Psyllid ID: psy17084

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-
MSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVCAPGWTGPTCKIKHNFFPYLQFIPLTTSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVDHDHCNPNPCLNGAPCFNTQADYYCHCTEDWEGKNCSFPRYKCDNPPCDDIDECVSNPCQNGGTCVDLVDGYKCECTQAWEGSNCQYDADECQKSPCVNAALGCTNLVGDYRCNCSPGWTGHNCDVNINDCVGQCRHGSTCIDLVNDFHCACLPGYTGRTCQTDINDCESSPCVNGGECVDQVNGFRCICPVGFAGQLCENGGTCVNTGDLYSCICKEGFEGPDCGQDINDCSPQPCYNGGKCVDGVNWFLCECAPGFAGPDCRININECASNPCGYGKEILTVQSRSRSPAYLCVSNPAYLVARCVSQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANSNQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANNKNECEPNPCKNNGTCIDGHADFTCLCKNGWKGKTCTSKNGHCDRGTCKHGGTCADLGSSFFCHCPPDWEGTSCHIGKLNACKSNPCKNGGTCVNTGDLYSCICKEGFVHALLFTRRTP
cccccccccccccccccccccccEEEccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEEccccccccccccccccccccccccccEEEccccccEEcccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccEEccccccEEEEcccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccEEccccccEEEEccccccccccccccccccccccccccEEEEccccEEEEccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEcccccccccccccccccccccccEEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccEEEEccccccccccccccccccccccccccEEccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccc
cccccEEccccHcccccccccccEEEccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEcccccccEccccccccccccccccEcccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccc
MSLFRLLSdlnycgthepcqnggtcentapdqylctcpegfsgincevvdnpcmmgpcgnggqcketagqfqcvcapgwtgptckikhnffpylqfiplTTSLFRLLSDlnycgthepcqnggtcentapdqylctcpegfsgincevvdnpcmmgpcgnggqcketagqfqcvdhdhcnpnpclngapcfntqadyychctedwegkncsfprykcdnppcddidecvsnpcqnggtcvdlvdgykcectqawegsncqydadecqkspcvnaalgctnlvgdyrcncspgwtghncdvnindcvgqcrhgstcidlvndfhcaclpgytgrtcqtdindcesspcvnggecvdqvngfrcicpvgfagqlcenggtcvntgdlYSCIckegfegpdcgqdindcspqpcynggkcvdgvnwflcecapgfagpdcrininecasnpcgygkeiltvqsrsrspaylcvsnpaYLVARCVsqsggsfkcscdagfsgkychenindckhnpcqnggtcvdkvnsfqcicrdgwegeicansnqsggsfkcscdagfsgkychenindckhnpcqnggtcvdkvnsfqcicrdgwegeicannknecepnpcknngtcidghadftclckngwkgktctsknghcdrgtckhggtcadlgssffchcppdwegtschigklnacksnpcknggtcvntgdlysCICKEGFVHALLFTRRTP
MSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVCAPGWTGPTCKIKHNFFPYLQFIPLTTSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVDHDHCNPNPCLNGAPCFNTQADYYCHCTEDWEGKNCSFPRYKCDNPPCDDIDECVSNPCQNGGTCVDLVDGYKCECTQAWEGSNCQYDADECQKSPCVNAALGCTNLVGDYRCNCSPGWTGHNCDVNINDCVGQCRHGSTCIDLVNDFHCACLPGYTGRTCQTDINDCESSPCVNGGECVDQVNGFRCICPVGFAGQLCENGGTCVNTGDLYSCICKEGFEGPDCGQDINDCSPQPCYNGGKCVDGVNWFLCECAPGFAGPDCRININECASNPCGYGKEILTVQSRSRSPAYLCVSNPAYLVARCVSQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANSNQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANNKNECEPNPCKNNGTCIDGHADFTCLCKNGWKGKTCTSKNGHCDRGTCKHGGTCADLGSSFFCHCPPDWEGTSCHIGKLNACKSNPCKNGGTCVNTGDLYSCICKEGFVHALLFTRRTP
MSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVCAPGWTGPTCKIKHNFFPYLQFIPLTTSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVDHDHCNPNPCLNGAPCFNTQADYYCHCTEDWEGKNCSFPRYKCDNPPCDDIDECVSNPCQNGGTCVDLVDGYKCECTQAWEGSNCQYDADECQKSPCVNAALGCTNLVGDYRCNCSPGWTGHNCDVNINDCVGQCRHGSTCIDLVNDFHCACLPGYTGRTCQTDINDCESSPCVNGGECVDQVNGFRCICPVGFAGQLCENGGTCVNTGDLYSCICKEGFEGPDCGQDINDCSPQPCYNGGKCVDGVNWFLCECAPGFAGPDCRININECASNPCGYGKEILTVQSRSRSPAYLCVSNPAYLVARCVSQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANSNQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANNKNECEPNPCKNNGTCIDGHADFTCLCKNGWKGKTCTSKNGHCDRGTCKHGGTCADLGSSFFCHCPPDWEGTSCHIGKLNACKSNPCKNGGTCVNTGDLYSCICKEGFVHALLFTRRTP
***FRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVCAPGWTGPTCKIKHNFFPYLQFIPLTTSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVDHDHCNPNPCLNGAPCFNTQADYYCHCTEDWEGKNCSFPRYKCDNPPCDDIDECVSNPCQNGGTCVDLVDGYKCECTQAWEGSNCQYDADECQKSPCVNAALGCTNLVGDYRCNCSPGWTGHNCDVNINDCVGQCRHGSTCIDLVNDFHCACLPGYTGRTCQTDINDCESSPCVNGGECVDQVNGFRCICPVGFAGQLCENGGTCVNTGDLYSCICKEGFEGPDCGQDINDCSPQPCYNGGKCVDGVNWFLCECAPGFAGPDCRININECASNPCGYGKEILTVQSRSRSPAYLCVSNPAYLVARCVSQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANSNQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANNKNECEPNPCKNNGTCIDGHADFTCLCKNGWKGKTCTSKNGHCDRGTCKHGGTCADLGSSFFCHCPPDWEGTSCHIGKLNACKSNPCKNGGTCVNTGDLYSCICKEGFVHALLFT****
MSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVCAPGWTGPTCKIKHNFFPYLQFIPLTTSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVDHDHCNPNPCLNGAPCFNTQADYYCHCTEDWEGKNCSFPRYKCDNPPCDDIDECVSNPCQNGGTCVDLVDGYKCECTQAWEGSNCQYDADECQKSPCVNAALGCTNLVGDYRCNCSPGWTGHNCDVNINDCVGQCRHGSTCIDLVNDFHCACLPGYTGRTCQTDINDCESSPCVNGGECVDQVNGFRCICPVGFAGQLCENGGTCVNTGDLYSCICKEGFEGPDCGQDINDCSPQPCYNGGKCVDGVNWFLCECAPGFAGPDCRININECASNPCGYGKEILTVQSRSRSPAYLCVSNPAYLVARCVSQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANSNQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANNKNECEPNPCKNNGTCIDGHADFTCLCKNGWKGKTCTSKNGHCDRGTCKHGGTCADLGSSFFCHCPPDWEGTSCHIGKLNACKSNPCKNGGTCVNTGDLYSCICKEGFVHALLFTRRTP
MSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVCAPGWTGPTCKIKHNFFPYLQFIPLTTSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVDHDHCNPNPCLNGAPCFNTQADYYCHCTEDWEGKNCSFPRYKCDNPPCDDIDECVSNPCQNGGTCVDLVDGYKCECTQAWEGSNCQYDADECQKSPCVNAALGCTNLVGDYRCNCSPGWTGHNCDVNINDCVGQCRHGSTCIDLVNDFHCACLPGYTGRTCQTDINDCESSPCVNGGECVDQVNGFRCICPVGFAGQLCENGGTCVNTGDLYSCICKEGFEGPDCGQDINDCSPQPCYNGGKCVDGVNWFLCECAPGFAGPDCRININECASNPCGYGKEILTVQSRSRSPAYLCVSNPAYLVARCVSQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANSNQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANNKNECEPNPCKNNGTCIDGHADFTCLCKNGWKGKTCTSKNGHCDRGTCKHGGTCADLGSSFFCHCPPDWEGTSCHIGKLNACKSNPCKNGGTCVNTGDLYSCICKEGFVHALLFTRRTP
**LFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVCAPGWTGPTCKIKHNFFPYLQFIPLTTSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVDHDHCNPNPCLNGAPCFNTQADYYCHCTEDWEGKNCSFPRYKCDNPPCDDIDECVSNPCQNGGTCVDLVDGYKCECTQAWEGSNCQYDADECQKSPCVNAALGCTNLVGDYRCNCSPGWTGHNCDVNINDCVGQCRHGSTCIDLVNDFHCACLPGYTGRTCQTDINDCESSPCVNGGECVDQVNGFRCICPVGFAGQLCENGGTCVNTGDLYSCICKEGFEGPDCGQDINDCSPQPCYNGGKCVDGVNWFLCECAPGFAGPDCRININECASNPCGYGKEILTVQSRSRSPAYLCVSNPAYLVARCVSQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANSNQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANNKNECEPNPCKNNGTCIDGHADFTCLCKNGWKGKTCTSKNGHCDRGTCKHGGTCADLGSSFFCHCPPDWEGTSCHIGKLNACKSNPCKNGGTCVNTGDLYSCICKEGFVHALLF*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVCAPGWTGPTCKIKHNFFPYLQFIPLTTSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVDHDHCNPNPCLNGAPCFNTQADYYCHCTEDWEGKNCSFPRYKCDNPPCDDIDECVSNPCQNGGTCVDLVDGYKCECTQAWEGSNCQYDADECQKSPCVNAALGCTNLVGDYRCNCSPGWTGHNCDVNINDCVGQCRHGSTCIDLVNDFHCACLPGYTGRTCQTDINDCESSPCVNGGECVDQVNGFRCICPVGFAGQLCENGGTCVNTGDLYSCICKEGFEGPDCGQDINDCSPQPCYNGGKCVDGVNWFLCECAPGFAGPDCRININECASNPCGYGKEILTVQSRSRSPAYLCVSNPAYLVARCVSQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANSNQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANNKNECEPNPCKNNGTCIDGHADFTCLCKNGWKGKTCTSKNGHCDRGTCKHGGTCADLGSSFFCHCPPDWEGTSCHIGKLNACKSNPCKNGGTCVNTGDLYSCICKEGFVHALLFTRRTP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query721 2.2.26 [Sep-21-2011]
P10079 1064 Fibropellin-1 OS=Strongyl no N/A 0.900 0.609 0.358 1e-120
Q9QW30 2471 Neurogenic locus notch ho yes N/A 0.936 0.273 0.352 1e-119
O35516 2470 Neurogenic locus notch ho yes N/A 0.936 0.273 0.348 1e-119
P21783 2524 Neurogenic locus notch pr N/A N/A 0.916 0.261 0.369 1e-119
P46530 2437 Neurogenic locus notch ho yes N/A 0.930 0.275 0.341 1e-118
Q04721 2471 Neurogenic locus notch ho yes N/A 0.937 0.273 0.342 1e-118
P46531 2555 Neurogenic locus notch ho no N/A 0.963 0.272 0.364 1e-114
Q01705 2531 Neurogenic locus notch ho no N/A 0.962 0.274 0.356 1e-114
P07207 2703 Neurogenic locus Notch pr yes N/A 0.926 0.247 0.345 1e-114
Q07008 2531 Neurogenic locus notch ho no N/A 0.947 0.269 0.357 1e-113
>sp|P10079|FBP1_STRPU Fibropellin-1 OS=Strongylocentrotus purpuratus GN=EGF1 PE=1 SV=2 Back     alignment and function desciption
 Score =  433 bits (1114), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 276/770 (35%), Positives = 388/770 (50%), Gaps = 121/770 (15%)

Query: 9   DLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETA 68
           D++ C + +PCQNGG C +   + Y+C C  GF G  CE   N C   PC NGG C +  
Sbjct: 214 DIDECAS-DPCQNGGACVDGV-NGYVCNCVPGFDGDECENNINECASSPCLNGGICVDGV 271

Query: 69  GQFQCVCAPGWTGPTCKIKHNFFPYLQFIPLTTSLFRLLSDLNYCGTHEPCQNGGTCENT 128
             F+C C  G+TG  C++                      +++ C +  PCQNGG C + 
Sbjct: 272 NMFECTCLAGFTGVRCEV----------------------NIDECASA-PCQNGGICID- 307

Query: 129 APDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCV------------DH 176
             + Y C+CP GFSG NCE  D+ C   PC NGG C +    + CV            + 
Sbjct: 308 GINGYTCSCPLGFSGDNCENNDDECSSIPCLNGGTCVDLVNAYMCVCAPGWTGPTCADNI 367

Query: 177 DHCNPNPCLNGAPCFNTQADYYCHCTEDWEGKNCSFPRYKCDNPPC-------------- 222
           D C   PC NG  C +    Y C C   + G +C     +C  PPC              
Sbjct: 368 DECASAPCQNGGVCIDGVNGYMCDCQPGYTGTHCETDIDECARPPCQNGGDCVDGVNGYV 427

Query: 223 -------------DDIDECVSNPCQNGGTCVDLVDGYKCECTQAWEGSNCQYDADECQKS 269
                        ++IDEC S PCQNG  CVD V+G+ C C+  + G  C+ D +EC   
Sbjct: 428 CICAPGFDGLNCENNIDECASRPCQNGAVCVDGVNGFVCTCSAGYTGVLCETDINECASM 487

Query: 270 PCVNAALGCTNLVGDYRCNCSPGWTGHNCDVNINDCVG-QCRHGSTCIDLVNDFHCACLP 328
           PC+N  + CT+LV  Y C C+ G+ G NC+ + ++C    C++G+TC D VN + C C+P
Sbjct: 488 PCLNGGV-CTDLVNGYICTCAAGFEGTNCETDTDECASFPCQNGATCTDQVNGYVCTCVP 546

Query: 329 GYTGRTCQTDINDCESSPCVNGGECVDQVNGFRCICPVGFAGQLCE------------NG 376
           GYTG  C+TDIN+C S PC+NGG C DQVNG+ C+C    +   CE            NG
Sbjct: 547 GYTGVLCETDINECASFPCLNGGTCNDQVNGYVCVCAQDTSVSTCETDRDECASAPCLNG 606

Query: 377 GTCVNTGDLYSCICKEGFEGPDCGQDINDCSPQPCYNGGKCVDGVNWFLCECAPGFAGPD 436
           G C++  + + C C  G+EG +C  + ++C+  PC NGG CVD VN ++C C PGF G  
Sbjct: 607 GACMDVVNGFVCTCLPGWEGTNCEINTDECASSPCMNGGLCVDQVNSYVCFCLPGFTGIH 666

Query: 437 CRININECASNPCGYGKEILTVQSRSRSPAYLCVSNPAYLVARCVSQSGGSFKCSCDAGF 496
           C   I+ECAS+PC  G                          +C+ +   S++C C AG+
Sbjct: 667 CGTEIDECASSPCLNG-------------------------GQCIDRVD-SYECVCAAGY 700

Query: 497 SGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANSNQ--------SGGS 548
           +   C  NI++C   PCQNGG CVD VN + C C  G+ G+ C             +GG+
Sbjct: 701 TAVRCQINIDECASAPCQNGGVCVDGVNGYVCNCAPGYTGDNCETEIDECASMPCLNGGA 760

Query: 549 -------FKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICA 601
                  + C C AG++G  C  +I++C   PCQNGG C D +N + C C  G+ G  C 
Sbjct: 761 CIEMVNGYTCQCVAGYTGVICETDIDECASAPCQNGGVCTDTINGYICACVPGFTGSNCE 820

Query: 602 NNKNECEPNPCKNNGTCIDGHADFTCLCKNGWKGKTCTSKNGHCDRGTCKHGGTCADLGS 661
            N +EC  +PC N G C+DG   F C C   + G  C      C    C++G TC ++G+
Sbjct: 821 TNIDECASDPCLNGGICVDGVNGFVCQCPPNYSGTYCEISLDACRSMPCQNGATCVNVGA 880

Query: 662 SFFCHCPPDWEGTSCHIGKLNACKSNPCKNGGTCVNTGDLYSCICKEGFV 711
            + C C P + G +C I  +N C S PC+NGG C++    Y+C C+ G++
Sbjct: 881 DYVCECVPGYAGQNCEI-DINECASLPCQNGGLCIDGIAGYTCQCRLGYI 929
Forms the apical lamina, a component of the extracellular matrix.
Strongylocentrotus purpuratus (taxid: 7668)
>sp|Q9QW30|NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 Back     alignment and function description
>sp|O35516|NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 Back     alignment and function description
>sp|P21783|NOTCH_XENLA Neurogenic locus notch protein homolog OS=Xenopus laevis GN=notch1 PE=1 SV=3 Back     alignment and function description
>sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 Back     alignment and function description
>sp|Q04721|NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 Back     alignment and function description
>sp|P46531|NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens GN=NOTCH1 PE=1 SV=4 Back     alignment and function description
>sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 Back     alignment and function description
>sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 Back     alignment and function description
>sp|Q07008|NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus GN=Notch1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query721
340382857 1067 PREDICTED: neurogenic locus notch homolo 0.904 0.611 0.377 1e-130
260815375 1099 hypothetical protein BRAFLDRAFT_63459 [B 0.925 0.606 0.375 1e-129
291234019 2431 PREDICTED: neurogenic locus notch homolo 0.950 0.281 0.380 1e-127
390343533 7990 PREDICTED: uncharacterized protein LOC57 0.940 0.084 0.353 1e-125
390339335 1665 PREDICTED: neurogenic locus Notch protei 0.963 0.417 0.371 1e-124
291234025 1262 PREDICTED: neurogenic locus notch homolo 0.923 0.527 0.355 1e-123
390333862 3404 PREDICTED: fibrillin-2-like [Strongyloce 0.938 0.198 0.361 1e-122
340373673 1751 PREDICTED: neurogenic locus notch homolo 0.909 0.374 0.366 1e-122
390333826 1634 PREDICTED: neurogenic locus notch homolo 0.932 0.411 0.348 1e-122
156398660691 predicted protein [Nematostella vectensi 0.886 0.924 0.359 1e-121
>gi|340382857|ref|XP_003389934.1| PREDICTED: neurogenic locus notch homolog protein 1-like [Amphimedon queenslandica] Back     alignment and taxonomy information
 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 284/752 (37%), Positives = 378/752 (50%), Gaps = 100/752 (13%)

Query: 17   EPCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCVCA 76
             PCQN  TC +   D Y CTC +G++G NC    N C   PC NG  C +    + C CA
Sbjct: 354  NPCQNDATCTDQVAD-YSCTCAQGYTGKNCSTNINDCSPNPCQNGATCTDQVADYSCTCA 412

Query: 77   PGWTGPTCKIKHNFFPYLQFIPLTTSLFRLLSDLNYCGTHEPCQNGGTCENTAPDQYLCT 136
             G+TG  C                       +++N C +  PCQNG TC +   D Y CT
Sbjct: 413  QGYTGKNCS----------------------TNINDC-SPNPCQNGATCTDQVAD-YSCT 448

Query: 137  CPEGFSGINCEVVDNPCMMGPCGNGGQCKETAGQFQCV------------DHDHCNPNPC 184
            C +G++G NC    N C   PC NG  C +    + C+            + D CNPNPC
Sbjct: 449  CAQGYTGKNCSTNINDCSPNPCQNGATCTDQVADYNCLCVQGYTGKNCNTNIDDCNPNPC 508

Query: 185  LNGAPCFNTQADYYCHCTEDWEGKNCSFPRYKCDNPPCDDIDECVSNPCQNGGTCVDLVD 244
             NGA C +  ADY C C + + GKNCS            +I++C  NPCQNG TC D V 
Sbjct: 509  QNGATCTDQVADYNCQCVQGYTGKNCST-----------NINDCNPNPCQNGATCTDQVA 557

Query: 245  GYKCECTQAWEGSNCQYDADECQKSPCVNAALGCTNLVGDYRCNCSPGWTGHNCDVNIND 304
             Y C+C Q + G NC  + ++C  +PC N A+ CT+ V DY C C+ G+TG NC  NIND
Sbjct: 558  DYNCQCVQGYTGKNCSTNINDCSPNPCQNGAM-CTDQVADYSCTCAQGYTGKNCSTNIND 616

Query: 305  CV-GQCRHGSTCIDLVNDFHCACLPGYTGRTCQTDINDCESSPCVNGGECVDQVNGFRCI 363
            C    C +G+TC D V D++C C+ GYTG+ C T+INDC  + C NG  C DQV  + C 
Sbjct: 617  CSPNPCHNGATCTDQVADYNCQCVQGYTGKNCSTNINDCNPNQCQNGATCTDQVADYNCQ 676

Query: 364  CPVGFAGQ------------LCENGGTCVNTGDLYSCICKEGFEGPDCGQDINDCSPQPC 411
            C  G+ G+             C+NG TC +    YSC C +G+ G +C  +INDCSP PC
Sbjct: 677  CVQGYTGKNCSTNINDCNPNPCQNGATCTDQVADYSCTCVQGYTGKNCSTNINDCSPNPC 736

Query: 412  YNGGKCVDGVNWFLCECAPGFAGPDCRININECASNPCGYGKEILTVQSRSRSPAYLCVS 471
             NG  C D V  + C+C  G+ G +C  NIN+C+ NPC  G          +   Y C  
Sbjct: 737  QNGATCTDQVADYNCQCVQGYTGKNCSTNINDCSPNPCQNGATCT-----DQVADYNCQC 791

Query: 472  NPAYLVARCVSQSG-----------------GSFKCSCDAGFSGKYCHENINDCKHNPCQ 514
               Y    C +                      + C C  G++GK C  NINDC  NPCQ
Sbjct: 792  AQGYTGKNCSTNINNCNPNPCQNGATCTDQVADYNCQCAQGYTGKNCSTNINDCNPNPCQ 851

Query: 515  NGGTCVDKVNSFQCICRDGWEGEIC---------------ANSNQSGGSFKCSCDAGFSG 559
            NG TC D+V  + C C  G+ G+ C               A        + C C  G++G
Sbjct: 852  NGATCTDQVADYNCQCAQGYTGKNCSTNINNCNPNPCQNGATCTDQVADYNCQCAQGYTG 911

Query: 560  KYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANNKNECEPNPCKNNGTCI 619
            K C  NINDC  NPCQNG TC D+V  + C C  G+ G+ C+ N N+C PNPC+N  TC 
Sbjct: 912  KNCSTNINDCNPNPCQNGATCTDQVADYNCQCAQGYTGKNCSTNINDCNPNPCQNGATCT 971

Query: 620  DGHADFTCLCKNGWKGKTCTSKNGHCDRGTCKHGGTCADLGSSFFCHCPPDWEGTSCHIG 679
            D  AD+ C C  G+ GK C++    C+   C++G TC D  + + C C   + G +C   
Sbjct: 972  DQVADYNCQCVQGYTGKNCSTNINDCNPNPCQNGATCTDQVADYNCQCAQGYTGKNCST- 1030

Query: 680  KLNACKSNPCKNGGTCVNTGDLYSCICKEGFV 711
             +N C  NPC+NG TC +    Y+C C +G+ 
Sbjct: 1031 NINDCNPNPCQNGATCTDQVADYNCQCVQGYT 1062

Source: Amphimedon queenslandica

Species: Amphimedon queenslandica

Genus: Amphimedon

Family: Niphatidae

Order: Haplosclerida

Class: Demospongiae

Phylum: Porifera

Superkingdom: Eukaryota
>gi|260815375|ref|XP_002602449.1| hypothetical protein BRAFLDRAFT_63459 [Branchiostoma floridae] gi|229287758|gb|EEN58461.1| hypothetical protein BRAFLDRAFT_63459 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|291234019|ref|XP_002736950.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|390343533|ref|XP_781600.3| PREDICTED: uncharacterized protein LOC576169 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|390339335|ref|XP_797229.3| PREDICTED: neurogenic locus Notch protein-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|291234025|ref|XP_002736953.1| PREDICTED: neurogenic locus notch homolog protein 2-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|390333862|ref|XP_780540.3| PREDICTED: fibrillin-2-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|340373673|ref|XP_003385365.1| PREDICTED: neurogenic locus notch homolog protein 1 [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|390333826|ref|XP_003723784.1| PREDICTED: neurogenic locus notch homolog protein 1-like isoform 1 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|156398660|ref|XP_001638306.1| predicted protein [Nematostella vectensis] gi|156225425|gb|EDO46243.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query721
ZFIN|ZDB-GENE-990415-183 2465 notch1b "notch homolog 1b" [Da 0.919 0.268 0.354 1.6e-136
UNIPROTKB|Q90819 1193 JAG1 "Delta-like protein" [Gal 0.918 0.554 0.375 3.8e-133
UNIPROTKB|P21783 2524 notch1 "Neurogenic locus notch 0.900 0.257 0.360 2.9e-131
UNIPROTKB|I3L9D5 1175 NOTCH3 "Uncharacterized protei 0.901 0.553 0.363 8.1e-131
ZFIN|ZDB-GENE-000329-5 2468 notch3 "notch homolog 3" [Dani 0.905 0.264 0.361 9.3e-131
ZFIN|ZDB-GENE-990415-173 2437 notch1a "notch homolog 1a" [Da 0.912 0.270 0.343 3.6e-129
UNIPROTKB|F1MSM3 2534 NOTCH1 "Uncharacterized protei 0.897 0.255 0.360 6.6e-129
UNIPROTKB|P46531 2555 NOTCH1 "Neurogenic locus notch 0.911 0.257 0.335 1.1e-128
MGI|MGI:1095416 1218 Jag1 "jagged 1" [Mus musculus 0.876 0.518 0.371 4.6e-128
RGD|2937 1219 Jag1 "jagged 1" [Rattus norveg 0.887 0.525 0.369 9.6e-128
ZFIN|ZDB-GENE-990415-183 notch1b "notch homolog 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 1349 (479.9 bits), Expect = 1.6e-136, P = 1.6e-136
 Identities = 274/772 (35%), Positives = 378/772 (48%)

Query:     6 LLSDLNYCGTHEPCQNGGTCE-NTAPDQYLCTCPEGFSGINCEVVDNPCMMG--PCGNGG 62
             LL  L+      PCQ G  C+ N    + +CTCP G+ G  C+   + C +G  PC + G
Sbjct:   388 LLCHLDDACISNPCQKGSNCDTNPVNGKAICTCPLGYVGPACDQDVDECSLGANPCEHAG 447

Query:    63 QCKETAGQFQCVCAPGWTGPTCKIKHN---FFPYLQFIPLTTSL--FRLLSDLNYCG--- 114
             +C  T G FQC C  G+ G  C++  N     P          +  F  +    Y G   
Sbjct:   448 KCINTKGSFQCKCLQGYVGARCELDINECLSTPCQNDATCLDQIGGFHCICMPGYEGVFC 507

Query:   115 ---THE----PCQNGGTCENTAPDQYLCTCPEGFSGINCEVVDNPCMMGPCGNGGQCKET 167
                T E    PC N G C +   + Y C CP GFSG  C+   + C   PC NG +C + 
Sbjct:   508 QINTDECASMPCLNNGKCIDKI-NNYQCECPTGFSGSQCQFDIDECASTPCKNGAKCMDG 566

Query:   168 AGQFQC------------VDHDHCNPNPCLNGAPCFNTQADYYCHCTEDWEGKNCSFPRY 215
                + C             D D C  NPC  G  C +  A + C C   + G+ C     
Sbjct:   567 PNMYTCQCTEGYTGQHCETDVDECLSNPCHYGT-CKDGLASFTCVCRAGFMGRLCEI--- 622

Query:   216 KCDNPPCDDIDECVSNPCQNGGTCVDLVDGYKCECTQAWEGSNCQYDADECQKSPCVNAA 275
                     +I+EC+S PCQNGGTC D  + Y C C +   G+NC+ + D+CQ +PC    
Sbjct:   623 --------NINECLSQPCQNGGTCQDRENAYLCVCPKGTAGANCEINLDDCQSNPCDFGR 674

Query:   276 LGCTNLVGDYRCNCSPGWTGHNCDVNINDC-VGQCRHGSTCIDLVNDFHCACLPGYTGRT 334
               C + +  Y C C PG+TG  C++NI++C +  C +G TC+D VN F C C  GY   T
Sbjct:   675 --CIDKINGYECACEPGYTGKMCNINIDECAINPCHNGGTCVDGVNGFTCLCREGYHDTT 732

Query:   335 CQTDINDCESSPCVNGGECVDQVNGFRCICPVGFAGQLCE------------NGGTCVNT 382
             CQ+ +N+C S+PC++G  C D+VNG+ CIC  G++G  C+            NGGTC + 
Sbjct:   733 CQSQLNECLSNPCIHG-HCEDKVNGYNCICDSGWSGVNCDINNNECESNPCMNGGTCKDM 791

Query:   383 GDLYSCICKEGFEGPDCGQDINDCSPQPCYNGGKCVDGVNWFLCECAPGFAGPDCRININ 442
                Y C C+ GF GP+C  +IN+C+  PC N G C+D V  + C C   + G  C ++IN
Sbjct:   792 TSGYVCTCRAGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGQTCEVDIN 851

Query:   443 ECASNPCGYGKEILTVQSRSRSPAYLCVSNPAYLVARCVSQSGGSFKCSCDAGFSGKYCH 502
             EC  NPC             R+ A +C              S GS+KCSC AG++G+ C 
Sbjct:   852 ECVKNPC-------------RNDA-IC------------QNSIGSYKCSCKAGYTGRNCE 885

Query:   503 ENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEIC---------------ANSNQSGG 547
              +I+DCK NPC NGG C D VN+F C C  G+ G  C               AN      
Sbjct:   886 TDIDDCKPNPCSNGGFCKDAVNAFACTCLPGFRGGRCEEDINECESNPCKNGANCTDCVN 945

Query:   548 SFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICANNKNEC 607
             S+ C+C  GFSG +C  N  DC  + C NGGTCVD +NSF C+C  G+ G  C ++ NEC
Sbjct:   946 SYTCTCPPGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPKGFTGNYCQHDINEC 1005

Query:   608 EPNPCKNNGTCIDGHADFTCLCKNGWKGKTCTSKNGHCDRGTCKHGGTCADLGSSFFCHC 667
             +  PC N GTC D +  + C C  G+ G  C      C    CK+GG C   G+ + C C
Sbjct:  1006 DSRPCMNGGTCQDSYGTYKCTCPQGYHGLNCQELVNWCKPSPCKNGGICRQSGTRYSCQC 1065

Query:   668 PPDWEGTSCHIGKLN---ACKSNP------CKNGGTCVNTGDLYSCICKEGF 710
                W G  C +  ++   A K         C+N G C++ G+ + C C+ G+
Sbjct:  1066 QTGWTGLYCDVPSVSCEVAAKQQGVDVVRLCRNSGQCLDAGNTHYCHCQAGY 1117
GO:0030154 "cell differentiation" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0007219 "Notch signaling pathway" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
GO:0050793 "regulation of developmental process" evidence=IEA
GO:0004872 "receptor activity" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0007275 "multicellular organismal development" evidence=IEA
GO:0001568 "blood vessel development" evidence=IMP
GO:0001946 "lymphangiogenesis" evidence=IMP
GO:0048936 "peripheral nervous system neuron axonogenesis" evidence=IGI
GO:0021654 "rhombomere boundary formation" evidence=IGI
UNIPROTKB|Q90819 JAG1 "Delta-like protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P21783 notch1 "Neurogenic locus notch protein homolog" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|I3L9D5 NOTCH3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000329-5 notch3 "notch homolog 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-173 notch1a "notch homolog 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSM3 NOTCH1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P46531 NOTCH1 "Neurogenic locus notch homolog protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1095416 Jag1 "jagged 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2937 Jag1 "jagged 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query721
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 2e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 5e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 8e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 8e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 4e-05
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 4e-05
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 5e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 9e-05
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 1e-04
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 1e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 1e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 1e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 1e-04
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 8e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 0.001
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 0.001
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 0.001
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 0.002
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information 
 Score = 44.5 bits (106), Expect = 2e-06
 Identities = 23/38 (60%), Positives = 27/38 (71%), Gaps = 1/38 (2%)

Query: 224 DIDECVS-NPCQNGGTCVDLVDGYKCECTQAWEGSNCQ 260
           DIDEC S NPCQNGGTCV+ V  Y+C C   + G NC+
Sbjct: 1   DIDECASGNPCQNGGTCVNTVGSYRCSCPPGYTGRNCE 38

Many of these proteins require calcium for their biological function and calcium-binding sites have been found to be located at the N-terminus of particular EGF-like domains; calcium-binding may be crucial for numerous protein-protein interactions. Six conserved core cysteines form three disulfide bridges as in non calcium-binding EGF domains, whose structures are very similar. EGF_CA can be found in tandem repeat arrangements. Length = 38
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 721
KOG1217|consensus487 99.81
KOG1217|consensus487 99.81
KOG4289|consensus 2531 99.79
KOG4289|consensus 2531 99.77
KOG0994|consensus 1758 99.64
KOG0994|consensus 1758 99.61
KOG1219|consensus 4289 99.53
KOG1219|consensus 4289 99.53
KOG1214|consensus1289 99.46
KOG1214|consensus1289 99.35
KOG1836|consensus 1705 99.33
KOG1836|consensus 1705 99.32
KOG1225|consensus 525 99.31
KOG1225|consensus 525 99.28
KOG4260|consensus350 98.91
KOG4260|consensus350 98.74
KOG1226|consensus 783 98.49
KOG1226|consensus 783 98.42
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.85
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.82
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.78
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.71
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.71
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.7
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 97.37
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.36
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.28
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 97.26
PF1266224 cEGF: Complement Clr-like EGF-like 97.09
cd0005336 EGF Epidermal growth factor domain, found in epide 96.88
cd0005336 EGF Epidermal growth factor domain, found in epide 96.86
smart0018135 EGF Epidermal growth factor-like domain. 96.8
smart0018135 EGF Epidermal growth factor-like domain. 96.75
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 96.48
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 96.38
KOG1218|consensus316 96.34
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.31
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.26
KOG1218|consensus316 96.25
KOG3512|consensus592 95.8
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 95.4
PF1266224 cEGF: Complement Clr-like EGF-like 95.04
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 94.73
KOG3512|consensus592 94.64
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 94.38
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 94.05
smart0005163 DSL delta serrate ligand. 92.45
smart0005163 DSL delta serrate ligand. 92.28
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 91.37
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 91.1
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 89.27
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 88.78
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 85.97
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 85.64
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 84.66
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 83.86
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 81.32
>KOG1217|consensus Back     alignment and domain information 
Probab=99.81  E-value=5.7e-18  Score=190.82  Aligned_cols=256  Identities=36%  Similarity=0.970  Sum_probs=201.8

Q ss_pred             CccccccCCCCCCCCCCcCCCCCC--CCCCCCCCEEeeCCCceEEecCCCccCCCCcccCcccCCCCCCCCceeeccCCC
Q psy17084        384 DLYSCICKEGFEGPDCGQDINDCS--PQPCYNGGKCVDGVNWFLCECAPGFAGPDCRININECASNPCGYGKEILTVQSR  461 (721)
Q Consensus       384 ~~~~C~C~~G~~G~~C~~~~~~C~--~~~C~~~g~C~~~~g~~~C~C~~Gy~G~~C~~~~~~C~~~~C~~g~~~~~~~~~  461 (721)
                      ..+.|.|..||.+..+....++|.  ..+|.+++.|.+..++|.|.|+++|++..++..         ..+         
T Consensus       150 ~~~~c~C~~g~~~~~~~~~~~~C~~~~~~c~~~~~C~~~~~~~~C~c~~~~~~~~~~~~---------~~~---------  211 (487)
T KOG1217|consen  150 GPFRCSCTEGYEGEPCETDLDECIQYSSPCQNGGTCVNTGGSYLCSCPPGYTGSTCETT---------GNG---------  211 (487)
T ss_pred             CceeeeeCCCcccccccccccccccCCCCcCCCcccccCCCCeeEeCCCCccCCcCcCC---------CCC---------
Confidence            467788888888888876657776  456999999999999999999999999988642         111         


Q ss_pred             CCCCCccccCCCccccceeeecCCCceEeccCCCCCCCcccccCCCCCCCCCCCCCEEecCCCCeeeecCCCcccccccC
Q psy17084        462 SRSPAYLCVSNPAYLVARCVSQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQCICRDGWEGEICAN  541 (721)
Q Consensus       462 ~~~~~~~C~~~~~~~~~~C~~~~~~~~~C~C~~G~~G~~C~~~~~~C~~~~C~~~g~C~~~~g~~~C~C~~G~~G~~C~~  541 (721)
                                      +.|...    +.|.+..||.+..+...+.++...   + ++|.+..++|+|.|++||.+..+  
T Consensus       212 ----------------~~c~~~----~~~~~~~g~~~~~c~~~~~~~~~~---~-~~c~~~~~~~~C~~~~g~~~~~~--  265 (487)
T KOG1217|consen  212 ----------------GTCVDS----VACSCPPGARGPECEVSIVECASG---D-GTCVNTVGSYTCRCPEGYTGDAC--  265 (487)
T ss_pred             ----------------ceEecc----eeccCCCCCCCCCcccccccccCC---C-CcccccCCceeeeCCCCcccccc--
Confidence                            233332    578999999999998888777655   5 89999999999999999987642  


Q ss_pred             CCCCCCCceeeCCCCccCCccccCCCCCCCCC-CCCCCEEeecCCCeEEeccCCCccCcc--cccCCCC----CCCCCCC
Q psy17084        542 SNQSGGSFKCSCDAGFSGKYCHENINDCKHNP-CQNGGTCVDKVNSFQCICRDGWEGEIC--ANNKNEC----EPNPCKN  614 (721)
Q Consensus       542 ~~~~~~~~~C~C~~G~~G~~C~~~~~~C~~~~-C~~~g~C~~~~~~~~C~C~~G~~G~~C--~~~~~~C----~~~~C~~  614 (721)
                                         ....++++|...+ |.++++|++..+.|.|.|++||+|..+  .....+|    ...+|.+
T Consensus       266 -------------------~~~~~~~~C~~~~~c~~~~~C~~~~~~~~C~C~~g~~g~~~~~~~~~~~C~~~~~~~~c~~  326 (487)
T KOG1217|consen  266 -------------------VTCVDVDSCALIASCPNGGTCVNVPGSYRCTCPPGFTGRLCTECVDVDECSPRNAGGPCAN  326 (487)
T ss_pred             -------------------ceeeeccccCCCCccCCCCeeecCCCcceeeCCCCCCCCCCccccccccccccccCCcCCC
Confidence                               1124678887764 999999999998899999999999998  2344677    4567998


Q ss_pred             CcEE--eeCCCCeEEecCCCCccccccCCCCCCCCCCCCCCCeeee-cCCCceeeCCCCCCCC-c---cccCccCCCCCC
Q psy17084        615 NGTC--IDGHADFTCLCKNGWKGKTCTSKNGHCDRGTCKHGGTCAD-LGSSFFCHCPPDWEGT-S---CHIGKLNACKSN  687 (721)
Q Consensus       615 ~g~C--~~~~~~~~C~C~~G~~G~~C~~~~~~C~~~~C~~~~~C~~-~~~~~~C~C~~G~~G~-~---C~~~~~~~C~~~  687 (721)
                      +++|  ......+.|.|..||.|..|+...++|...++..++.|.+ ..+.|.|.|+.+|.+. .   -...++++|.. 
T Consensus       327 g~~C~~~~~~~~~~C~c~~~~~g~~C~~~~~~C~~~~~~~~~~c~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~c~~-  405 (487)
T KOG1217|consen  327 GGTCNTLGSFGGFRCACGPGFTGRRCEDSNDECASSPCCPGGTCVNETPGSYRCACPAGFAGKANGDGVGCEDIDECSG-  405 (487)
T ss_pred             CcccccCCCCCCCCcCCCCCCCCCccccCCccccCCccccCCEeccCCCCCeEecCCCccccCCccccccccccccccC-
Confidence            8899  3344578899999999999987656898888999999999 6889999999999984 1   11224455544 


Q ss_pred             CCCCCCeEeeCCCceeeecCC
Q psy17084        688 PCKNGGTCVNTGDLYSCICKE  708 (721)
Q Consensus       688 ~C~~~~~C~~~~~~~~C~C~~  708 (721)
                          .+.|++..+++.|. ++
T Consensus       406 ----~~~c~~~~~~~~c~-~~  421 (487)
T KOG1217|consen  406 ----CGDCVNGPGGGACT-PP  421 (487)
T ss_pred             ----CcceeccCCCCccc-cC
Confidence                56799999999999 87

>KOG1217|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query721
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 3e-22
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 2e-18
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 3e-16
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 3e-10
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 3e-22
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 2e-18
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 2e-16
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 4e-10
4d90_A143 Crystal Structure Of Del-1 Egf Domains Length = 143 2e-13
4d90_A143 Crystal Structure Of Del-1 Egf Domains Length = 143 5e-12
4d90_A143 Crystal Structure Of Del-1 Egf Domains Length = 143 3e-10
4d90_A143 Crystal Structure Of Del-1 Egf Domains Length = 143 2e-09
2vj2_A169 Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 3e-12
2vj2_A169 Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 8e-04
2ygq_A324 Wif Domain-Epidermal Growth Factor (Egf)-Like Domai 3e-09
2ygq_A324 Wif Domain-Epidermal Growth Factor (Egf)-Like Domai 1e-05
1dan_L152 Complex Of Active Site Inhibited Human Blood Coagul 5e-06
1z6j_L142 Crystal Structure Of A Ternary Complex Of Factor Vi 5e-06
1dva_L101 Crystal Structure Of The Complex Between The Peptid 5e-06
1w0y_L142 Tf7a_3771 Complex Length = 142 5e-06
1o5d_L152 Dissecting And Designing Inhibitor Selectivity Dete 6e-06
1j9c_L95 Crystal Structure Of Tissue Factor-Factor Viia Comp 7e-06
1qfk_L104 Structure Of Human Factor Viia And Its Implications 3e-05
2puq_L94 Crystal Structure Of Active Site Inhibited Coagulat 3e-05
2rqz_A38 Structure Of Sugar Modified Epidermal Growth Factor 5e-05
2rqz_A38 Structure Of Sugar Modified Epidermal Growth Factor 5e-05
1lmj_A86 Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 5e-05
1edm_B39 Epidermal Growth Factor-Like Domain From Human Fact 9e-05
1f7e_A46 The First Egf-Like Domain From Human Blood Coagulat 1e-04
1x7a_L146 Porcine Factor Ixa Complexed To 1-{3-[amino(Imino) 1e-04
1bf9_A41 N-Terminal Egf-Like Domain From Human Factor Vii, N 3e-04
3h5c_B317 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 3e-04
3h5c_B 317 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 4e-04
1nfu_B195 Crystal Structure Of Human Coagulation Factor Xa Co 8e-04
1pfx_L146 Porcine Factor Ixa Length = 146 8e-04
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure 
Iteration: 1

 Score =  103 bits (257), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 77/116 (66%), Gaps = 4/116 (3%)
Query: 262 DADECQ--KSPCVNAALGCTNLVGDYRCNCSPGWTGHNCDVNINDCVGQ-CRHGSTCIDL 318
           D DEC    +PC +A   C N +G + C C  G+TG  C++++N+CV   C++ +TC+D 
Sbjct: 2   DVDECSLGANPCEHAG-KCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQ 60
Query: 319 VNDFHCACLPGYTGRTCQTDINDCESSPCVNGGECVDQVNGFRCICPVGFAGQLCE 374
           + +F C C+PGY G  C+ + ++C SSPC++ G C+D++N F+C CP GF G LC+
Sbjct: 61  IGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQ 116
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|4D90|A Chain A, Crystal Structure Of Del-1 Egf Domains Length = 143 Back     alignment and structure
>pdb|4D90|A Chain A, Crystal Structure Of Del-1 Egf Domains Length = 143 Back     alignment and structure
>pdb|4D90|A Chain A, Crystal Structure Of Del-1 Egf Domains Length = 143 Back     alignment and structure
>pdb|4D90|A Chain A, Crystal Structure Of Del-1 Egf Domains Length = 143 Back     alignment and structure
>pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 Back     alignment and structure
>pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 Back     alignment and structure
>pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 Back     alignment and structure
>pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 Back     alignment and structure
>pdb|1DAN|L Chain L, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 152 Back     alignment and structure
>pdb|1Z6J|L Chain L, Crystal Structure Of A Ternary Complex Of Factor Viia/tissue Factor/pyrazinone Inhibitor Length = 142 Back     alignment and structure
>pdb|1DVA|L Chain L, Crystal Structure Of The Complex Between The Peptide Exosite Inhibitor E-76 And Coagulation Factor Viia Length = 101 Back     alignment and structure
>pdb|1W0Y|L Chain L, Tf7a_3771 Complex Length = 142 Back     alignment and structure
>pdb|1O5D|L Chain L, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 152 Back     alignment and structure
>pdb|1J9C|L Chain L, Crystal Structure Of Tissue Factor-Factor Viia Complex Length = 95 Back     alignment and structure
>pdb|1QFK|L Chain L, Structure Of Human Factor Viia And Its Implications For The Triggering Of Blood Coagulation Length = 104 Back     alignment and structure
>pdb|2PUQ|L Chain L, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia In Complex With Soluble Tissue Factor Length = 94 Back     alignment and structure
>pdb|2RQZ|A Chain A, Structure Of Sugar Modified Epidermal Growth Factor-Like Repeat 12 Of Mouse Notch-1 Receptor Length = 38 Back     alignment and structure
>pdb|2RQZ|A Chain A, Structure Of Sugar Modified Epidermal Growth Factor-Like Repeat 12 Of Mouse Notch-1 Receptor Length = 38 Back     alignment and structure
>pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 Back     alignment and structure
>pdb|1EDM|B Chain B, Epidermal Growth Factor-Like Domain From Human Factor Ix Length = 39 Back     alignment and structure
>pdb|1F7E|A Chain A, The First Egf-Like Domain From Human Blood Coagulation Fvii, Nmr, 20 Structures Length = 46 Back     alignment and structure
>pdb|1X7A|L Chain L, Porcine Factor Ixa Complexed To 1-{3-[amino(Imino) Methyl]phenyl}-N-[4-(1h-Benzimidazol-1-Yl)-2- Fluorophenyl]- 3-(Trifluoromethyl)-1h-Pyrazole-5-Carboxamide Length = 146 Back     alignment and structure
>pdb|1BF9|A Chain A, N-Terminal Egf-Like Domain From Human Factor Vii, Nmr, 23 Structures Length = 41 Back     alignment and structure
>pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 Back     alignment and structure
>pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 Back     alignment and structure
>pdb|1NFU|B Chain B, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr132747 Length = 195 Back     alignment and structure
>pdb|1PFX|L Chain L, Porcine Factor Ixa Length = 146 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query721
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 3e-35
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-34
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-33
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-32
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-31
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-30
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-30
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 4e-26
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 3e-12
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-32
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-32
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-31
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-30
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 6e-29
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-25
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-24
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 6e-22
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 8e-20
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-15
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-08
2vh0_B134 Activated factor XA light chain; serine protease, 1e-30
2vh0_B134 Activated factor XA light chain; serine protease, 7e-28
2vh0_B134 Activated factor XA light chain; serine protease, 3e-27
2vh0_B134 Activated factor XA light chain; serine protease, 1e-26
2vh0_B134 Activated factor XA light chain; serine protease, 2e-25
2vh0_B134 Activated factor XA light chain; serine protease, 8e-25
2vh0_B134 Activated factor XA light chain; serine protease, 4e-24
2vh0_B134 Activated factor XA light chain; serine protease, 6e-22
2vh0_B134 Activated factor XA light chain; serine protease, 1e-21
2vh0_B134 Activated factor XA light chain; serine protease, 1e-21
2vh0_B134 Activated factor XA light chain; serine protease, 4e-19
2vh0_B134 Activated factor XA light chain; serine protease, 1e-16
2vh0_B134 Activated factor XA light chain; serine protease, 1e-06
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 3e-30
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 5e-30
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 1e-28
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 6e-28
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 4e-26
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 6e-24
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 5e-23
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 5e-19
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 1e-17
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 3e-09
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 9e-30
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-27
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-27
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 9e-26
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 5e-24
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 7e-13
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 3e-25
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-24
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-23
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 9e-23
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-22
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-22
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-21
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 5e-19
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-17
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 7e-17
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 1e-12
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 2e-12
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-24
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-23
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-21
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 3e-20
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-20
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 1e-19
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-19
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 7e-16
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 5e-15
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-11
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 4e-06
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 2e-21
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 2e-21
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-20
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-20
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 4e-20
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 2e-16
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 5e-15
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 6e-10
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 6e-10
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 7e-10
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 5e-06
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 5e-18
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 3e-16
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 1e-15
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 5e-15
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 3e-14
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 7e-07
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 3e-06
1aut_L114 Activated protein C; serine proteinase, plasma cal 3e-17
1aut_L114 Activated protein C; serine proteinase, plasma cal 1e-16
1aut_L114 Activated protein C; serine proteinase, plasma cal 6e-16
1aut_L114 Activated protein C; serine proteinase, plasma cal 9e-15
1aut_L114 Activated protein C; serine proteinase, plasma cal 1e-14
1aut_L114 Activated protein C; serine proteinase, plasma cal 7e-12
1aut_L114 Activated protein C; serine proteinase, plasma cal 1e-11
1aut_L114 Activated protein C; serine proteinase, plasma cal 1e-10
1aut_L114 Activated protein C; serine proteinase, plasma cal 9e-10
1aut_L114 Activated protein C; serine proteinase, plasma cal 4e-09
1aut_L114 Activated protein C; serine proteinase, plasma cal 1e-08
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 1e-15
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 3e-11
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 5e-11
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-09
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 3e-09
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 6e-09
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 6e-09
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-08
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 4e-15
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 6e-15
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 3e-14
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 1e-13
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 5e-13
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 8e-12
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 2e-08
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 2e-06
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 4e-15
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 1e-14
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-11
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-11
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 5e-11
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 4e-10
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 1e-09
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 5e-09
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 6e-08
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 1e-07
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-07
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-06
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 7e-06
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-14
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-07
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 2e-06
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-14
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 4e-11
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-10
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-08
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-08
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-05
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-14
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-13
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-12
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-11
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-11
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 3e-11
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 6e-11
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 3e-07
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 9e-14
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 5e-12
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 3e-10
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-08
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 9e-07
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 1e-05
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 2e-11
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 1e-10
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 1e-09
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 1e-09
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 9e-09
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 1e-07
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 9e-07
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 2e-05
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 4e-05
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 4e-05
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 3e-04
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 4e-04
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 3e-11
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-10
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-09
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-08
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-08
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-07
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-06
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-06
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-05
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-05
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-05
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-05
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 8e-05
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-04
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-04
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-04
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-04
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-04
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 4e-04
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 6e-04
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 8e-04
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 1e-10
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 1e-10
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 1e-10
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 3e-10
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 7e-09
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 5e-08
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 2e-07
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 3e-07
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 7e-06
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 4e-05
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 7e-05
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 9e-04
2bou_A143 EGF-like module containing mucin-like hormone rece 4e-09
2bou_A143 EGF-like module containing mucin-like hormone rece 5e-07
2bou_A143 EGF-like module containing mucin-like hormone rece 4e-06
2bou_A143 EGF-like module containing mucin-like hormone rece 3e-05
2bou_A143 EGF-like module containing mucin-like hormone rece 6e-05
2bou_A143 EGF-like module containing mucin-like hormone rece 4e-04
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 2e-08
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 2e-07
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 9e-06
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 1e-05
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 3e-05
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 8e-05
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 1e-04
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 3e-08
4dur_A 791 Plasminogen, serine protease; fibrinolysis, hydrol 6e-05
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 4e-08
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 4e-07
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 4e-06
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 1e-05
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-05
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 5e-05
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-04
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 8e-04
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 5e-07
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 1e-04
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 6e-07
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 3e-06
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 3e-06
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 5e-06
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 1e-05
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 1e-05
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 2e-05
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 8e-04
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-05
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-04
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-05
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-05
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 7e-05
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 1e-04
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 1e-04
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 1e-04
3nxp_A 424 Prethrombin-1; allostery, blood coagulation, hydro 1e-04
3nxp_A 424 Prethrombin-1; allostery, blood coagulation, hydro 2e-04
3nt1_A587 Prostaglandin-endoperoxide synthase 2; prostagland 1e-04
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-04
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-04
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 2e-04
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 2e-04
3p5b_L400 Low density lipoprotein receptor variant; B-propel 3e-04
3p5b_L400 Low density lipoprotein receptor variant; B-propel 3e-04
3v65_B 386 Low-density lipoprotein receptor-related protein; 3e-04
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 6e-04
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
 Score =  129 bits (326), Expect = 3e-35
 Identities = 51/161 (31%), Positives = 82/161 (50%), Gaps = 31/161 (19%)

Query: 258 NCQYDADECQK--SPCVNAALGCTNLVGDYRCNCSPGWTGHNCDVNINDCVGQ-CRHGST 314
           + Q D DEC    +PC +A   C N +G + C C  G+TG  C++++N+CV   C++ +T
Sbjct: 1   SAQ-DVDECSLGANPCEHAGK-CINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDAT 58

Query: 315 CIDLVNDFHCACLPGYTGRTCQTDINDCESSPCVNGGECVDQVNGFRCICPVGFAGQLCE 374
           C+D + +F C C+PGY G  C+ + ++C SSPC++ G C+D++N F+C CP GF G LC+
Sbjct: 59  CLDQIGEFQCICMPGYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQ 118

Query: 375 NGGTCVNTGDLYSCICKEGFEGPDCGQDINDCSPQPCYNGG 415
                                      D++           
Sbjct: 119 --------------------------VDLHHILDAQKMVWN 133
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query721
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.94
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.92
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.87
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.87
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.86
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.84
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.79
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.78
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.78
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.77
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.77
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.74
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.72
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.7
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.69
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.65
2bou_A143 EGF-like module containing mucin-like hormone rece 99.63
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.62
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.61
2bou_A143 EGF-like module containing mucin-like hormone rece 99.6
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.59
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.57
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.55
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.54
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.53
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.52
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.5
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.49
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.48
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.48
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.46
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.42
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.33
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.29
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.25
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.25
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.25
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.23
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.22
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.22
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.2
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.18
2vh0_B134 Activated factor XA light chain; serine protease, 99.17
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.16
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.16
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.14
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.12
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.07
2vh0_B134 Activated factor XA light chain; serine protease, 99.04
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.01
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.96
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.89
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.88
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.83
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.81
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.79
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.75
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.68
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.68
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.64
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.56
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.51
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.49
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.43
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.33
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.29
3v65_B386 Low-density lipoprotein receptor-related protein; 98.27
3v65_B386 Low-density lipoprotein receptor-related protein; 98.25
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.25
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.23
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.16
1a3p_A45 Epidermal growth factor; disulfide connectivities, 98.06
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 98.05
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 98.04
2k2s_B61 Micronemal protein 6; microneme protein complex, c 98.01
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.99
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.98
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.93
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.89
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.87
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.87
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.79
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.79
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.64
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.39
1nql_B53 Epidermal growth factor; cell surface receptor, ty 97.32
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.32
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 97.24
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.12
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.08
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 97.04
1ob1_C99 Major merozoite surface protein; immune system, im 96.99
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 96.96
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.71
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 96.7
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 96.6
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 96.55
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.49
1ob1_C99 Major merozoite surface protein; immune system, im 96.46
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.31
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.3
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 96.3
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 96.21
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 96.2
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 96.16
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.09
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 96.09
2y38_A403 Laminin subunit alpha-5; structural protein, cell 95.97
2y38_A403 Laminin subunit alpha-5; structural protein, cell 95.96
2i9a_A145 Urokinase-type plasminogen activator; growth facto 95.94
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 95.91
3nt1_A587 Prostaglandin-endoperoxide synthase 2; prostagland 95.91
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 95.29
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 95.27
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 95.12
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 95.08
2i9a_A145 Urokinase-type plasminogen activator; growth facto 94.97
3nt1_A587 Prostaglandin-endoperoxide synthase 2; prostagland 94.93
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 94.01
2wph_E59 Coagulation factor IXA light chain; serine proteas 93.91
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 93.68
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 93.58
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 93.5
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 93.33
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 93.24
1szb_A170 Mannose binding lectin-associated serine protease- 93.22
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 93.22
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 93.19
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 93.18
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 93.16
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 93.15
1szb_A170 Mannose binding lectin-associated serine protease- 93.13
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 92.59
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 91.5
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 91.5
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 91.12
1b9w_A95 Protein (merozoite surface protein 1); MSP-1, cand 90.95
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 90.12
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 89.84
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 89.33
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 89.01
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 88.87
1nzi_A159 Complement C1S component; calcium, innate immunity 86.72
2wph_E59 Coagulation factor IXA light chain; serine proteas 86.19
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 84.24
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 82.81
1nzi_A159 Complement C1S component; calcium, innate immunity 82.43
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 82.25
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 81.89
2e26_A 725 Reelin, reeler protein; signaling protein; HET: NA 81.05
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
Probab=99.94  E-value=4.4e-31  Score=261.69  Aligned_cols=247  Identities=15%  Similarity=0.146  Sum_probs=192.7

Q ss_pred             eeeccCCccccccCCC---CCCCCCCcCCCCCCCCCCCCCCEEeeCCCceEEecCCCccCCCCcccCcc------cCCCC
Q psy17084        378 TCVNTGDLYSCICKEG---FEGPDCGQDINDCSPQPCYNGGKCVDGVNWFLCECAPGFAGPDCRININE------CASNP  448 (721)
Q Consensus       378 ~C~~~~~~~~C~C~~G---~~G~~C~~~~~~C~~~~C~~~g~C~~~~g~~~C~C~~Gy~G~~C~~~~~~------C~~~~  448 (721)
                      ++.|..+.+++.+.+|   |.|..+++++..+.. +|.++|+|++..++|+|+|++||+|++|+++|++      |...|
T Consensus         5 ~~~n~~Gg~s~~~~pgg~~~~g~~~~~n~~~~~~-~c~ngG~C~~g~~~y~C~Cp~Gf~G~~Ce~ni~ec~~~~~c~s~p   83 (267)
T 4fbr_A            5 LVQNQWGGSQATWNPGGLWLIGARDKQNVVALDI-KSDDGGKTLKGTMTYNGEGPIGFRGTLSSANNYTVENQWGGTSAP   83 (267)
T ss_dssp             EEEEECSSTTSCCEEEEEEECCCCSSCCEEEEEE-ECSSTTSEEEEEEEETTSCCEEEEEEECSTTEEEEEEESSSTTSC
T ss_pred             eEeecCCcccCCcCCCCceeeccccccccccCCC-CcCCCCeecCCCCCeEEeCCCCcccccccccccccccccCcCCCc
Confidence            3556777888888888   677777777766554 7889999999999999999999999999999999      55555


Q ss_pred             CCCCceeeccCCCCCCCCccccCCCccccceeeecCCCceEeccCCCCCCCcccccCCCCCCCCCCCCCEEecCCCCeee
Q psy17084        449 CGYGKEILTVQSRSRSPAYLCVSNPAYLVARCVSQSGGSFKCSCDAGFSGKYCHENINDCKHNPCQNGGTCVDKVNSFQC  528 (721)
Q Consensus       449 C~~g~~~~~~~~~~~~~~~~C~~~~~~~~~~C~~~~~~~~~C~C~~G~~G~~C~~~~~~C~~~~C~~~g~C~~~~g~~~C  528 (721)
                      |.++                                   ++|     |.|..|+. +++|.+.||.++|+|++..++|+|
T Consensus        84 C~ng-----------------------------------gtc-----~~G~~c~~-~~eC~s~pC~ngG~C~~~~~sy~C  122 (267)
T 4fbr_A           84 WQPG-----------------------------------GVW-----VLGARDKQ-NIVAVSIKSNDGGKTLTGTTTYNG  122 (267)
T ss_dssp             EEEE-----------------------------------EEE-----ECCCCSSC-CEEEEEEECSSTTSEEEEEEEETT
T ss_pred             ccCC-----------------------------------Cee-----eccCcccc-ccccCCCCCCCCCEEecCCccEEe
Confidence            5544                                   232     46777764 468999999999999999999888


Q ss_pred             ecCCCcccccccCCCCCCCCceeeCCCCccCCccccCCCC------CCCCCCCCCCEEeecCCCeEEeccCCCccCcccc
Q psy17084        529 ICRDGWEGEICANSNQSGGSFKCSCDAGFSGKYCHENIND------CKHNPCQNGGTCVDKVNSFQCICRDGWEGEICAN  602 (721)
Q Consensus       529 ~C~~G~~G~~C~~~~~~~~~~~C~C~~G~~G~~C~~~~~~------C~~~~C~~~g~C~~~~~~~~C~C~~G~~G~~C~~  602 (721)
                      .|++||+|..|+.                       ++++      |...||.++++|              |.|.+|+.
T Consensus       123 ~C~~Gf~G~~Ce~-----------------------~~d~C~n~~~c~s~pC~ngg~c--------------~~G~~c~~  165 (267)
T 4fbr_A          123 EGPIGFKSEVTDG-----------------------DTYSVENQWGGSAAPWHSGGVW--------------VLGTRGKQ  165 (267)
T ss_dssp             SCCEEEEEEECCC-----------------------CEEEEEEECSSTTSCCEEEEEE--------------ECCSSTTS
T ss_pred             eCCCCccccCCCC-----------------------CcccccccCCcCCccccCCcce--------------eccccccc
Confidence            8888888776654                       4555      444556555444              34677776


Q ss_pred             cCCCCCCCCCCCCcEEeeCCCCeEEecCCCCccccccCCCCCCCCCCCCCCCeeeecCCCceeeCCCCCCCCccccCccC
Q psy17084        603 NKNECEPNPCKNNGTCIDGHADFTCLCKNGWKGKTCTSKNGHCDRGTCKHGGTCADLGSSFFCHCPPDWEGTSCHIGKLN  682 (721)
Q Consensus       603 ~~~~C~~~~C~~~g~C~~~~~~~~C~C~~G~~G~~C~~~~~~C~~~~C~~~~~C~~~~~~~~C~C~~G~~G~~C~~~~~~  682 (721)
                      .++ +...||.++|+|++..++|+|+|++||+|.+|+.+++++...+....+.|++. +.+.+.|+.++.+..++.    
T Consensus       166 ~i~-c~~~~c~ngg~C~dg~~~y~C~Cp~Gf~G~~c~~~i~ec~~~~~c~~~~c~~g-G~~~~~C~~g~n~~~c~~----  239 (267)
T 4fbr_A          166 NVI-NVDAKSNDGGKTLSGTMTYNGEGPIGFRGTLTSPDTYTVENQWGGSTAPWNPG-GFWMIGARNGQNVVALNV----  239 (267)
T ss_dssp             CEE-EEEEECSSTTSEEEEEEEETTSCCEEEEEEEEETTEEEEEEECSCTTSCCEEE-EEEECCCCTTCCEEEEEE----
T ss_pred             ccc-cCCCCCCCCCEeeCCCCCeEEeCCCCccccccccccceeccCCCccCCcccCC-CeEEEecCCCCccccCCc----
Confidence            653 66778999999999999999999999999999999888654444444445443 345677999988777662    


Q ss_pred             CCCCCCCCCCCeEeeCCCceeeecCCCCccCC
Q psy17084        683 ACKSNPCKNGGTCVNTGDLYSCICKEGFVHAL  714 (721)
Q Consensus       683 ~C~~~~C~~~~~C~~~~~~~~C~C~~G~~g~~  714 (721)
                           ||.++++|++...+|.|+||+||+|.+
T Consensus       240 -----~c~ngGtC~dg~~sy~CeCp~GF~G~~  266 (267)
T 4fbr_A          240 -----ASSDGGKTLAGTMIYNGEGPIGFRARL  266 (267)
T ss_dssp             -----ECSSTTSEEEEEEEETTSCCEEEEEEE
T ss_pred             -----CCCCCCEeeCCCcceeecCCCCccccC
Confidence                 788999999999999999999999864
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1b9w_A Protein (merozoite surface protein 1); MSP-1, candidate malaria vaccine, surface antigen; 1.80A {Plasmodium cynomolgi} SCOP: g.3.11.4 g.3.11.4 PDB: 2npr_A Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 721
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-09
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-08
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 5e-08
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 7e-08
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 7e-08
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-06
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 8e-06
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-05
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-05
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-05
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-04
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-04
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 3e-04
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 3e-04
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 2e-09
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 4e-08
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 4e-08
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 6e-08
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 8e-08
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 1e-06
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 4e-06
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 1e-05
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 5e-05
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 1e-04
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 4e-04
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 4e-04
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 4e-04
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 5e-04
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 3e-09
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 3e-08
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 2e-07
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 3e-07
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 3e-07
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 3e-06
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 4e-05
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 4e-05
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 2e-04
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 2e-04
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 6e-04
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 9e-04
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 9e-04
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 0.003
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 1e-08
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 1e-07
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 2e-07
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 3e-07
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 3e-07
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 2e-06
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 8e-06
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 7e-05
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 8e-05
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 2e-04
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 3e-04
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 3e-04
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 4e-04
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 5e-04
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 4e-08
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 4e-07
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 9e-07
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 9e-07
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 4e-06
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 5e-06
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 1e-04
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 3e-04
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 3e-04
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 3e-04
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 9e-04
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 0.002
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 0.002
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 0.002
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 8e-08
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 5e-06
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 1e-05
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 1e-05
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 2e-05
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 5e-05
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.001
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.001
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.002
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.002
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.003
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.003
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.003
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 1e-07
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 3e-06
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 8e-06
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 1e-05
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 2e-05
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 6e-05
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 2e-04
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 0.001
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 0.001
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 0.002
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 0.002
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 0.003
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 2e-07
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 2e-06
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 4e-06
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 5e-06
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 6e-06
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 6e-05
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 2e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 3e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 4e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 4e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 7e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 0.001
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 0.001
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 0.003
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 1e-06
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 3e-06
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 3e-06
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 1e-05
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 3e-04
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 3e-04
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 3e-04
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 0.002
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 0.002
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 5e-05
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 1e-04
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 7e-04
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 0.002
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 5e-05
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 1e-04
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 3e-04
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 5e-04
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 8e-04
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 9e-04
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 0.001
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 6e-05
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 6e-04
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 0.001
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 0.001
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 0.002
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 0.002
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 2e-04
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 0.001
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 0.001
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 0.003
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 0.003
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 0.003
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 4e-04
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 5e-04
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 9e-04
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 0.001
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 0.001
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 0.001
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 0.002
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 0.003
d1ioxa_50 g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) 0.004
d1ioxa_50 g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) 0.004
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor IX (IXa)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 51.6 bits (124), Expect = 1e-09
 Identities = 19/37 (51%), Positives = 26/37 (70%)

Query: 224 DIDECVSNPCQNGGTCVDLVDGYKCECTQAWEGSNCQ 260
           D D+C SNPC NGG+C D ++ Y+C C   +EG NC+
Sbjct: 2   DGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCE 38
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query721
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.84
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.79
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.77
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.75
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.75
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.74
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.73
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.72
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.61
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.6
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.58
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.56
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.45
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.44
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.38
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.38
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.37
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.36
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.35
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 98.35
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.34
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 98.27
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.19
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.19
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 98.16
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 98.08
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.99
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.98
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.88
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.87
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.84
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.82
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.68
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.68
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.67
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.63
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.62
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.59
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.59
d1szba245 Mannose-binding protein associated serine protease 97.58
d1nt0a345 Mannose-binding protein associated serine protease 97.57
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.53
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.48
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.47
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.44
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.4
d1szba245 Mannose-binding protein associated serine protease 97.31
d1nt0a345 Mannose-binding protein associated serine protease 97.25
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.25
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.18
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 96.77
d3bpse140 Low density lipoprotein (LDL) receptor, different 96.75
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.73
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 96.63
d3bpse140 Low density lipoprotein (LDL) receptor, different 96.6
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.57
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 96.09
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 95.89
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 95.82
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 95.63
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 95.55
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 95.54
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 95.44
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 95.43
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 95.36
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 94.87
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 94.12
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 92.48
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 92.15
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 91.84
d1ijqa250 Low density lipoprotein (LDL) receptor, different 91.38
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 91.06
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 91.02
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 90.9
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 90.76
d1ijqa250 Low density lipoprotein (LDL) receptor, different 90.7
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 90.48
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 90.22
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 88.27
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 87.96
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 87.84
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 85.81
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 85.49
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 84.32
d1dx5i143 Thrombomodulin, different EGF-like domains {Human 80.03
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor IX (IXa)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.84  E-value=1.1e-09  Score=73.01  Aligned_cols=38  Identities=47%  Similarity=1.128  Sum_probs=27.1

Q ss_pred             cCCCCCCCCCCCCCCCEeccCCCCceeEeCCCCCccCccC
Q psy17084          8 SDLNYCGTHEPCQNGGTCENTAPDQYLCTCPEGFSGINCE   47 (721)
Q Consensus         8 ~~~~~C~~~~~C~~~g~C~~~~~~~~~C~C~~G~~G~~C~   47 (721)
                      +|+|+|.+ +||+|+|+|++ ..++|+|.|++||+|.+||
T Consensus         1 id~d~C~~-~PC~ngg~C~~-~~~~y~C~C~~g~~G~~Ce   38 (39)
T d1edmb_           1 VDGDQCES-NPCLNGGSCKD-DINSYECWCPFGFEGKNCE   38 (39)
T ss_dssp             CCCCTTTT-CCCCTTCEEEE-ETTEEEEECCTTCCSTTSC
T ss_pred             CccccCCC-CCCCCCcEEEc-CCCCEEEECCCCCCCCCCC
Confidence            46677776 77777777776 4567777777777777775
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure