Psyllid ID: psy17077
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 83 | ||||||
| 449673518 | 577 | PREDICTED: metal transporter CNNM2-like, | 0.722 | 0.103 | 0.666 | 3e-16 | |
| 328783660 | 945 | PREDICTED: metal transporter CNNM2-like | 0.759 | 0.066 | 0.666 | 7e-16 | |
| 380016390 | 985 | PREDICTED: LOW QUALITY PROTEIN: metal tr | 0.759 | 0.063 | 0.666 | 7e-16 | |
| 345478782 | 938 | PREDICTED: metal transporter CNNM2-like | 0.759 | 0.067 | 0.650 | 7e-16 | |
| 332022207 | 999 | Metal transporter CNNM2 [Acromyrmex echi | 0.759 | 0.063 | 0.650 | 1e-15 | |
| 307177469 | 1003 | Metal transporter CNNM2 [Camponotus flor | 0.759 | 0.062 | 0.634 | 1e-15 | |
| 196015749 | 459 | hypothetical protein TRIADDRAFT_1604 [Tr | 0.759 | 0.137 | 0.666 | 3e-15 | |
| 449665982 | 733 | PREDICTED: metal transporter CNNM2-like | 0.722 | 0.081 | 0.65 | 3e-15 | |
| 321464707 | 478 | hypothetical protein DAPPUDRAFT_55651 [D | 0.722 | 0.125 | 0.633 | 3e-15 | |
| 350403868 | 950 | PREDICTED: metal transporter CNNM2-like | 0.759 | 0.066 | 0.634 | 3e-15 |
| >gi|449673518|ref|XP_002163724.2| PREDICTED: metal transporter CNNM2-like, partial [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
Score = 89.0 bits (219), Expect = 3e-16, Method: Composition-based stats.
Identities = 40/60 (66%), Positives = 54/60 (90%)
Query: 8 TKGLVAVIGTTITLVIIGEILPQSIGSRYGLAIGAHTIYLTRLAMLITFPLSYPMGKALD 67
T G+VAV+G+T+ +V++GEI+PQSI SRYGLA+GA+TIYLT+L M+ITFP+SYP+ K LD
Sbjct: 247 TSGIVAVVGSTLGIVLLGEIIPQSICSRYGLAVGAYTIYLTKLFMIITFPVSYPISKILD 306
|
Source: Hydra magnipapillata Species: Hydra magnipapillata Genus: Hydra Family: Hydridae Order: Hydroida Class: Hydrozoa Phylum: Cnidaria Superkingdom: Eukaryota |
| >gi|328783660|ref|XP_625178.3| PREDICTED: metal transporter CNNM2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380016390|ref|XP_003692168.1| PREDICTED: LOW QUALITY PROTEIN: metal transporter CNNM2-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|345478782|ref|XP_001605401.2| PREDICTED: metal transporter CNNM2-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|332022207|gb|EGI62522.1| Metal transporter CNNM2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307177469|gb|EFN66596.1| Metal transporter CNNM2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|196015749|ref|XP_002117730.1| hypothetical protein TRIADDRAFT_1604 [Trichoplax adhaerens] gi|190579615|gb|EDV19706.1| hypothetical protein TRIADDRAFT_1604 [Trichoplax adhaerens] | Back alignment and taxonomy information |
|---|
| >gi|449665982|ref|XP_002154156.2| PREDICTED: metal transporter CNNM2-like [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
| >gi|321464707|gb|EFX75713.1| hypothetical protein DAPPUDRAFT_55651 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|350403868|ref|XP_003486930.1| PREDICTED: metal transporter CNNM2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 83 | ||||||
| RGD|1305571 | 772 | Cnnm4 "cyclin M4" [Rattus norv | 0.506 | 0.054 | 0.619 | 1.9e-08 | |
| TAIR|locus:2014520 | 499 | AT1G03270 "AT1G03270" [Arabido | 0.469 | 0.078 | 0.564 | 2.2e-08 | |
| MGI|MGI:2151060 | 771 | Cnnm4 "cyclin M4" [Mus musculu | 0.506 | 0.054 | 0.619 | 2.4e-08 | |
| UNIPROTKB|Q6P4Q7 | 775 | CNNM4 "Metal transporter CNNM4 | 0.506 | 0.054 | 0.619 | 3.1e-08 | |
| ZFIN|ZDB-GENE-050208-36 | 811 | cnnm2a "cyclin M2a" [Danio rer | 0.506 | 0.051 | 0.595 | 8.8e-08 | |
| UNIPROTKB|F1ND49 | 598 | CNNM2 "Uncharacterized protein | 0.469 | 0.065 | 0.615 | 9.5e-08 | |
| UNIPROTKB|F1S849 | 827 | CNNM2 "Uncharacterized protein | 0.469 | 0.047 | 0.615 | 1.5e-07 | |
| UNIPROTKB|E1BIL3 | 853 | CNNM2 "Uncharacterized protein | 0.469 | 0.045 | 0.615 | 1.5e-07 | |
| UNIPROTKB|E2RJ19 | 875 | CNNM2 "Uncharacterized protein | 0.469 | 0.044 | 0.615 | 1.6e-07 | |
| UNIPROTKB|Q9H8M5 | 875 | CNNM2 "Metal transporter CNNM2 | 0.469 | 0.044 | 0.615 | 1.6e-07 |
| RGD|1305571 Cnnm4 "cyclin M4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 140 (54.3 bits), Expect = 1.9e-08, P = 1.9e-08
Identities = 26/42 (61%), Positives = 36/42 (85%)
Query: 29 PQSIGSRYGLAIGAHTIYLTRLAMLITFPLSYPMGKALDFSL 70
PQ++ SR+GLA+GA+TI LT++ ML+TFPLS+P+ K LDF L
Sbjct: 285 PQALCSRHGLAVGANTIVLTKIFMLLTFPLSFPISKLLDFVL 326
|
|
| TAIR|locus:2014520 AT1G03270 "AT1G03270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2151060 Cnnm4 "cyclin M4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6P4Q7 CNNM4 "Metal transporter CNNM4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050208-36 cnnm2a "cyclin M2a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1ND49 CNNM2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S849 CNNM2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BIL3 CNNM2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RJ19 CNNM2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9H8M5 CNNM2 "Metal transporter CNNM2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 83 | |||
| pfam01595 | 182 | pfam01595, DUF21, Domain of unknown function DUF21 | 6e-08 | |
| COG1253 | 429 | COG1253, TlyC, Hemolysins and related proteins con | 1e-05 |
| >gnl|CDD|216595 pfam01595, DUF21, Domain of unknown function DUF21 | Back alignment and domain information |
|---|
Score = 46.8 bits (112), Expect = 6e-08
Identities = 16/60 (26%), Positives = 32/60 (53%)
Query: 11 LVAVIGTTITLVIIGEILPQSIGSRYGLAIGAHTIYLTRLAMLITFPLSYPMGKALDFSL 70
L+A + +T+ +++ GEILP+++ R I R+ M + +PL + + K + L
Sbjct: 89 LLATLVSTLLILVFGEILPKTLARRNPERIALRLAPPLRVLMKLLYPLVWLLSKLSNLLL 148
|
This transmembrane region has no known function. Many of the sequences in this family are annotated as hemolysins, however this is due to a similarity to Treponema hyodysenteriae hemolysin C that does not contain this domain. This domain is found in the N-terminus of the proteins adjacent to two intracellular CBS domains pfam00571. Length = 182 |
| >gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 83 | |||
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 99.43 | |
| PF01595 | 183 | DUF21: Domain of unknown function DUF21; InterPro: | 99.41 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 99.4 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 99.35 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 99.12 | |
| KOG2118|consensus | 498 | 98.57 |
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
Probab=99.43 E-value=6.6e-13 Score=101.54 Aligned_cols=59 Identities=24% Similarity=0.421 Sum_probs=53.7
Q ss_pred HHHHHHHHHHHHHHhhhhHHHHHHhHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhHHHh
Q psy17077 12 VAVIGTTITLVIIGEILPQSIGSRYGLAIGAHTIYLTRLAMLITFPLSYPMGKALDFSL 70 (83)
Q Consensus 12 ~a~~i~T~lIlifGEIiPK~ia~~~~~~ia~~~a~~v~~~~~il~Pl~~~l~~i~~~~~ 70 (83)
++++++|+++++|||++||++|.+||+++|..+++++++++++++|++|+++++.+.+.
T Consensus 89 ~~~~~~t~l~lvfgEiiPK~la~~~~~~ia~~~a~~l~~~~~l~~P~~~~l~~~~~~i~ 147 (408)
T TIGR03520 89 IEVVIVTFLILLFGEILPKVYANRNNLKFAKFMAYPINILDKVFSPISLPLRAITNFIH 147 (408)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 45667899999999999999999999999999999999999999999999999765443
|
Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldC is a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. GldE was discovered because of its adjacency to GldD in F. johnsonii. Overexpression of GldE partially supresses the effects of a GldB point mutant suggesting that GldB and GldE interact. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Not all Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility and in fact some do not appear to express the gliding phenotype. |
| >PF01595 DUF21: Domain of unknown function DUF21; InterPro: IPR002550 This transmembrane region has no known function | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2118|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
No hit with probability above 80.00