
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.83
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.81
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.76
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.53
COG5189423 SFP1 Putative transcriptional repressor regulating 97.37
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.34
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.27
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.27
COG5189423 SFP1 Putative transcriptional repressor regulating 97.18
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.97
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.94
smart0035526 ZnF_C2H2 zinc finger. 96.85
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.72
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.69
smart0035526 ZnF_C2H2 zinc finger. 96.63
KOG2231|consensus 669 96.27
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.16
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.97
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.96
KOG2893|consensus 341 95.77
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.72
PRK04860160 hypothetical protein; Provisional 95.61
PRK04860160 hypothetical protein; Provisional 94.78
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.26
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.21
COG5048467 FOG: Zn-finger [General function prediction only] 93.36
KOG1146|consensus 1406 92.96
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 92.84
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.81
KOG1146|consensus1406 90.49
COG404965 Uncharacterized protein containing archaeal-type C 89.79
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 89.45
PF1290740 zf-met2: Zinc-binding 89.1
COG404965 Uncharacterized protein containing archaeal-type C 88.18
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 88.07
KOG2893|consensus 341 86.46
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 86.45
KOG2785|consensus 390 85.58
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 84.92
COG5048467 FOG: Zn-finger [General function prediction only] 84.59
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 83.45
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 81.73
COG1592166 Rubrerythrin [Energy production and conversion] 81.45
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 81.25
PF1371937 zinc_ribbon_5: zinc-ribbon domain 80.45
>KOG2462|consensus Back     alignment and domain information
Probab=99.96  E-value=2.1e-30  Score=179.13  Aligned_cols=134  Identities=29%  Similarity=0.559  Sum_probs=119.2

Q ss_pred             cCCCCCccchhhhhhhcCChHHHHHHHHHhhcC---CCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCcccccc
Q psy16925         16 NASTLGKYSLALMVTRFSSRSAVTAHTKAVHLG---ERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKL   92 (166)
Q Consensus        16 ~~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~---~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~   92 (166)
                      +....+.|.|..|++.+.+.+.|.+|.+ .|-.   .+.+.|..|++.|..-..|..|+++|+  .+++|..||      
T Consensus       124 ~~~~~~r~~c~eCgk~ysT~snLsrHkQ-~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCG------  194 (279)
T KOG2462|consen  124 SAAKHPRYKCPECGKSYSTSSNLSRHKQ-THRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICG------  194 (279)
T ss_pred             ccccCCceeccccccccccccccchhhc-ccccccccccccCCCCCceeeehHHHhhHhhccC--CCccccccc------
Confidence            3445678999999999999999999988 5543   566999999999999999999999996  567777655      


Q ss_pred             ccccCCCcCCCchhHHHHhhhhcCCCCcccCcccccccCChhhhhhhhhhcchhHHHHHHHhhhhhhhhcccC
Q psy16925         93 SNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGKIFLYGKMKN  165 (166)
Q Consensus        93 ~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~f~~~~~~~  165 (166)
                            +.|...|.|+.|+|+|+|||||.|+.|+++|+.+++|+.|+++ |.+..+|.|..|+|.|.-..++|
T Consensus       195 ------KaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQT-HS~~K~~qC~~C~KsFsl~SyLn  260 (279)
T KOG2462|consen  195 ------KAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQT-HSDVKKHQCPRCGKSFALKSYLN  260 (279)
T ss_pred             ------ccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHHh-hcCCccccCcchhhHHHHHHHHH
Confidence                  5568999999999999999999999999999999999999997 77777999999999999888776



>KOG2462|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF12907 zf-met2: Zinc-binding Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 8e-16
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-12
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-10
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 3e-10
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-08
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-07
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 3e-07
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 3e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 3e-07
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 4e-07
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 4e-07
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-07
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-07
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 5e-07
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 9e-07
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 2e-06
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 4e-06
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 7e-06
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 1e-05
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-05
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-05
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-05
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 7e-05
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-04
2dlk_A79 Solution Structure Of The First And The Second Zf-C 3e-04
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 6e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 79.7 bits (195), Expect = 8e-16, Method: Compositional matrix adjust. Identities = 40/112 (35%), Positives = 60/112 (53%), Gaps = 14/112 (12%) Query: 29 VTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKK 88 ++ F S S+V A+ GE+P+ C ECG+SF+ L EH H+ + P+KC Sbjct: 1 ISEFGSSSSVAQ--AALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKC------ 52 Query: 89 SLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKR 140 CG + KDL H HTG++PY CP C ++F+ +N R+H+R Sbjct: 53 ------PECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQR 98
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2DLK|A Chain A, Solution Structure Of The First And The Second Zf-C2h2 Domains Of Zinc Finger Protein 692 Length = 79 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-19
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-14
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-13
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 8e-15
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-18
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-05
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-18
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-18
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-18
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-10
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-18
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-15
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-17
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-17
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-17
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-16
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-13
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-16
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-15
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-15
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-14
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-15
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-12
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-14
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-14
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-13
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-05
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-10
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-10
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 9e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 8e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 9e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 9e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 7e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 9e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 6e-04
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 9e-04
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
 Score = 78.4 bits (194), Expect = 3e-19
 Identities = 37/123 (30%), Positives = 57/123 (46%), Gaps = 23/123 (18%)

Query: 32  FSSRSAVTAH--TKAVHLGERPFVCHECG-----QSFASKGILQEHLTIHSDDAPWKCDI 84
           F S+  +  H  ++ +H   + FVCH  G     + F ++ +L  H+  H+ + P KC  
Sbjct: 13  FDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTF 72

Query: 85  --CSKKSLKLSNVSCGWYPDESKDLKNHHNLHTGKRPYTC--PWCSRTFANGSNCRSHKR 140
             C K   +L N            LK H   HTG++PY C    CS+ F+N S+   H+ 
Sbjct: 73  EGCRKSYSRLEN------------LKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQN 120

Query: 141 RMH 143
           R H
Sbjct: 121 RTH 123


>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.96
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.94
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.93
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.88
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.86
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.85
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.84
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.84
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.81
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.81
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.8
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.8
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.8
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.79
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.79
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.78
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.78
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.77
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.76
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.73
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.73
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.72
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.72
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.71
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.71
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.69
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.68
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.68
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.68
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.65
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.65
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.64
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.63
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.63
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.62
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.62
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.59
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.57
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.55
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.55
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.54
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.53
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.52
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.52
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.52
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.52
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.51
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.51
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.49
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.49
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.47
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.47
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.47
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.47
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.46
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.45
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.44
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.43
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.42
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.42
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.42
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.4
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.38
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.36
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.35
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.35
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.34
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.31
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.31
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.31
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.3
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.3
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.29
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.26
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.24
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.18
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.16
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.13
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.13
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.12
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.12
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.12
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.12
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.11
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.11
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.1
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.1
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.1
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.06
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.02
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.02
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.98
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.98
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.97
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.97
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.97
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.96
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.96
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.96
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.96
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.96
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.96
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.95
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.95
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.95
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.94
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.93
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.92
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.92
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.92
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.92
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.92
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.92
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.91
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.91
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.91
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.91
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.9
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.9
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.89
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.88
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.87
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.85
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.82
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.81
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.81
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.79
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.79
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.76
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.76
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.74
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.71
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.7
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.65
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.64
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.63
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.62
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.61
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.6
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.6
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.58
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.53
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.52
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.46
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.41
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.37
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.37
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.37
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.34
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.32
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.29
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.28
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.28
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.26
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.25
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.25
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.24
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.24
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.23
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.19
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.17
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.17
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.17
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.46
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.16
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.16
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.15
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.15
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.15
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.42
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.13
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.13
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.13
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.13
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.12
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.4
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.11
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.1
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.1
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.06
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.06
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.06
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.06
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.27
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.27
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.0
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.98
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.91
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.07
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.74
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.72
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.61
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.21
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.97
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 96.0
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.72
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.54
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.3
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.26
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.26
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.86
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.56
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 91.54
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.27
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 90.44
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 89.35
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 88.77
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 83.97
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 82.19
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 81.67
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.96  E-value=5.6e-31  Score=179.54  Aligned_cols=146  Identities=30%  Similarity=0.580  Sum_probs=119.1

Q ss_pred             CCCCCccchhhhhhhcCChHHHHHHHHHhhcCCCCeecccchhhcCChHHHHHHHhHcCCCCCccCCcCCcccccc----
Q psy16925         17 ASTLGKYSLALMVTRFSSRSAVTAHTKAVHLGERPFVCHECGQSFASKGILQEHLTIHSDDAPWKCDICSKKSLKL----   92 (166)
Q Consensus        17 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~~h~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~C~~~~~~~----   92 (166)
                      ......|.|++|++.|.....|..|++ .|.++++|.|..|++.|.....|..|++.|.++++|.|+.|++.|...    
T Consensus        16 ~~~~~~~~C~~C~~~f~~~~~l~~H~~-~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~   94 (190)
T 2i13_A           16 EPGEKPYACPECGKSFSRSDHLAEHQR-THTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLR   94 (190)
T ss_dssp             ---------------CCSSHHHHHGGG-CC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHH
T ss_pred             cCCCCCCcCCCCccccCCHHHHHHHHH-HcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHH
Confidence            344567999999999999999999987 789999999999999999999999999999999999999999999653    


Q ss_pred             ------------ccccCCCcCCCchhHHHHhhhhcCCCCcccCcccccccCChhhhhhhhhhcchhHHHHHHHhhhhhhh
Q psy16925         93 ------------SNVSCGWYPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEELKLYESSLGKIFLY  160 (166)
Q Consensus        93 ------------~c~~c~~~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~c~~c~~~f~~  160 (166)
                                  .|+.|++.|.....|..|++.|++++||.|+.|++.|.....|..|++. |.++.++.|+.|++.|..
T Consensus        95 ~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~-H~~~~~~~C~~C~~~f~~  173 (190)
T 2i13_A           95 AHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRT-HTGEKPYKCPECGKSFSR  173 (190)
T ss_dssp             HHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHH-HHCCCCEECTTTCCEESS
T ss_pred             HHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHh-cCCCCCeECCCCCCccCC
Confidence                        7999999999999999999999999999999999999999999999986 677789999999999987


Q ss_pred             hccc
Q psy16925        161 GKMK  164 (166)
Q Consensus       161 ~~~~  164 (166)
                      ...+
T Consensus       174 ~~~L  177 (190)
T 2i13_A          174 RDAL  177 (190)
T ss_dssp             HHHH
T ss_pred             HHHH
Confidence            7654



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 166
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 5e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.003
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.001
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.003
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 45.7 bits (109), Expect = 2e-08
 Identities = 10/34 (29%), Positives = 16/34 (47%)

Query: 114 HTGKRPYTCPWCSRTFANGSNCRSHKRRMHPEEL 147
           H+G++PY C  C   F      + H  + H E +
Sbjct: 3   HSGEKPYECYICHARFTQSGTMKMHILQKHTENV 36


>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.6
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.55
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.33
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.32
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.29
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.28
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.26
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.25
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.16
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.11
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.09
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.02
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.01
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.0
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.99
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.97
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.97
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.97
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.95
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.93
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.92
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.87
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.85
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.81
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.78
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.74
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.74
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.67
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.65
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.63
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.62
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.55
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.54
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.52
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.47
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.44
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.43
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.36
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.24
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.23
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.07
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.05
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.03
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.0
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.0
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.98
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.9
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.89
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.74
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.72
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.71
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.65
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.65
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.57
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.53
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.39
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.29
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.25
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.22
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.22
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.22
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.21
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.19
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.15
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.09
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.09
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.07
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.97
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.92
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.9
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.87
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.84
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.8
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.76
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.72
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.72
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.67
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.6
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.56
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.5
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.42
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.39
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.23
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.11
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.04
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.03
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.55
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.34
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.24
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.76
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.74
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.54
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.33
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.07
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.91
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 93.78
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.23
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.86
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 92.0
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 92.0
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 91.94
d1y0jb136 U-shaped transcription factor, different fingers { 91.27
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 91.17
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.73
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 90.48
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 90.19
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 89.04
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 88.85
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 88.38
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 85.59
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 85.45
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 84.33
d2ct5a160 Zinc finger BED domain-containing protein 1 {Human 81.44
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 80.58
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.60  E-value=2.7e-16  Score=83.49  Aligned_cols=42  Identities=24%  Similarity=0.470  Sum_probs=32.4

Q ss_pred             cCCCchhHHHHhhhhcCCCCcccCcccccccCChhhhhhhhh
Q psy16925        100 YPDESKDLKNHHNLHTGKRPYTCPWCSRTFANGSNCRSHKRR  141 (166)
Q Consensus       100 ~f~~~~~l~~H~~~h~~~~p~~C~~C~~~f~~~~~l~~H~~~  141 (166)
                      .|.....|..|+++|++++||.|++||++|...+.|..|++.
T Consensus        11 ~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~   52 (53)
T d2csha1          11 SFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKI   52 (53)
T ss_dssp             EESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTT
T ss_pred             eECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhc
Confidence            346677777787788888888888888888888888888765



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ct5a1 g.37.1.6 (A:8-67) Zinc finger BED domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure