Psyllid ID: psy16999

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MFDFRWSEVFRERIIAEVILLLFQVDPGSEELIVMSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQYRVKIIDSVRSYRVPNHALLL
ccccccccccccEEEEEEEEEEEEEccccccEEEEEEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHccccccccc
ccccccccccccEEEEEEEEEEEEccccccccEEEEEEEEEEccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcHHHHHcHHHcccccEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccEEc
mfdfrwseVFRERIIAEVILLLFqvdpgseeliVMSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLrennglkadkkklipfrdsKLTQIFQRSLSGLSSTVKMIVNvnaspayaeeTVQYRVKIIDSvrsyrvpnhalll
mfdfrwseVFRERIIAEVILLLFQVDPGSEELIVMSSFDICDLAGAERQkrahtsgdrlreartinsslHVLARCFNVLrennglkadkkklipfrdsKLTQIFQRslsglsstvKMIVNVNaspayaeetvQYRVKIIdsvrsyrvpnhalll
MFDFRWSEVFRERIIAEVILLLFQVDPGSEELIVMSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQYRVKIIDSVRSYRVPNHALLL
**DFRWSEVFRERIIAEVILLLFQVDPGSEELIVMSSFDICDLAG******************TINSSLHVLARCFNVLRENNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQYRVKIIDSVRSYRVP******
********VFRERIIAEVILLL************MSSFDICDLAGAERQ*******D**REARTINSSLHVLARCFNVLREN*********LIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQYRVKIIDSVRSYRVPNHALLL
MFDFRWSEVFRERIIAEVILLLFQVDPGSEELIVMSSFDICDLAGA************LREARTINSSLHVLARCFNVLRENNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQYRVKIIDSVRSYRVPNHALLL
********VFRERIIAEVILLLFQVDPGSEELIVMSSFDICDLAGAE*******SGDRLREARTINSSLHVLARCFNVLRENNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQYRVKIIDSVRSYRVPNHALLL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFDFRWSEVFRERIIAEVILLLFQVDPGSEELIVMSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQYRVKIIDSVRSYRVPNHALLL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query154 2.2.26 [Sep-21-2011]
P97329 887 Kinesin-like protein KIF2 yes N/A 0.616 0.107 0.489 5e-18
Q29RT6 888 Kinesin-like protein KIF2 yes N/A 0.616 0.106 0.479 1e-17
O95235 890 Kinesin-like protein KIF2 yes N/A 0.616 0.106 0.479 1e-17
Q02241 960 Kinesin-like protein KIF2 no N/A 0.655 0.105 0.442 5e-16
Q80WE4 1774 Kinesin-like protein KIF2 no N/A 0.610 0.052 0.428 2e-14
Q96Q89 1820 Kinesin-like protein KIF2 no N/A 0.636 0.053 0.405 4e-14
Q9V877 628 Kinesin-like protein subi yes N/A 0.636 0.156 0.425 6e-14
P46873 699 Osmotic avoidance abnorma no N/A 0.603 0.133 0.42 1e-12
Q86Y91 864 Kinesin-like protein KIF1 no N/A 0.746 0.133 0.355 3e-12
Q90640 1225 Chromosome-associated kin no N/A 0.597 0.075 0.422 5e-12
>sp|P97329|KI20A_MOUSE Kinesin-like protein KIF20A OS=Mus musculus GN=Kif20a PE=2 SV=1 Back     alignment and function desciption
 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 65/98 (66%), Gaps = 3/98 (3%)

Query: 35  MSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNGLKADKKKLIP 94
           +S   +CDLAG+ER K    SG+RL+EA  IN+SLH L RC   LR+N   ++ K+ LIP
Sbjct: 400 ISELSLCDLAGSERCKH-QKSGERLKEAGNINTSLHTLGRCIAALRQNQQNRS-KQNLIP 457

Query: 95  FRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETV 132
           FRDSKLT++FQ   +G   +  MIVNVN   +  +ET+
Sbjct: 458 FRDSKLTRVFQGFFTGRGRSC-MIVNVNPCASTYDETL 494
Mitotic kinesin required for chromosome passenger complex (CPC)-mediated cytokinesis. Following phosphorylation by PLK1, involved in recruitment of PLK1 to the central spindle (By similarity). Interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and RAB6B. May act as a motor required for the retrograde RAB6 regulated transport of Golgi membranes and associated vesicles along microtubules. Has a microtubule plus end-directed motility.
Mus musculus (taxid: 10090)
>sp|Q29RT6|KI20A_BOVIN Kinesin-like protein KIF20A OS=Bos taurus GN=KIF20A PE=2 SV=1 Back     alignment and function description
>sp|O95235|KI20A_HUMAN Kinesin-like protein KIF20A OS=Homo sapiens GN=KIF20A PE=1 SV=1 Back     alignment and function description
>sp|Q02241|KIF23_HUMAN Kinesin-like protein KIF23 OS=Homo sapiens GN=KIF23 PE=1 SV=3 Back     alignment and function description
>sp|Q80WE4|KI20B_MOUSE Kinesin-like protein KIF20B OS=Mus musculus GN=Kif20b PE=1 SV=3 Back     alignment and function description
>sp|Q96Q89|KI20B_HUMAN Kinesin-like protein KIF20B OS=Homo sapiens GN=KIF20B PE=1 SV=3 Back     alignment and function description
>sp|Q9V877|SUB_DROME Kinesin-like protein subito OS=Drosophila melanogaster GN=sub PE=1 SV=1 Back     alignment and function description
>sp|P46873|OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans GN=osm-3 PE=2 SV=4 Back     alignment and function description
>sp|Q86Y91|KI18B_HUMAN Kinesin-like protein KIF18B OS=Homo sapiens GN=KIF18B PE=1 SV=3 Back     alignment and function description
>sp|Q90640|KIF4_CHICK Chromosome-associated kinesin KIF4 OS=Gallus gallus GN=KIF4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
91082823 657 PREDICTED: similar to subito CG12298-PA 0.564 0.132 0.544 8e-19
328725064 957 PREDICTED: kinesin-like protein KIF20A-l 0.636 0.102 0.524 1e-18
449267063 884 Kinesin-like protein KIF20A [Columba liv 0.662 0.115 0.466 3e-17
307197892 1403 Kinesin-like protein KIF20A [Harpegnatho 0.733 0.080 0.434 8e-17
357624566 1307 hypothetical protein KGM_08312 [Danaus p 0.642 0.075 0.475 1e-16
229487413 1245 unnamed protein product [Heliconius melp 0.662 0.081 0.461 1e-16
432090298 891 Kinesin-like protein KIF20A [Myotis davi 0.662 0.114 0.471 1e-16
327265689 893 PREDICTED: LOW QUALITY PROTEIN: kinesin- 0.727 0.125 0.426 1e-16
443429446 1315 kinesin-like protein [Heliconius erato] 0.662 0.077 0.461 2e-16
54038272 675 kif20a-prov protein, partial [Xenopus (S 0.616 0.140 0.489 2e-16
>gi|91082823|ref|XP_969189.1| PREDICTED: similar to subito CG12298-PA [Tribolium castaneum] gi|270008165|gb|EFA04613.1| subito [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 64/90 (71%), Gaps = 3/90 (3%)

Query: 35  MSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNGLKADKKKLIP 94
           +SSF+ CDLAG+ER K+    GDRLRE+  IN+SL VL RC + +R  N  KA   KL+P
Sbjct: 346 VSSFNFCDLAGSERSKKTLNVGDRLRESNNINTSLLVLGRCISAVR--NAQKAHDNKLVP 403

Query: 95  FRDSKLTQIFQRSLSGLSSTVKMIVNVNAS 124
           FR+SKLTQ+FQ++LSG    + MIV +N S
Sbjct: 404 FRESKLTQLFQKALSG-GEDIAMIVTINPS 432

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328725064|ref|XP_001944759.2| PREDICTED: kinesin-like protein KIF20A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|449267063|gb|EMC78029.1| Kinesin-like protein KIF20A [Columba livia] Back     alignment and taxonomy information
>gi|307197892|gb|EFN78991.1| Kinesin-like protein KIF20A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|357624566|gb|EHJ75290.1| hypothetical protein KGM_08312 [Danaus plexippus] Back     alignment and taxonomy information
>gi|229487413|emb|CAY54166.1| unnamed protein product [Heliconius melpomene] Back     alignment and taxonomy information
>gi|432090298|gb|ELK23731.1| Kinesin-like protein KIF20A [Myotis davidii] Back     alignment and taxonomy information
>gi|327265689|ref|XP_003217640.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein KIF20A-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|443429446|gb|AGC92730.1| kinesin-like protein [Heliconius erato] Back     alignment and taxonomy information
>gi|54038272|gb|AAH84524.1| kif20a-prov protein, partial [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query154
UNIPROTKB|F1N8T5 786 LOC430761 "Uncharacterized pro 0.733 0.143 0.412 6.7e-17
UNIPROTKB|J9P9G6608 KIF20A "Uncharacterized protei 0.662 0.167 0.471 9e-17
UNIPROTKB|E2RHG7 752 KIF20A "Uncharacterized protei 0.662 0.135 0.471 1.3e-16
UNIPROTKB|F1NLI8 881 KIF20A "Uncharacterized protei 0.766 0.133 0.426 1.3e-16
UNIPROTKB|F1NJX5 553 LOC430761 "Uncharacterized pro 0.727 0.202 0.412 1.6e-16
MGI|MGI:1201682 887 Kif20a "kinesin family member 0.616 0.107 0.489 1.7e-16
RGD|1307695 888 Kif20a "kinesin family member 0.616 0.106 0.489 1.7e-16
UNIPROTKB|F1N8T6 617 LOC430761 "Uncharacterized pro 0.727 0.181 0.412 1.9e-16
UNIPROTKB|Q29RT6 888 KIF20A "Kinesin-like protein K 0.662 0.114 0.462 2.8e-16
UNIPROTKB|F1RH90 890 KIF20A "Uncharacterized protei 0.662 0.114 0.462 2.8e-16
UNIPROTKB|F1N8T5 LOC430761 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 219 (82.2 bits), Expect = 6.7e-17, P = 6.7e-17
 Identities = 47/114 (41%), Positives = 65/114 (57%)

Query:    19 ILLLFQVDPGSEELIVMSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNV 78
             I LL   D     ++ +S    CDLAG+ER  +    GDRL+EA  IN+SLH+L +C   
Sbjct:   317 IRLLILTDEHQPHVLGVSELTFCDLAGSERCNKTQAFGDRLKEAGNINNSLHILGKCIAA 376

Query:    79 LRENNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETV 132
             L++N   K  K   IPFR+SKLT++FQ    G      MIVN+N   +  +ET+
Sbjct:   377 LKQNQNPKRMKPSYIPFRESKLTRLFQPFFCGKGKAC-MIVNINQHASTYDETL 429
GO:0000910 "cytokinesis" evidence=IEA
GO:0003777 "microtubule motor activity" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IEA
GO:0005875 "microtubule associated complex" evidence=IEA
GO:0007018 "microtubule-based movement" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005874 "microtubule" evidence=IEA
UNIPROTKB|J9P9G6 KIF20A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RHG7 KIF20A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLI8 KIF20A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJX5 LOC430761 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1201682 Kif20a "kinesin family member 20A" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307695 Kif20a "kinesin family member 20A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N8T6 LOC430761 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RT6 KIF20A "Kinesin-like protein KIF20A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RH90 KIF20A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
cd00106328 cd00106, KISc, Kinesin motor domain 3e-29
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 1e-28
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 2e-27
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 3e-27
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 2e-20
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 6e-20
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 1e-19
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 1e-19
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 4e-18
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 6e-17
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 1e-16
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 4e-16
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 6e-16
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 1e-15
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 2e-15
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 4e-15
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 1e-14
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 1e-13
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 2e-09
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information 
 Score =  108 bits (272), Expect = 3e-29
 Identities = 44/106 (41%), Positives = 59/106 (55%), Gaps = 6/106 (5%)

Query: 28  GSEELIVMSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNGLKA 87
                I  S  ++ DLAG+ER K+    GDRL+EA+ IN SL  L    + L        
Sbjct: 220 NDGRSIKSSKLNLVDLAGSERAKKTGAEGDRLKEAKNINKSLSALGNVISALSSGQ---- 275

Query: 88  DKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQ 133
            KKK IP+RDSKLT++ Q SL G S T+ MI N++ S    +ET+ 
Sbjct: 276 -KKKHIPYRDSKLTRLLQDSLGGNSKTL-MIANISPSSENYDETLS 319

This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), in some its is found in the middle (M-type), or C-terminal (C-type). N-type and M-type kinesins are (+) end-directed motors, while C-type kinesins are (-) end-directed motors, i.e. they transport cargo towards the (-) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 328
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 154
KOG4280|consensus 574 100.0
KOG0245|consensus 1221 100.0
KOG0243|consensus 1041 100.0
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 100.0
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 100.0
KOG0240|consensus 607 100.0
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 100.0
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 100.0
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 100.0
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 100.0
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 100.0
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 100.0
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 100.0
KOG0242|consensus 675 100.0
KOG0241|consensus 1714 100.0
PF00225335 Kinesin: Kinesin motor domain; InterPro: IPR001752 100.0
KOG0247|consensus 809 100.0
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Micr 100.0
KOG0246|consensus 676 100.0
cd00106328 KISc Kinesin motor domain. This catalytic (head) d 100.0
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 100.0
KOG0239|consensus670 100.0
KOG0244|consensus 913 99.98
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 99.97
COG5059568 KIP1 Kinesin-like protein [Cytoskeleton] 85.37
>KOG4280|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.1e-43  Score=299.81  Aligned_cols=138  Identities=33%  Similarity=0.439  Sum_probs=127.2

Q ss_pred             ccccCCceeEEEEEEEEEEecCCCCcceeEeeEEEEeCCCCccccccCccccchHHHHHhhhhHHHHHHHHHHHhhccCC
Q psy16999          6 WSEVFRERIIAEVILLLFQVDPGSEELIVMSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNGL   85 (154)
Q Consensus         6 ~~~ssRSH~i~~i~i~~~~~~~~~~~~~~~S~L~~VDLAGsEr~~~~~~~~~~~~E~~~in~Sl~~L~~vi~aL~~~~~~   85 (154)
                      +..|||||+|||++|++.....++....+.|+|+|||||||||..++++.|++++|+.+||+||++||+||.||+++.. 
T Consensus       205 n~~SsRSH~ift~~i~~~~~~~~~~~~~~~~rlnlvDLagsEr~~~tga~G~rlkEa~~IN~SLs~LG~vI~aLvd~~~-  283 (574)
T KOG4280|consen  205 NEESSRSHAIFTIHIESSEKSDGGLMSGRSSKLNLVDLAGSERQSKTGAEGERLKEATNINLSLSALGNVISALVDGSK-  283 (574)
T ss_pred             CcccccceEEEEEEEEeecccCCCccccccceeeeeeccchhhhcccCccchhhhhhcccchhHHHHHHHHHHHhcccc-
Confidence            5679999999999999955444457788999999999999999999999999999999999999999999999999872 


Q ss_pred             CCCCCCcccCCCchhhHHhhhhcCCCCCeEEEEEEeCCCCCCHHHHHHHHHHHHHHhccccccCCccc
Q psy16999         86 KADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQYRVKIIDSVRSYRVPNHALL  153 (154)
Q Consensus        86 ~~~~~~~ipyr~SkLT~lL~d~L~g~s~~~~~i~~vsp~~~~~~eTl~tL~~fa~r~~~i~i~~~~~~  153 (154)
                           .||||||||||+||||+||||+ +|+|||||+|...+|+||++|| +||+|++  .|.|+|+|
T Consensus       284 -----~HIPYRdSkLT~LLqdSLGGN~-kT~mianvsp~~~~~~ETlsTL-rfA~Rak--~I~nk~~i  342 (574)
T KOG4280|consen  284 -----THIPYRDSKLTRLLQDSLGGNS-KTTMIANVSPSSDNYEETLSTL-RFAQRAK--AIKNKPVI  342 (574)
T ss_pred             -----CCCCcchhHHHHHHHHHcCCCc-eEEEEEecCchhhhhHHHHHHH-HHHHHHH--Hhhccccc
Confidence                 4999999999999999999999 9999999999999999999999 9999999  66777765

>KOG0245|consensus Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
4etp_A403 C-Terminal Motor And Motor Homology Domain Of Kar3v 4e-13
3b6u_A372 Crystal Structure Of The Motor Domain Of Human Kine 5e-13
1f9t_A358 Crystal Structures Of Kinesin Mutants Reveal A Sign 8e-13
3kar_A346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 8e-13
1f9v_A347 Crystal Structures Of Mutants Reveal A Signalling P 9e-13
2h58_A330 Crystal Structure Of The Kifc3 Motor Domain In Comp 1e-12
1f9w_A347 Crystal Structures Of Mutants Reveal A Signalling P 5e-12
1f9u_A347 Crystal Structures Of Mutants Reveal A Signalling P 6e-12
4gkr_A371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 8e-12
3t0q_A349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 2e-11
3gbj_A354 Crystal Structure Of The Motor Domain Of Kinesin Ki 4e-11
4a14_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 6e-11
1goj_A355 Structure Of A Fast Kinesin: Implications For Atpas 8e-11
1sdm_A369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 3e-10
3h4s_A386 Structure Of The Complex Of A Mitotic Kinesin With 4e-10
2vvg_A350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 5e-10
4h1g_A715 Structure Of Candida Albicans Kar3 Motor Domain Fus 9e-10
4aqv_C373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 1e-09
3nwn_A359 Crystal Structure Of The Human Kif9 Motor Domain In 2e-09
3zcw_A348 Eg5 - New Allosteric Binding Site Length = 348 2e-09
4a28_A368 Eg5-2 Length = 368 2e-09
1x88_A359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 2e-09
4ap0_A370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 2e-09
4a1z_A368 Eg5-1 Length = 368 2e-09
1ii6_A368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 2e-09
1q0b_A367 Crystal Structure Of The Motor Protein Ksp In Compl 2e-09
3hqd_A369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 2e-09
3bfn_A388 Crystal Structure Of The Motor Domain Of Human Kine 2e-09
2y5w_A365 Crystal Structure Of Drosophila Melanogaster Kinesi 2e-09
2xt3_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 5e-09
2wbe_C373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 2e-08
3lre_A355 Crystal Structure Analysis Of Human Kinesin-8 Motor 3e-08
2rep_A376 Crystal Structure Of The Motor Domain Of Human Kine 4e-08
2owm_A443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 4e-08
1t5c_A349 Crystal Structure Of The Motor Domain Of Human Kine 5e-08
1mkj_A349 Human Kinesin Motor Domain With Docked Neck Linker 1e-07
4atx_C340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 1e-07
1bg2_A325 Human Ubiquitous Kinesin Motor Domain Length = 325 1e-07
3b6v_A395 Crystal Structure Of The Motor Domain Of Human Kine 8e-07
2heh_A387 Crystal Structure Of The Kif2c Motor Domain (Casp T 1e-06
1ia0_K394 Kif1a Head-Microtubule Complex Structure In Atp-For 1e-06
1i5s_A367 Crystal Structure Of The Kif1a Motor Domain Complex 1e-06
1vfv_A366 Crystal Structure Of The Kif1a Motor Domain Complex 1e-06
1i6i_A366 Crystal Structure Of The Kif1a Motor Domain Complex 2e-06
3edl_D331 Kinesin13-Microtubule Ring Complex Length = 331 2e-06
2gry_A420 Crystal Structure Of The Human Kif2 Motor Domain In 2e-06
1v8j_A410 The Crystal Structure Of The Minimal Functional Dom 2e-06
3l1c_A383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 1e-05
1cz7_A406 The Crystal Structure Of A Minus-End Directed Micro 1e-05
3u06_A412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 1e-05
2ncd_A420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 1e-05
1n6m_A409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 6e-05
1ry6_A360 Crystal Structure Of Internal Kinesin Motor Domain 1e-04
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure 
Iteration: 1

 Score = 70.1 bits (170), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (58%), Gaps = 5/97 (5%)
Query: 36  SSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNGLKADKKKLIPF 95
            + ++ DLAG+ER   +   GDRLRE + IN SL  L    + L    G     K+ IPF
Sbjct: 294 GTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSALGDVIHAL----GQPDSTKRHIPF 349
Query: 96  RDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETV 132
           R+SKLT + Q SL+G S T+ M VN++ S ++  ET+
Sbjct: 350 RNSKLTYLLQYSLTGDSKTL-MFVNISPSSSHINETL 385
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 Back     alignment and structure
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query154
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 4e-25
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 6e-25
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 7e-25
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 8e-25
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 2e-24
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 2e-24
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 5e-24
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 1e-23
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 2e-23
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 2e-23
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 2e-23
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 4e-23
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 4e-23
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 4e-23
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 5e-23
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 6e-23
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 7e-23
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 4e-22
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 8e-22
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 9e-22
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 1e-21
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 1e-21
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 2e-21
3u06_A412 Protein claret segregational; motor domain, stalk 2e-21
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 1e-19
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 3e-19
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 3e-13
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
 Score = 97.3 bits (243), Expect = 4e-25
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 11/126 (8%)

Query: 19  ILLLFQVDPGSEELIVMSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNV 78
           I+ L   +  +       + ++ DLAG+ER   +   GDRLRE + IN SL  L    + 
Sbjct: 222 IIHLSGSNAKTGA-HSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSCLGDVIHA 280

Query: 79  LRENNGLKADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETV---QY- 134
           L + +      K+ IPFR+SKLT + Q SL+G S T+ M VN++ S ++  ET+   ++ 
Sbjct: 281 LGQPDS----TKRHIPFRNSKLTYLLQYSLTGDSKTL-MFVNISPSSSHINETLNSLRFA 335

Query: 135 -RVKII 139
            +V   
Sbjct: 336 SKVNST 341
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 100.0
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 100.0
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 100.0
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 100.0
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 100.0
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 100.0
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 100.0
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 100.0
4h1g_A715 Maltose binding protein-cakar3 motor domain fusio; 100.0
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
3u06_A412 Protein claret segregational; motor domain, stalk 100.0
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 99.96
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 99.95
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
Probab=100.00  E-value=1.6e-44  Score=298.14  Aligned_cols=137  Identities=28%  Similarity=0.409  Sum_probs=111.3

Q ss_pred             ccccCCceeEEEEEEEEEEecCCCCcceeEeeEEEEeCCCCccccccCccccchHHHHHhhhhHHHHHHHHHHHhhccCC
Q psy16999          6 WSEVFRERIIAEVILLLFQVDPGSEELIVMSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNGL   85 (154)
Q Consensus         6 ~~~ssRSH~i~~i~i~~~~~~~~~~~~~~~S~L~~VDLAGsEr~~~~~~~~~~~~E~~~in~Sl~~L~~vi~aL~~~~~~   85 (154)
                      |..|||||+||+|.|.+.....++......|+|+|||||||||..++++.|.+++|+..||+||++|++||.||.+++  
T Consensus       220 N~~SSRSH~if~i~i~~~~~~~~~~~~~~~skL~lVDLAGSEr~~~t~~~g~rl~E~~~INkSL~aLg~vI~aL~~~~--  297 (359)
T 1x88_A          220 NAYSSRSHSVFSVTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITALVERT--  297 (359)
T ss_dssp             TTHHHHCEEEEEEEEEEEEECTTSCEEEEEEEEEEEECCCCCC---------------CCCHHHHHHHHHHHHHHTTC--
T ss_pred             CCCCCCccEEEEEEEEEecccCCCCceEEEEEEEEEcCCCCCcccccCCcccchHHHhhhhHHHHHHHHHHHHHhcCC--
Confidence            678999999999999987766555556788999999999999999999999999999999999999999999999876  


Q ss_pred             CCCCCCcccCCCchhhHHhhhhcCCCCCeEEEEEEeCCCCCCHHHHHHHHHHHHHHhccccccCCccc
Q psy16999         86 KADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQYRVKIIDSVRSYRVPNHALL  153 (154)
Q Consensus        86 ~~~~~~~ipyr~SkLT~lL~d~L~g~s~~~~~i~~vsp~~~~~~eTl~tL~~fa~r~~~i~i~~~~~~  153 (154)
                           .||||||||||+||||+||||+ +|+||+||||...+++||++|| +||+|++  .|.|+|+|
T Consensus       298 -----~hvPyRdSkLT~lLqdsLgGns-kt~mIa~vsP~~~~~~ETl~TL-rfA~rak--~I~n~p~v  356 (359)
T 1x88_A          298 -----PHVPYRESKLTRILQDSLGGRT-RTSIIATISPASLNLEETLSTL-EYAHRAK--NILNKPEV  356 (359)
T ss_dssp             -----SCCCGGGSHHHHHTGGGSSSSS-EEEEEEEECCCGGGHHHHHHHH-HHHHHHT--TCCCCCC-
T ss_pred             -----CCCccccchHHHHHHHHhCCCC-eEEEEEEECCCcccHHHHHHHH-HHHHHHh--hccCccee
Confidence                 8999999999999999999999 9999999999999999999999 9999999  55666654
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 154
d2zfia1349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 3e-20
d1v8ka_362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 2e-19
d1f9va_342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 3e-19
d1bg2a_323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 3e-19
d1x88a1345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 9e-19
d1ry6a_330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 6e-17
d2ncda_368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 2e-16
d1goja_354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 2e-16
d1sdma_364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 6e-14
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Mouse (Mus musculus), kif1a [TaxId: 10090]

 Score = 83.1 bits (204), Expect = 3e-20
 Identities = 35/103 (33%), Positives = 50/103 (48%), Gaps = 6/103 (5%)

Query: 36  SSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRE-----NNGLKADKK 90
           S   + DLAG+ER       G RL+E   IN SL  L +  + L E     N   K  K 
Sbjct: 239 SKISLVDLAGSERADSTGAKGTRLKEGANINKSLTTLGKVISALAEMDSGPNKNKKKKKT 298

Query: 91  KLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQ 133
             IP+RDS LT + + +L G S T  M+  ++ +    +ET+ 
Sbjct: 299 DFIPYRDSVLTWLLRENLGGNSRTA-MVAALSPADINYDETLS 340
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query154
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 100.0
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 100.0
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 100.0
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin heavy chain-like protein
species: Potato (Solanum tuberosum) [TaxId: 4113]

Probab=100.00  E-value=5.3e-40  Score=269.51  Aligned_cols=134  Identities=31%  Similarity=0.450  Sum_probs=114.4

Q ss_pred             cccccCCceeEEEEEEEEEEecCCCCcceeEeeEEEEeCCCCccccccCccccchHHHHHhhhhHHHHHHHHHHHhhccC
Q psy16999          5 RWSEVFRERIIAEVILLLFQVDPGSEELIVMSSFDICDLAGAERQKRAHTSGDRLREARTINSSLHVLARCFNVLRENNG   84 (154)
Q Consensus         5 r~~~ssRSH~i~~i~i~~~~~~~~~~~~~~~S~L~~VDLAGsEr~~~~~~~~~~~~E~~~in~Sl~~L~~vi~aL~~~~~   84 (154)
                      -+..|||||+||++.+.+....   ......++|+||||||+||..++++.|.+++|+..||+||.+|++||.+|++++ 
T Consensus       194 ~n~~ssRsH~i~~i~v~~~~~~---~~~~~~~kl~~vDLAGsEr~~~~~~~g~~~~E~~~iN~SL~~L~~vi~aL~~~~-  269 (364)
T d1sdma_         194 MNEQSSRSHLIVSVIIESTNLQ---TQAIARGKLSFVDLAGSERVKKSGSAGNQLKEAQSINKSLSALGDVISALSSGN-  269 (364)
T ss_dssp             TTCHHHHSEEEEEEEEEEEETT---TCCEEEEEEEEEECCCCSCCCC---------CCCTTCHHHHHHHHHHHHHHHTC-
T ss_pred             ccccccccceEEEEEEEEeccC---cceeeeEEEEeechhhccccccccccCceeeeccccccchhhHHHHHHHHHcCC-
Confidence            3678999999999999886653   446788999999999999999999999999999999999999999999999977 


Q ss_pred             CCCCCCCcccCCCchhhHHhhhhcCCCCCeEEEEEEeCCCCCCHHHHHHHHHHHHHHhccccccCCcc
Q psy16999         85 LKADKKKLIPFRDSKLTQIFQRSLSGLSSTVKMIVNVNASPAYAEETVQYRVKIIDSVRSYRVPNHAL  152 (154)
Q Consensus        85 ~~~~~~~~ipyr~SkLT~lL~d~L~g~s~~~~~i~~vsp~~~~~~eTl~tL~~fa~r~~~i~i~~~~~  152 (154)
                            .|||||+||||+||+|+||||+ +|+||+||||...+++||++|| +||+++++|  .|+|.
T Consensus       270 ------~~ipyR~SkLT~lL~d~Lggns-~t~~I~~isp~~~~~~eTl~TL-~fa~~ak~i--~n~p~  327 (364)
T d1sdma_         270 ------QHIPYRNHKLTMLMSDSLGGNA-KTLMFVNISPAESNLDETHNSL-TYASRVRSI--VNDPS  327 (364)
T ss_dssp             ------SCCCGGGCHHHHHTTTTTTSSS-EEEEEEEECCBGGGHHHHHHHH-HHHHHHTTC--CCCCC
T ss_pred             ------CcCCchhhhhhHHHHhhcCCCc-eEEEEEEeCCCcchHHHHHHHH-HHHHHHhhc--ccCCc
Confidence                  8999999999999999999999 9999999999999999999999 999999955  45543
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure