Psyllid ID: psy16967


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MPLSLRRSKMIMNYVSKIGSCHRNPIHNEFFNRNYDFANHPNTPKPLLMRAREITDFIANIDSSEFAPYDKHIPPWSSVVPSIDTSLHSGKKDNVSPSVFQVQFLVNINTKYHDRILCFTDGSKTENSTSCAYTINKNVNSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFLLVTDSMSSLQAITSKSCNNALLSKIYSTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVQRNWQSSWNSVPNGNKLKTYRK
ccHHHHHHHHHHHHHHHHHccccccccHHHHcccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEccccccccccEEEEEcccccEEEccccccHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccc
ccHHHHHHHHHHHHHHHHHcccccccHHHHcccHHHHHcccccccccHHHHHHHHHHHccccccccccccccccccccccccEEEcccccccccccHHHHHHHHHHHHHHHccccEEEEEccccccccEEEEEEEcccccEcccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHccccccHHHHHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEccc
MPLSLRRSKMIMNYVSKigschrnpihneffnrnydfanhpntpkplLMRAREITDFIanidssefapydkhippwssvvpsidtslhsgkkdnvspsvFQVQFLVNINTKyhdrilcftdgsktenstscAYTINKNVNSFRLNVVNSVFSAELMAILLCLQnlkylpstkflLVTDSMSSLQAITSKSCNNALLSKIYSTWLDLVAcgkeisfmwcpshcgisgneavdvaaknpspsfpplklcsasdykpLIKKIVQRNWqsswnsvpngnklktyrk
MPLSLRRSKMIMNYVSKIGSCHRNPIHNEFFNRNYDFANHPNTPKPLLMRAREITDFIANIDSSEFAPYDKHIPPWSSVVPSIDTSLHsgkkdnvspsVFQVQFLVNINTKYHDRILCFTDGSKTENSTSCAYTINKNVNSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFLLVTDSMSSLQAITSKSCNNALLSKIYSTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVqrnwqsswnsvpngnklktyrk
MPLSLRRSKMIMNYVSKIGSCHRNPIHNEFFNRNYDFANHPNTPKPLLMRAREITDFIANIDSSEFAPYDKHIPPWSSVVPSIDTSLHSGKKDNVSPSVFQVQFLVNINTKYHDRILCFTDGSKTENSTSCAYTINKNVNSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFLLVTDSMSSLQAITSKSCNNALLSKIYSTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVQRNWQSSWNSVPNGNKLKTYRK
*********MIMNYVSKIGSCHRNPIHNEFFNRNYDFANHPNTPKPLLMRAREITDFIANIDSSEFAPYDKHIPPWSSVVPSI************SPSVFQVQFLVNINTKYHDRILCFTDGSKTENSTSCAYTINKNVNSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFLLVTDSMSSLQAITSKSCNNALLSKIYSTWLDLVACGKEISFMWCPSHCGISGNEAVDVA**********LKLCSASDYKPLIKKIVQRNWQSSW**************
MPLSLRRSKMIMNYVSKIGSCHRNPIHNEFFNR**************LMRAREITDFIANIDSSEFAPYDKHIPPWSSVVPSIDTSLHSGK***VSPSVFQVQFLVNINTKYHDRILCFTDGSKTENSTSCAYTINKNVNSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFLLVTDSMSSLQAITSKSCNNALLSKIYSTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVQRNWQSSWNSV***********
MPLSLRRSKMIMNYVSKIGSCHRNPIHNEFFNRNYDFANHPNTPKPLLMRAREITDFIANIDSSEFAPYDKHIPPWSSVVPSIDTSLHSGKKDNVSPSVFQVQFLVNINTKYHDRILCFTDGSKTENSTSCAYTINKNVNSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFLLVTDSMSSLQAITSKSCNNALLSKIYSTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVQRNWQSSWNSVPNGNKLKTYRK
MPLSLRRSKMIMNYVSKIGSCHRNPIHNEFFNRNYDFANHPNTPKPLLMRAREITDFIANIDSSEFAPYDKHIPPWSSVVPSIDTSLHSGKKDNVSPSVFQVQFLVNINTKYHDRILCFTDGSKTENSTSCAYTINKNVNSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFLLVTDSMSSLQAITSKSCNNALLSKIYSTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVQRNWQSSWNSVPNGNKLKTY**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLSLRRSKMIMNYVSKIGSCHRNPIHNEFFNRNYDFANHPNTPKPLLMRAREITDFIANIDSSEFAPYDKHIPPWSSVVPSIDTSLHSGKKDNVSPSVFQVQFLVNINTKYHDRILCFTDGSKTENSTSCAYTINKNVNSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFLLVTDSMSSLQAITSKSCNNALLSKIYSTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSPSFPPLKLCSASDYKPLIKKIVQRNWQSSWNSVPNGNKLKTYRK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query282 2.2.26 [Sep-21-2011]
Q77373 1435 Gag-Pol polyprotein OS=Hu yes N/A 0.258 0.050 0.367 0.0001
>sp|Q77373|POL_HV1AN Gag-Pol polyprotein OS=Human immunodeficiency virus type 1 group O (isolate ANT70) GN=gag-pol PE=3 SV=3 Back     alignment and function desciption
 Score = 47.0 bits (110), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 44/79 (55%), Gaps = 6/79 (7%)

Query: 153  AELMAILLCLQNLKYLPSTKFLLVTDSMSSLQAITSKSCNNALLSKIYSTWLDLVACGKE 212
            AELMAILL LQ+ K   +    +VTDS  +L  I+S+   +   S I    ++ +   ++
Sbjct: 1063 AELMAILLALQDSKETVN----IVTDSQYALGVISSQPTQSE--SPIVQQIIEELTKKEQ 1116

Query: 213  ISFMWCPSHCGISGNEAVD 231
            +   W P+H GI GNE +D
Sbjct: 1117 VYLTWVPAHKGIGGNEKID 1135




Integrase catalyzes viral DNA integration into the host chromosome, by performing a series of DNA cutting and joining reactions. This enzyme activity takes place after virion entry into a cell and reverse transcription of the RNA genome in dsDNA. The first step in the integration process is 3' processing. This step requires a complex comprising the viral genome, matrix protein, Vpr and integrase. This complex is called the pre-integration complex (PIC). The integrase protein removes 2 nucleotides from each 3' end of the viral DNA, leaving recessed CA OH's at the 3' ends. In the second step, the PIC enters cell nucleus. This process is mediated through integrase and Vpr proteins, and allows the virus to infect a non dividing cell. This ability to enter the nucleus is specific of lentiviruses, other retroviruses cannot and rely on cell division to access cell chromosomes. In the third step, termed strand transfer, the integrase protein joins the previously processed 3' ends to the 5' ends of strands of target cellular DNA at the site of integration. The 5'-ends are produced by integrase-catalyzed staggered cuts, 5 bp apart. A Y-shaped, gapped, recombination intermediate results, with the 5'-ends of the viral DNA strands and the 3' ends of target DNA strands remaining unjoined, flanking a gap of 5 bp. The last step is viral DNA integration into host chromosome. This involves host DNA repair synthesis in which the 5 bp gaps between the unjoined strands are filled in and then ligated. Since this process occurs at both cuts flanking the HIV genome, a 5 bp duplication of host DNA is produced at the ends of HIV-1 integration. Alternatively, Integrase may catalyze the excision of viral DNA just after strand transfer, this is termed disintegration.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 1EC: .EC: 1EC: 3EC: .EC: 2

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
125901787 1222 pol-like protein [Biomphalaria glabrata] 0.936 0.216 0.350 2e-30
443700898300 hypothetical protein CAPTEDRAFT_212630, 0.968 0.91 0.338 2e-27
443710566377 hypothetical protein CAPTEDRAFT_186063 [ 0.968 0.724 0.338 5e-27
443693558 502 hypothetical protein CAPTEDRAFT_189741, 0.836 0.470 0.336 4e-24
443734745252 hypothetical protein CAPTEDRAFT_216906 [ 0.829 0.928 0.342 2e-22
443723447225 hypothetical protein CAPTEDRAFT_187673 [ 0.765 0.96 0.340 2e-21
443713753266 hypothetical protein CAPTEDRAFT_215116 [ 0.826 0.875 0.315 2e-20
443695973261 hypothetical protein CAPTEDRAFT_23017, p 0.691 0.747 0.351 5e-19
427791321 1210 Putative tick transposon, partial [Rhipi 0.932 0.217 0.301 2e-18
427791807 1212 Putative tick transposon, partial [Rhipi 0.932 0.216 0.301 2e-18
>gi|125901787|gb|ABN58714.1| pol-like protein [Biomphalaria glabrata] Back     alignment and taxonomy information
 Score =  139 bits (349), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 138/277 (49%), Gaps = 13/277 (4%)

Query: 1    MPLSLRRSKMIMNYVSKIGSCHRNPIHNEFFN-RNYDFANH-PNTPKPLLMRARE----I 54
            +P+ +R  K+ M Y+ K+ S   NP  +  FN    +  N  PN  +PL +R RE    +
Sbjct: 841  LPMDIRMKKLAMQYIVKLKSNPTNPAFDSIFNPTEVELYNRRPNVIQPLGLRMREPIQNL 900

Query: 55   TDFIANIDSSEFAPYDKHIPPWSSVVPSIDTSLHSGKKDNVSPSVFQVQFLVNINTKYHD 114
            T  I  I   E  P +   PPW    P ++ SL + KK+N  PS+ QV F   +   Y D
Sbjct: 901  TQPIDQISKIE-TPQN---PPWLMNKPKLNLSLLNFKKENTDPSILQVHFR-ELQESYGD 955

Query: 115  RILCFTDGSKTENSTSCAYTINKNVNSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFL 174
                +TDGSK E   +CA +      S RL    S+F+AEL AILL L  +K    +KF+
Sbjct: 956  CGTIYTDGSKMEGKVACACSFRNKTISRRLPDGCSIFTAELHAILLALMAVKASERSKFI 1015

Query: 175  LVTDSMSSLQAITSKSCNNALLSKIYSTWLDLV-ACGKEISFMWCPSHCGISGNEAVDVA 233
            + +DS S+LQA+     +  L+ K     LDL+ A  ++++F+W PSH GI GNEA D  
Sbjct: 1016 ICSDSKSALQALGRMKTDIPLVHKSLKL-LDLITADRRDVTFIWVPSHVGIEGNEAADRE 1074

Query: 234  AKNPSPSFPPLKLCSASDYKPLIKKIVQRNWQSSWNS 270
            AK              SD +  I     R WQ+ W +
Sbjct: 1075 AKRALNHAVSGTQIPYSDLRQSIASATYREWQNRWEA 1111




Source: Biomphalaria glabrata

Species: Biomphalaria glabrata

Genus: Biomphalaria

Family: Planorbidae

Order:

Class: Gastropoda

Phylum: Mollusca

Superkingdom: Eukaryota

>gi|443700898|gb|ELT99633.1| hypothetical protein CAPTEDRAFT_212630, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|443710566|gb|ELU04776.1| hypothetical protein CAPTEDRAFT_186063 [Capitella teleta] Back     alignment and taxonomy information
>gi|443693558|gb|ELT94903.1| hypothetical protein CAPTEDRAFT_189741, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|443734745|gb|ELU18611.1| hypothetical protein CAPTEDRAFT_216906 [Capitella teleta] Back     alignment and taxonomy information
>gi|443723447|gb|ELU11866.1| hypothetical protein CAPTEDRAFT_187673 [Capitella teleta] Back     alignment and taxonomy information
>gi|443713753|gb|ELU06453.1| hypothetical protein CAPTEDRAFT_215116 [Capitella teleta] Back     alignment and taxonomy information
>gi|443695973|gb|ELT96755.1| hypothetical protein CAPTEDRAFT_23017, partial [Capitella teleta] Back     alignment and taxonomy information
>gi|427791321|gb|JAA61112.1| Putative tick transposon, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427791807|gb|JAA61355.1| Putative tick transposon, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
ASPGD|ASPL0000075333 486 AN10625 [Emericella nidulans ( 0.599 0.347 0.245 2e-05
ASPGD|ASPL0000075333 AN10625 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
 Score = 128 (50.1 bits), Expect = 2.0e-05, P = 2.0e-05
 Identities = 45/183 (24%), Positives = 78/183 (42%)

Query:   107 NINTKYHDRILCFTDGSKTENSTSCA-----YTINKNVNSFRLNVVNSVFSAELMAILLC 161
             NI  +    I  +TDGS        A     Y I+++ +       ++V+ AEL  ILL 
Sbjct:   174 NILNRAPRPIALYTDGSGINGRVGAAAICPKYLISRS-SYMGQQSESTVYVAELQGILLA 232

Query:   162 LQNLKYLPSTKFLLVTDSMSSLQAITSKSCNNA--LLSKIYSTWLDLVACGKEISFMWCP 219
             L  +        ++ TD+ ++LQA+ +    +   +L  I          G  + F W P
Sbjct:   233 LVIILQRQMQHAVIFTDNQATLQALRNPGSQSGQYILEAIIMALNKGRKAGLNVHFRWIP 292

Query:   220 SHCGISGNEAVDVAAKNPSPSFPPLK-----LCSASDYKPLIKKIVQRNWQSSWNSVPNG 274
             +H G+ GNE  D  AK  +  +  ++     +   S  K    ++V   W++ W S  +G
Sbjct:   293 AHRGVEGNEQADRRAKEAT-GWRRIRGHRGRMTIRSAVKRRAHEVVNARWENDWKSCHHG 351

Query:   275 NKL 277
              +L
Sbjct:   352 REL 354


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.318   0.131   0.403    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      282       282   0.00083  115 3  11 22  0.36    34
                                                     33  0.42    37


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  617 (66 KB)
  Total size of DFA:  229 KB (2125 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  23.95u 0.08s 24.03t   Elapsed:  00:00:37
  Total cpu time:  23.95u 0.08s 24.03t   Elapsed:  00:00:37
  Start:  Thu Aug 15 13:26:54 2013   End:  Thu Aug 15 13:27:31 2013


GO:0008150 "biological_process" evidence=ND
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004523 "ribonuclease H activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.260.691
3rd Layer3.1.26.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
cd09276128 cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI dom 3e-32
pfam00075126 pfam00075, RNase_H, RNase H 8e-19
cd06222123 cd06222, RNase_H, RNase H is an endonuclease that 1e-12
cd09273135 cd09273, RNase_HI_RT_Bel, Bel/Pao family of RNase 2e-07
cd09280150 cd09280, RNase_HI_eukaryote_like, Eukaryotic RNase 1e-05
COG0328154 COG0328, RnhA, Ribonuclease HI [DNA replication, r 3e-05
>gnl|CDD|187700 cd09276, Rnase_HI_RT_non_LTR, non-LTR RNase HI domain of reverse transcriptases Back     alignment and domain information
 Score =  115 bits (289), Expect = 3e-32
 Identities = 42/123 (34%), Positives = 60/123 (48%), Gaps = 5/123 (4%)

Query: 118 CFTDGSKTENSTSCAYTI---NKNVNSFRLNVVNSVFSAELMAILLCLQNLKYLPS--TK 172
            +TDGSK E  T   + I        S++L    SVF AEL+AIL  LQ          K
Sbjct: 2   IYTDGSKLEGRTGAGFAIVRKGTISRSYKLGPYCSVFDAELLAILEALQLALREGRRARK 61

Query: 173 FLLVTDSMSSLQAITSKSCNNALLSKIYSTWLDLVACGKEISFMWCPSHCGISGNEAVDV 232
             + +DS ++L+A+ S   ++ L+ +I     +L   G ++   W P H GI GNE  D 
Sbjct: 62  ITIFSDSQAALKALRSPRSSSPLVLRIRKAIRELANHGVKVRLHWVPGHSGIEGNERADR 121

Query: 233 AAK 235
            AK
Sbjct: 122 LAK 124


Ribonuclease H (RNase H) is classified into two families, type 1 (prokaryotic RNase HI, eukaryotic RNase H1 and viral RNase H) and type 2 (prokaryotic RNase HII and HIII, and eukaryotic RNase H2). Ribonuclease HI (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner. RNase H is widely present in various organisms, including bacteria, archaea and eukaryotes. RNase HI has also been observed as an adjunct domain to the reverse transcriptase gene in retroviruses, long-term repeat (LTR)-bearing retrotransposons and non-LTR retrotransposons. RNase HI in LTR retrotransposons perform degradation of the original RNA template, generation of a polypurine tract (the primer for plus-strand DNA synthesis), and final removal of RNA primers from newly synthesized minus and plus strands. The catalytic residues for RNase H enzymatic activity, three aspartatic acids and one glutamatic acid residue (DEDD), are unvaried across all RNase H domains. The position of the RNase domain of non-LTR and LTR transposons is at the carboxyl terminal of the reverse transcriptase (RT) domain and their RNase domains group together, indicating a common evolutionary origin. Many non-LTR transposons have lost the RNase domain because their activity is at the nucleus and cellular RNase may suffice; however LTR retotransposons always encode their own RNase domain because it requires RNase activity in RNA-protein particles in the cytoplasm. RNase H inhibitors have been explored as an anti-HIV drug target because RNase H inactivation inhibits reverse transcription. Length = 128

>gnl|CDD|215695 pfam00075, RNase_H, RNase H Back     alignment and domain information
>gnl|CDD|187690 cd06222, RNase_H, RNase H is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a sequence non-specific manner Back     alignment and domain information
>gnl|CDD|187697 cd09273, RNase_HI_RT_Bel, Bel/Pao family of RNase HI in long-term repeat retroelements Back     alignment and domain information
>gnl|CDD|187704 cd09280, RNase_HI_eukaryote_like, Eukaryotic RNase H is longer and more complex than their prokaryotic counterparts and unlike prokaryote, RNase H are essential in higher eukaryote Back     alignment and domain information
>gnl|CDD|223405 COG0328, RnhA, Ribonuclease HI [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 282
PF00075132 RNase_H: RNase H; InterPro: IPR002156 The RNase H 99.9
PRK06548161 ribonuclease H; Provisional 99.9
PRK08719147 ribonuclease H; Reviewed 99.9
COG0328154 RnhA Ribonuclease HI [DNA replication, recombinati 99.89
PRK00203150 rnhA ribonuclease H; Reviewed 99.88
cd06222130 RnaseH RNase H (RNase HI) is an endonuclease that 99.81
KOG3752|consensus371 99.77
PRK13907128 rnhA ribonuclease H; Provisional 99.76
PRK07708219 hypothetical protein; Validated 99.66
PRK07238 372 bifunctional RNase H/acid phosphatase; Provisional 99.55
PF1345687 RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EH 99.34
.; GO: 0004523 ribonuclease H activity" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF00336">PF00336245 DNA_pol_viral_C: DNA polymerase (viral) C-terminal 81.29
>PF00075 RNase_H: RNase H; InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site Back     alignment and domain information
Probab=99.90  E-value=4.5e-24  Score=170.42  Aligned_cols=117  Identities=33%  Similarity=0.471  Sum_probs=89.9

Q ss_pred             CceEEecCCCCCCC--CceEEEEEcCCe-eeeecCCCCchHHHHHHHHHHHHHHhhcCCCCeEEEEeCcHHHHHHHhc--
Q psy16967        114 DRILCFTDGSKTEN--STSCAYTINKNV-NSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFLLVTDSMSSLQAITS--  188 (282)
Q Consensus       114 ~~~~iyTDGS~~~~--~~G~gvv~~~~~-~~~~l~~~~s~~~AEl~AI~~AL~~~~~~~~~~i~I~sDS~~al~~l~~--  188 (282)
                      +.+.||||||+...  ..|+|+++..+. .+..++ ..+++.|||.||..||+.+ .  ...++|+|||++++..+..  
T Consensus         2 ~~~~iytDgS~~~~~~~~~~g~v~~~~~~~~~~~~-~~s~~~aEl~Ai~~AL~~~-~--~~~v~I~tDS~~v~~~l~~~~   77 (132)
T PF00075_consen    2 KAIIIYTDGSCRPNPGKGGAGYVVWGGRNFSFRLG-GQSNNRAELQAIIEALKAL-E--HRKVTIYTDSQYVLNALNKWL   77 (132)
T ss_dssp             TSEEEEEEEEECTTTTEEEEEEEEETTEEEEEEEE-SECHHHHHHHHHHHHHHTH-S--TSEEEEEES-HHHHHHHHTHH
T ss_pred             CcEEEEEeCCccCCCCceEEEEEEECCeEEEeccc-ccchhhhheehHHHHHHHh-h--cccccccccHHHHHHHHHHhc
Confidence            46899999998753  367776555444 555565 8899999999999999944 3  4999999999999998877  


Q ss_pred             ---CCCCc----hHHHHHHHHHHHHHhCCCceEEEecCCcCCC-cccHHHHHHhcCCC
Q psy16967        189 ---KSCNN----ALLSKIYSTWLDLVACGKEISFMWCPSHCGI-SGNEAVDVAAKNPS  238 (282)
Q Consensus       189 ---~~~~~----~~~~~i~~~~~~l~~~~~~v~~~WVpgH~gi-~gNe~AD~lAk~a~  238 (282)
                         .+...    ++..+|.+.   + ..+..|.|+|||||+|+ .||+.||+|||+|+
T Consensus        78 ~~~~~~~~~~~~~i~~~i~~~---~-~~~~~v~~~~V~~H~~~~~~N~~aD~lAk~a~  131 (132)
T PF00075_consen   78 HGNGWKKTSNGRPIKNEIWEL---L-SRGIKVRFRWVPGHSGVPQGNERADRLAKEAA  131 (132)
T ss_dssp             HHTTSBSCTSSSBHTHHHHHH---H-HHSSEEEEEESSSSSSSHHHHHHHHHHHHHHH
T ss_pred             cccccccccccccchhheeec---c-ccceEEeeeeccCcCCCchhHHHHHHHHHHhc
Confidence               33222    244555555   3 45789999999999999 69999999999763



This domain is a part of a large family of homologous RNase H enzymes of which the RNase HI protein from Escherichia coli is the best characterised []. Secondary structure predictions for the enzymes from E. coli, yeast, human liver and diverse retroviruses (such as Rous sarcoma virus and the Foamy viruses) supported, in every case, the five beta-strands (1 to 5) and four or five alpha-helices (A, B/C, D, E) that have been identified by crystallography in the RNase H domain of Human immunodeficiency virus 1 (HIV-1) reverse transcriptase and in E. coli RNase H []. Reverse transcriptase (RT) is a modular enzyme carrying polymerase and ribonuclease H (RNase H) activities in separable domains. Reverse transcriptase (RT) converts the single-stranded RNA genome of a retrovirus into a double-stranded DNA copy for integration into the host genome. This process requires ribonuclease H as well as RNA- and DNA-directed DNA polymerase activities. Retroviral RNase H is synthesised as part of the POL polyprotein that contains; an aspartyl protease, a reverse transcriptase, RNase H and integrase. POL polyprotein undergoes specific enzymatic cleavage to yield the mature proteins. Bacterial RNase H 3.1.26.4 from EC catalyses endonucleolytic cleavage to 5'-phosphomonoester acting on RNA-DNA hybrids. The 3D structure of the RNase H domain from diverse bacteria and retroviruses has been solved [, , ]. All have four beta strands and four to five alpha helices. The E. coli RNase H1 protein binds a single Mg2+ ion cofactor in the active site of the enzyme. The divalent cation is bound by the carboxyl groups of four acidic residues, Asp-10, Glu-48, Asp-70, and Asp-134 []. The first three acidic residues are highly conserved in all bacterial and retroviral RNase H sequences. ; GO: 0003676 nucleic acid binding, 0004523 ribonuclease H activity; PDB: 3LP3_B 2KW4_A 3P1G_A 1RIL_A 2RPI_A 4EQJ_G 4EP2_B 3OTY_P 3U3G_D 2ZQB_D ....

>PRK06548 ribonuclease H; Provisional Back     alignment and domain information
>PRK08719 ribonuclease H; Reviewed Back     alignment and domain information
>COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00203 rnhA ribonuclease H; Reviewed Back     alignment and domain information
>cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner Back     alignment and domain information
>KOG3752|consensus Back     alignment and domain information
>PRK13907 rnhA ribonuclease H; Provisional Back     alignment and domain information
>PRK07708 hypothetical protein; Validated Back     alignment and domain information
>PRK07238 bifunctional RNase H/acid phosphatase; Provisional Back     alignment and domain information
>PF13456 RVT_3: Reverse transcriptase-like; PDB: 3ALY_A 2EHG_A 3HST_B Back     alignment and domain information
>PF00336 DNA_pol_viral_C: DNA polymerase (viral) C-terminal domain; InterPro: IPR001462 This domain is at the C terminus of hepatitis B-type viruses P proteins and represents a functional domain that controls the RNase H activities of the protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
4b3o_A560 Structures Of Hiv-1 Rt And Rna-dna Complex Reveal A 3e-04
1lwf_A560 Crystal Structure Of A Mutant Hiv-1 Reverse Transcr 4e-04
1lwe_A560 Crystal Structure Of M41lT215Y MUTANT HIV-1 Reverse 5e-04
1rt3_A560 Azt Drug Resistant Hiv-1 Reverse Transcriptase Comp 5e-04
1lw0_A560 Crystal Structure Of T215y Mutant Hiv-1 Reverse Tra 5e-04
1s1t_A560 Crystal Structure Of L100i Mutant Hiv-1 Reverse Tra 5e-04
1s1x_A560 Crystal Structure Of V108i Mutant Hiv-1 Reverse Tra 5e-04
1lwc_A560 Crystal Structure Of M184v Mutant Hiv-1 Reverse Tra 5e-04
1rev_A560 Hiv-1 Reverse Transcriptase Length = 560 5e-04
3dm2_A560 Crystal Structure Of Hiv-1 K103n Mutant Reverse Tra 5e-04
1jle_A560 Crystal Structure Of Y188c Mutant Hiv-1 Reverse Tra 5e-04
3med_A560 Hiv-1 K103n Reverse Transcriptase In Complex With T 5e-04
1s1w_A560 Crystal Structure Of V106a Mutant Hiv-1 Reverse Tra 5e-04
2rki_A560 Crystal Structure Of Hiv-1 Reverse Transcriptase (R 5e-04
3ffi_A561 Hiv-1 Rt With Pyridone Non-Nucleoside Inhibitor Len 5e-04
3dlk_A556 Crystal Structure Of An Engineered Form Of The Hiv- 5e-04
2jle_A566 Novel Indazole Nnrtis Created Using Molecular Templ 6e-04
3di6_A561 Hiv-1 Rt With Pyridazinone Non-Nucleoside Inhibitor 6e-04
1s6p_A560 Crystal Structure Of Human Immunodeficiency Virus T 6e-04
1jkh_A560 Crystal Structure Of Y181c Mutant Hiv-1 Reverse Tra 6e-04
1qe1_A558 Crystal Structure Of 3tc-Resistant M184i Mutant Of 6e-04
3ig1_A555 Hiv-1 Reverse Transcriptase With The Inhibitor Beta 6e-04
1jlf_A560 Crystal Structure Of Y188c Mutant Hiv-1 Reverse Tra 6e-04
1hni_A558 Structure Of Hiv-1 Reverse Transcriptase In A Compl 6e-04
2ynf_A563 Hiv-1 Reverse Transcriptase Y188l Mutant In Complex 6e-04
3kjv_A560 Hiv-1 Reverse Transcriptase In Complex With Dna Len 6e-04
2rf2_A563 Hiv Reverse Transcriptase In Complex With Inhibitor 6e-04
3drs_A563 Hiv Reverse Transcriptase K103n Mutant In Complex W 6e-04
3qo9_A557 Crystal Structure Of Hiv-1 Reverse Transcriptase (R 6e-04
1hpz_A560 Human Immunodeficiency Virus Type 1 Length = 560 6e-04
4dg1_A549 Crystal Structure Of Hiv-1 Reverse Transcriptase (R 6e-04
3dmj_A560 Crystal Structure Of Hiv-1 V106a And Y181c Mutant R 6e-04
3qlh_A555 Hiv-1 Reverse Transcriptase In Complex With Manicol 6e-04
2zd1_A557 Crystal Structure Of Hiv-1 Reverse Transcriptase (R 6e-04
2i5j_A552 Crystal Structure Of Hiv-1 Reverse Transcriptase (R 6e-04
1dlo_A556 Human Immunodeficiency Virus Type 1 Length = 556 6e-04
3irx_A558 Crystal Structure Of Hiv-1 Reverse Transcriptase (R 7e-04
2ze2_A557 Crystal Structure Of L100iK103N MUTANT HIV-1 Revers 7e-04
1rdh_A146 Crystallographic Analyses Of An Active Hiv-1 Ribonu 7e-04
3drr_A563 Hiv Reverse Transcriptase Y181c Mutant In Complex W 7e-04
1hys_A553 Crystal Structure Of Hiv-1 Reverse Transcriptase In 7e-04
3kle_A562 Crystal Structure Of Azt-Resistant Hiv-1 Reverse Tr 7e-04
1hmv_A560 The Structure Of Unliganded Reverse Transcriptase F 7e-04
1n5y_A558 Hiv-1 Reverse Transcriptase Crosslinked To Post- Tr 7e-04
1hvu_A554 Human Immunodeficiency Virus Type 1 Reverse Transcr 7e-04
3klh_A564 Crystal Structure Of Azt-Resistant Hiv-1 Reverse Tr 7e-04
3jsm_A558 K65r Mutant Hiv-1 Reverse Transcriptase Cross-Linke 7e-04
2iaj_A560 Crystal Structure Of K103nY181C MUTANT HIV-1 Revers 7e-04
1uwb_A558 Tyr 181 Cys Hiv-1 Rt8-Cl Tibo Length = 558 7e-04
3hvt_A556 Structural Basis Of Asymmetry In The Human Immunode 7e-04
2vg5_A557 Crystal Structures Of Hiv-1 Reverse Transcriptase C 7e-04
3klf_A557 Crystal Structure Of Wild-Type Hiv-1 Reverse Transc 8e-04
3bgr_A557 Crystal Structure Of K103nY181C MUTANT HIV-1 Revers 9e-04
>pdb|4B3O|A Chain A, Structures Of Hiv-1 Rt And Rna-dna Complex Reveal A Unique Rt Conformation And Substrate Interface Length = 560 Back     alignment and structure

Iteration: 1

Score = 42.4 bits (98), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 30/117 (25%), Positives = 52/117 (44%), Gaps = 12/117 (10%) Query: 119 FTDGSKTENST--SCAYTINKNVNSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFLLV 176 + DG+ + + Y NK + EL AI L LQ+ + +V Sbjct: 441 YVDGAASRETKLGKAGYVTNKGRQKVVTLTDTTNQKTELQAIHLALQD----SGLEVNIV 496 Query: 177 TDSMSSLQAITSK--SCNNALLSKIYSTWLDLVACGKEISFMWCPSHCGISGNEAVD 231 TDS +L I ++ + L+++I ++ + +++ W P+H GI GNE VD Sbjct: 497 TDSQYALGIIQAQPDQSESELVNQI----IEQLIKKEKVYLAWVPAHKGIGGNEQVD 549
>pdb|1LWF|A Chain A, Crystal Structure Of A Mutant Hiv-1 Reverse Transcriptase (rtmq+m184v: M41l/d67n/k70r/m184v/t215y) In Complex With Nevirapine Length = 560 Back     alignment and structure
>pdb|1LWE|A Chain A, Crystal Structure Of M41lT215Y MUTANT HIV-1 Reverse Transcriptase (Rtmn) In Complex With Nevirapine Length = 560 Back     alignment and structure
>pdb|1RT3|A Chain A, Azt Drug Resistant Hiv-1 Reverse Transcriptase Complexed With 1051u91 Length = 560 Back     alignment and structure
>pdb|1LW0|A Chain A, Crystal Structure Of T215y Mutant Hiv-1 Reverse Transcriptase In Complex With Nevirapine Length = 560 Back     alignment and structure
>pdb|1S1T|A Chain A, Crystal Structure Of L100i Mutant Hiv-1 Reverse Transcriptase In Complex With Uc-781 Length = 560 Back     alignment and structure
>pdb|1S1X|A Chain A, Crystal Structure Of V108i Mutant Hiv-1 Reverse Transcriptase In Complex With Nevirapine Length = 560 Back     alignment and structure
>pdb|1LWC|A Chain A, Crystal Structure Of M184v Mutant Hiv-1 Reverse Transcriptase In Complex With Nevirapine Length = 560 Back     alignment and structure
>pdb|1REV|A Chain A, Hiv-1 Reverse Transcriptase Length = 560 Back     alignment and structure
>pdb|3DM2|A Chain A, Crystal Structure Of Hiv-1 K103n Mutant Reverse Transcriptase In Complex With Gw564511. Length = 560 Back     alignment and structure
>pdb|1JLE|A Chain A, Crystal Structure Of Y188c Mutant Hiv-1 Reverse Transcriptase Length = 560 Back     alignment and structure
>pdb|3MED|A Chain A, Hiv-1 K103n Reverse Transcriptase In Complex With Tmc125 Length = 560 Back     alignment and structure
>pdb|1S1W|A Chain A, Crystal Structure Of V106a Mutant Hiv-1 Reverse Transcriptase In Complex With Uc-781 Length = 560 Back     alignment and structure
>pdb|2RKI|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With A Triazole Derived Nnrti Length = 560 Back     alignment and structure
>pdb|3FFI|A Chain A, Hiv-1 Rt With Pyridone Non-Nucleoside Inhibitor Length = 561 Back     alignment and structure
>pdb|3DLK|A Chain A, Crystal Structure Of An Engineered Form Of The Hiv-1 Reverse Transcriptase, Rt69a Length = 556 Back     alignment and structure
>pdb|2JLE|A Chain A, Novel Indazole Nnrtis Created Using Molecular Template Hybridization Based On Crystallographic Overlays Length = 566 Back     alignment and structure
>pdb|3DI6|A Chain A, Hiv-1 Rt With Pyridazinone Non-Nucleoside Inhibitor Length = 561 Back     alignment and structure
>pdb|1S6P|A Chain A, Crystal Structure Of Human Immunodeficiency Virus Type 1 Reverse Transcriptase (Rt) In Complex With Janssen-R100943 Length = 560 Back     alignment and structure
>pdb|1JKH|A Chain A, Crystal Structure Of Y181c Mutant Hiv-1 Reverse Transcriptase In Complex With Dmp-266(Efavirenz) Length = 560 Back     alignment and structure
>pdb|1QE1|A Chain A, Crystal Structure Of 3tc-Resistant M184i Mutant Of Hiv-1 Reverse Transcriptase Length = 558 Back     alignment and structure
>pdb|3IG1|A Chain A, Hiv-1 Reverse Transcriptase With The Inhibitor Beta- Thujaplicinol Bound At The Rnase H Active Site Length = 555 Back     alignment and structure
>pdb|1JLF|A Chain A, Crystal Structure Of Y188c Mutant Hiv-1 Reverse Transcriptase In Complex With Nevirapine Length = 560 Back     alignment and structure
>pdb|1HNI|A Chain A, Structure Of Hiv-1 Reverse Transcriptase In A Complex With The Nonnucleoside Inhibitor Alpha-Apa R 95845 At 2.8 Angstroms Resolution Length = 558 Back     alignment and structure
>pdb|2YNF|A Chain A, Hiv-1 Reverse Transcriptase Y188l Mutant In Complex With Inhibitor Gsk560 Length = 563 Back     alignment and structure
>pdb|3KJV|A Chain A, Hiv-1 Reverse Transcriptase In Complex With Dna Length = 560 Back     alignment and structure
>pdb|2RF2|A Chain A, Hiv Reverse Transcriptase In Complex With Inhibitor 7e (Nnrti) Length = 563 Back     alignment and structure
>pdb|3DRS|A Chain A, Hiv Reverse Transcriptase K103n Mutant In Complex With Inhibitor R8d Length = 563 Back     alignment and structure
>pdb|3QO9|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With Tsao-T, A Non-Nucleoside Rt Inhibitor (Nnrti) Length = 557 Back     alignment and structure
>pdb|1HPZ|A Chain A, Human Immunodeficiency Virus Type 1 Length = 560 Back     alignment and structure
>pdb|4DG1|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) With Polymorphism Mutation K172a And K173a Length = 549 Back     alignment and structure
>pdb|3DMJ|A Chain A, Crystal Structure Of Hiv-1 V106a And Y181c Mutant Reverse Transcriptase In Complex With Gw564511 Length = 560 Back     alignment and structure
>pdb|3QLH|A Chain A, Hiv-1 Reverse Transcriptase In Complex With Manicol At The Rnase H Active Site And Tmc278 (rilpivirine) At The Nnrti Binding Pocket Length = 555 Back     alignment and structure
>pdb|2ZD1|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With Tmc278 (Rilpivirine), A Non-Nucleoside Rt Inhibitor Length = 557 Back     alignment and structure
>pdb|2I5J|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With Dhbnh, An Rnase H Inhibitor Length = 552 Back     alignment and structure
>pdb|1DLO|A Chain A, Human Immunodeficiency Virus Type 1 Length = 556 Back     alignment and structure
>pdb|3IRX|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase (Rt) In Complex With The Non-Nucleoside Rt Inhibitor (E)-S-Methyl 5-(1-(3,7-Dimethyl-2-Oxo-2, 3-Dihydrobenzo[d]oxazol-5-Yl)-5- (5-Methyl-1,3,4-Oxadiazol-2-Yl)pent-1-Enyl)-2-Methoxy-3- Methylbenzothioate. Length = 558 Back     alignment and structure
>pdb|2ZE2|A Chain A, Crystal Structure Of L100iK103N MUTANT HIV-1 Reverse Transcriptase (Rt) In Complex With Tmc278 (Rilpivirine), A Non-Nucleoside Rt Inhibitor Length = 557 Back     alignment and structure
>pdb|1RDH|A Chain A, Crystallographic Analyses Of An Active Hiv-1 Ribonuclease H Domain Show Structural Features That Distinguish It From The Inactive Form Length = 146 Back     alignment and structure
>pdb|3DRR|A Chain A, Hiv Reverse Transcriptase Y181c Mutant In Complex With Inhibitor R8e Length = 563 Back     alignment and structure
>pdb|1HYS|A Chain A, Crystal Structure Of Hiv-1 Reverse Transcriptase In Complex With A Polypurine Tract Rna:dna Length = 553 Back     alignment and structure
>pdb|3KLE|A Chain A, Crystal Structure Of Azt-Resistant Hiv-1 Reverse Transcriptase Crosslinked To A Dsdna With A Bound Excision Product, Aztppppa Length = 562 Back     alignment and structure
>pdb|1HMV|A Chain A, The Structure Of Unliganded Reverse Transcriptase From The Human Immunodeficiency Virus Type 1 Length = 560 Back     alignment and structure
>pdb|1N5Y|A Chain A, Hiv-1 Reverse Transcriptase Crosslinked To Post- Translocation Aztmp-Terminated Dna (Complex P) Length = 558 Back     alignment and structure
>pdb|1HVU|A Chain A, Human Immunodeficiency Virus Type 1 Reverse Transcriptase Complexed With A 33-Base Nucleotide Rna Pseudoknot Length = 554 Back     alignment and structure
>pdb|3KLH|A Chain A, Crystal Structure Of Azt-Resistant Hiv-1 Reverse Transcriptase Crosslinked To Post-Translocation Aztmp-Terminated Dna (Complex P) Length = 564 Back     alignment and structure
>pdb|3JSM|A Chain A, K65r Mutant Hiv-1 Reverse Transcriptase Cross-Linked To Ds-Dna And Complexed With Tenofovir-Diphosphate As The Incoming Nucleotide Substrate Length = 558 Back     alignment and structure
>pdb|2IAJ|A Chain A, Crystal Structure Of K103nY181C MUTANT HIV-1 Reverse Transcriptase (Rt) In Complex With Atp Length = 560 Back     alignment and structure
>pdb|1UWB|A Chain A, Tyr 181 Cys Hiv-1 Rt8-Cl Tibo Length = 558 Back     alignment and structure
>pdb|3HVT|A Chain A, Structural Basis Of Asymmetry In The Human Immunodeficiency Virus Type 1 Reverse Transcriptase Heterodimer Length = 556 Back     alignment and structure
>pdb|2VG5|A Chain A, Crystal Structures Of Hiv-1 Reverse Transcriptase Complexes With Thiocarbamate Non-Nucleoside Inhibitors Length = 557 Back     alignment and structure
>pdb|3KLF|A Chain A, Crystal Structure Of Wild-Type Hiv-1 Reverse Transcriptase Crosslinked To A Dsdna With A Bound Excision Product, Aztppppa Length = 557 Back     alignment and structure
>pdb|3BGR|A Chain A, Crystal Structure Of K103nY181C MUTANT HIV-1 Reverse Transcriptase (Rt) In Complex With Tmc278 (Rilpivirine), A Non-Nucleoside Rt Inhibitor Length = 557 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
3p1g_A165 Xenotropic murine leukemia virus-related virus (X 2e-08
2qkb_A154 Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy 1e-06
2kq2_A147 Ribonuclease H-related protein; PSI, NESG, protein 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
2zd1_A557 Reverse transcriptase/ribonuclease H; P51/P66, het 6e-05
1mu2_A555 HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym 3e-04
3qio_A150 GAG-POL polyprotein; RNAse H, inhibitor, nuclease, 4e-04
>3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A Length = 165 Back     alignment and structure
 Score = 51.8 bits (124), Expect = 2e-08
 Identities = 28/130 (21%), Positives = 44/130 (33%), Gaps = 18/130 (13%)

Query: 119 FTDGSKTENS--TSCAYTI---NKNVNSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKF 173
           +TDGS             +    + + +  L    S   AEL+A+   L+  +     K 
Sbjct: 27  YTDGSSFLQEGQRRAGAAVTTETEVIWARALPAGTSAQRAELIALTQALKMAE---GKKL 83

Query: 174 LLVTDSMSSLQAITSKSCNNALLSKIYSTW---LDLVACGKEISFMWCPSHCG-----IS 225
            + TDS  +       S       K  +     L  +   K +S + CP H         
Sbjct: 84  NVYTDSRYAFATAHVHSEGRE--IKNKNEILALLKALFLPKRLSIIHCPGHQKGNSAEAR 141

Query: 226 GNEAVDVAAK 235
           GN   D AA+
Sbjct: 142 GNRMADQAAR 151


>2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* Length = 154 Back     alignment and structure
>2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A Length = 147 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... Length = 557 Back     alignment and structure
>1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B Length = 555 Back     alignment and structure
>3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A Length = 150 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
2qkb_A154 Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy 99.92
3qio_A150 GAG-POL polyprotein; RNAse H, inhibitor, nuclease, 99.91
2kq2_A147 Ribonuclease H-related protein; PSI, NESG, protein 99.91
3h08_A146 RNH (ribonuclease H); RNAse H, 3D-structure, endon 99.91
1jl1_A155 Ribonuclease HI; RNAse HI, protein stability, ther 99.89
2e4l_A158 Ribonuclease HI, RNAse HI; hydrolase, endoribonucl 99.89
3p1g_A165 Xenotropic murine leukemia virus-related virus (X 99.89
1ril_A166 Ribonuclease H; hydrolase(endoribonuclease); 2.80A 99.88
2lsn_A165 Reverse transcriptase; RNAse H, viral protein; NMR 99.85
3u3g_D140 Ribonuclease H, RNAse H1; hydrolase, cleave the RN 99.84
3hst_B141 Protein RV2228C/MT2287; ribonuclease H1, RV2228C N 99.83
1mu2_A555 HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym 99.81
2ehg_A149 Ribonuclease HI; RNAse HI, hyperthermophilic archa 99.81
2zd1_A557 Reverse transcriptase/ribonuclease H; P51/P66, het 99.8
1zbf_A142 Ribonuclease H-related protein; RNAse H, RNA/DNA h 99.41
4htu_A134 Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine, 99.24
1rw3_A455 POL polyprotein; RNA and DNA dependent DNA polymer 85.06
>2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* Back     alignment and structure
Probab=99.92  E-value=5.6e-25  Score=179.94  Aligned_cols=127  Identities=24%  Similarity=0.295  Sum_probs=97.8

Q ss_pred             CCCceEEecCCCCCCCC-----ceEEEEEc-CCe--eeeecCCCCchHHHHHHHHHHHHHHhhcCCCCeEEEEeCcHHHH
Q psy16967        112 YHDRILCFTDGSKTENS-----TSCAYTIN-KNV--NSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFLLVTDSMSSL  183 (282)
Q Consensus       112 ~~~~~~iyTDGS~~~~~-----~G~gvv~~-~~~--~~~~l~~~~s~~~AEl~AI~~AL~~~~~~~~~~i~I~sDS~~al  183 (282)
                      ..+.+.||||||+..++     +|+||++. ++.  .+..+...+|++.|||.|++.||+.+...+..+|.|+|||++++
T Consensus         4 ~~~~~~iytDGs~~~n~~~~~~aG~Gvv~~~~~~~~~~~~l~~~~tn~~aEl~A~~~aL~~~~~~~~~~v~i~tDS~~vi   83 (154)
T 2qkb_A            4 MGDFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEIHAACKAIEQAKTQNINKLVLYTNSMFTI   83 (154)
T ss_dssp             ETTEEEEEEEEEEETTTSSSCEEEEEEECSTTCTTCEEEECCSSCCHHHHHHHHHHHHHHHHHHTTCCEEEEEESCHHHH
T ss_pred             CCCeEEEEEccCcCCCCCCCCcEEEEEEEECCCceeEEeecCCCCchHHHHHHHHHHHHHHHHhCCCceEEEEECcHHHH
Confidence            35679999999998643     68886653 322  45556557899999999999999999887789999999999999


Q ss_pred             HHHhcC--------CC-Cch---HHHHHHHHHHHHHhCCCceEEEecCCcCCCcccHHHHHHhcCCCC
Q psy16967        184 QAITSK--------SC-NNA---LLSKIYSTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPSP  239 (282)
Q Consensus       184 ~~l~~~--------~~-~~~---~~~~i~~~~~~l~~~~~~v~~~WVpgH~gi~gNe~AD~lAk~a~~  239 (282)
                      +.|..+        +. .++   ....+++.+..+.. +..|.|.|||||+|++||+.||+||++|+.
T Consensus        84 ~~i~~~~~~w~~~~w~~~~~~~~~n~~l~~~i~~l~~-~~~v~~~~V~~H~g~~~N~~AD~LA~~a~~  150 (154)
T 2qkb_A           84 NGITNWVQGWKKNGWKTSAGKEVINKEDFVALERLTQ-GMDIQWMHVPGHSGFIGNEEADRLAREGAK  150 (154)
T ss_dssp             HHHHTHHHHHHTTTSBCTTSSBCTTHHHHHHHHHHHT-TCEEEEEECCTTSSCHHHHHHHHHHHHHHT
T ss_pred             hhhhhhHHHHHhccccccCCCccccHHHHHHHHHHHc-CCceEEEEccCCCCCHhHHHHHHHHHHHHH
Confidence            999873        11 111   12344444444444 467999999999999999999999998863



>3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} SCOP: c.55.3.1 PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A Back     alignment and structure
>2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A Back     alignment and structure
>3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum} Back     alignment and structure
>1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 3aa4_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 3aa3_A 3aa2_A 3aa5_X 1rbv_A ... Back     alignment and structure
>2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis} PDB: 2zqb_A Back     alignment and structure
>3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A 4e89_A Back     alignment and structure
>1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A Back     alignment and structure
>2lsn_A Reverse transcriptase; RNAse H, viral protein; NMR {Simian foamy virus} Back     alignment and structure
>3u3g_D Ribonuclease H, RNAse H1; hydrolase, cleave the RNA strand of RNA/DNA hybrid; 1.40A {Uncultured organism} Back     alignment and structure
>3hst_B Protein RV2228C/MT2287; ribonuclease H1, RV2228C N-terminal domain, fusion protein, maltose binding protein, HYDR; HET: MLR TAR; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B Back     alignment and structure
>2ehg_A Ribonuclease HI; RNAse HI, hyperthermophilic archaeon, D stranded RNA-dependent RNAse, hydrolase; 1.60A {Sulfolobus tokodaii} PDB: 3aly_A Back     alignment and structure
>2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... Back     alignment and structure
>1zbf_A Ribonuclease H-related protein; RNAse H, RNA/DNA hybrid, DDE motif, hydrolase; 1.50A {Bacillus halodurans} SCOP: c.55.3.1 PDB: 1zbi_A 2g8u_A 2g8i_A 2g8h_A 2g8k_A 2g8f_A 2g8v_A 2g8w_A 3ey1_A* 1zbl_A 3d0p_A* 3i8d_A* 2r7y_A* Back     alignment and structure
>4htu_A Ribonuclease H, RNAse H; 5-chloro-2'-deoxyuridine, W-C base PAIR, wobble base PAIR, D helix; HET: DNA UCL; 1.49A {Bacillus halodurans} PDB: 3d0p_A* 4hue_A* 4huf_A* 4hug_A* 1zbf_A 1zbi_A 2g8u_A 3uld_A* 3ey1_A* 3twh_A* 2g8f_A 2g8v_A 2g8w_A 2g8i_A 2g8h_A 2g8k_A 3i8d_A* 2r7y_A* 1zbl_A Back     alignment and structure
>1rw3_A POL polyprotein; RNA and DNA dependent DNA polymerase, reverse transcriptase, transferase, replication; 3.00A {Moloney murine leukemia virus} SCOP: e.8.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 282
d1mu2a1126 c.55.3.1 (A:430-555) HIV RNase H (Domain of revers 4e-08
d1s1ta1110 c.55.3.1 (A:430-539) HIV RNase H (Domain of revers 3e-06
d1rila_147 c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermoph 4e-04
>d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} Length = 126 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: Ribonuclease H
domain: HIV RNase H (Domain of reverse transcriptase)
species: Human immunodeficiency virus type 2 [TaxId: 11709]
 Score = 48.8 bits (115), Expect = 4e-08
 Identities = 28/119 (23%), Positives = 49/119 (41%), Gaps = 8/119 (6%)

Query: 119 FTDGSKTENST--SCAYTINKNVNSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFLLV 176
           +TDGS    S      Y  ++  +  +     +   AEL A  + L +       K  ++
Sbjct: 11  YTDGSCNRQSKEGKAGYVTDRGKDKVKKLEQTTNQQAELEAFAMALTDSG----PKVNII 66

Query: 177 TDSMSSLQAITSKSCNNALLSKIYSTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAK 235
            DS   +  + S+   +   SKI +  ++ +   + I   W P+H GI GN+ VD    
Sbjct: 67  VDSQYVMGIVASQPTESE--SKIVNQIIEEMIKKEAIYVAWVPAHKGIGGNQEVDHLVS 123


>d1s1ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} Length = 110 Back     information, alignment and structure
>d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
d1mu2a1126 HIV RNase H (Domain of reverse transcriptase) {Hum 99.92
d1rila_147 RNase H (RNase HI) {Thermus thermophilus [TaxId: 2 99.88
d1jl1a_152 RNase H (RNase HI) {Escherichia coli [TaxId: 562]} 99.88
d1s1ta1110 HIV RNase H (Domain of reverse transcriptase) {Hum 99.77
d1zbfa1132 BH0863-like Ribonuclease H {Bacillus halodurans [T 99.53
>d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Ribonuclease H-like
family: Ribonuclease H
domain: HIV RNase H (Domain of reverse transcriptase)
species: Human immunodeficiency virus type 2 [TaxId: 11709]
Probab=99.92  E-value=1.2e-25  Score=175.99  Aligned_cols=117  Identities=21%  Similarity=0.357  Sum_probs=89.2

Q ss_pred             CCceEEecCCCCCCC-C-ceEEEEEcCCe-eeeecCCCCchHHHHHHHHHHHHHHhhcCCCCeEEEEeCcHHHHHHHhcC
Q psy16967        113 HDRILCFTDGSKTEN-S-TSCAYTINKNV-NSFRLNVVNSVFSAELMAILLCLQNLKYLPSTKFLLVTDSMSSLQAITSK  189 (282)
Q Consensus       113 ~~~~~iyTDGS~~~~-~-~G~gvv~~~~~-~~~~l~~~~s~~~AEl~AI~~AL~~~~~~~~~~i~I~sDS~~al~~l~~~  189 (282)
                      ++..++|||||+..+ + .|+|++...+. ....++ ..|++.|||.||++||+..    ...+.|+|||++++..+.+.
T Consensus         5 ~~~~t~YTDGS~~~n~~~~~~g~~~~~~~~~~~~~~-~~tnn~AEl~Ai~~al~~~----~~~i~I~tDS~~v~~~~~~~   79 (126)
T d1mu2a1           5 PGAETFYTDGSCNRQSKEGKAGYVTDRGKDKVKKLE-QTTNQQAELEAFAMALTDS----GPKVNIIVDSQYVMGIVASQ   79 (126)
T ss_dssp             TTCEEEEEEEEECTTTCCEEEEEEETTSCEEEEEES-SCCHHHHHHHHHHHHHHTS----CSEEEEEESCHHHHHHHHTC
T ss_pred             CCCcEEEEcCCCCCCCCcEEEEEEecCCCEEEEecC-CCcchHHHHHHHHHHhccC----CcceEEEechHHHHHHHhcC
Confidence            455799999998764 3 56666655444 444453 5799999999999999863    57899999999999999997


Q ss_pred             CCCch--HHHHHHHHHHHHHhCCCceEEEecCCcCCCcccHHHHHHhcCCC
Q psy16967        190 SCNNA--LLSKIYSTWLDLVACGKEISFMWCPSHCGISGNEAVDVAAKNPS  238 (282)
Q Consensus       190 ~~~~~--~~~~i~~~~~~l~~~~~~v~~~WVpgH~gi~gNe~AD~lAk~a~  238 (282)
                      ...+.  ....   .+..+.. ...|.|.|||||+|++|||.||+||++|.
T Consensus        80 ~~~~~~~~~~~---~~~~~~~-~~~v~~~wV~gH~g~~gNe~AD~LA~~ai  126 (126)
T d1mu2a1          80 PTESESKIVNQ---IIEEMIK-KEAIYVAWVPAHKGIGGNQEVDHLVSQGI  126 (126)
T ss_dssp             CSEESCHHHHH---HHHHHHH-CSEEEEEECCSSSCCTTHHHHHHHHHTTC
T ss_pred             CccccchHHHH---HHHHhhh-cceeEEEEEeCCCCCcchHHHHHHHHhhC
Confidence            65432  2222   2233433 46899999999999999999999999984



>d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s1ta1 c.55.3.1 (A:430-539) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d1zbfa1 c.55.3.1 (A:62-193) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure