Psyllid ID: psy17175
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 285 | ||||||
| 328721829 | 152 | PREDICTED: hypothetical protein LOC10057 | 0.385 | 0.723 | 0.366 | 2e-12 | |
| 270002674 | 321 | hypothetical protein TcasGA2_TC005227 [T | 0.378 | 0.336 | 0.391 | 7e-12 | |
| 427791807 | 1212 | Putative tick transposon, partial [Rhipi | 0.308 | 0.072 | 0.433 | 1e-11 | |
| 427791321 | 1210 | Putative tick transposon, partial [Rhipi | 0.308 | 0.072 | 0.433 | 1e-11 | |
| 270015744 | 879 | hypothetical protein TcasGA2_TC004345 [T | 0.319 | 0.103 | 0.437 | 3e-11 | |
| 443733872 | 400 | hypothetical protein CAPTEDRAFT_197082 [ | 0.410 | 0.292 | 0.344 | 6e-11 | |
| 328696858 | 206 | PREDICTED: hypothetical protein LOC10056 | 0.463 | 0.640 | 0.340 | 8e-11 | |
| 328720146 | 164 | PREDICTED: hypothetical protein LOC10056 | 0.336 | 0.585 | 0.415 | 1e-10 | |
| 427798889 | 1199 | Putative tick transposon, partial [Rhipi | 0.301 | 0.071 | 0.438 | 1e-10 | |
| 189242251 | 1808 | PREDICTED: similar to pol-like protein [ | 0.336 | 0.053 | 0.41 | 3e-10 |
| >gi|328721829|ref|XP_003247415.1| PREDICTED: hypothetical protein LOC100572018 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 79.0 bits (193), Expect = 2e-12, Method: Compositional matrix adjust.
Identities = 41/112 (36%), Positives = 65/112 (58%), Gaps = 2/112 (1%)
Query: 155 TTEDLKPFISFLITSEWQNQWNHIPNTNKLKVIKPTIEYWSTSNQNKRFQEVILTRMRIG 214
T++DL I + WQN W+ I +NKL+++K T+ W+ S R ++ I+ R RIG
Sbjct: 18 TSKDLINEAQKSILASWQNHWDDILTSNKLRIVKKTVSKWTYSENASRREQTIINRARIG 77
Query: 215 HTRLTHNHLFTKIDPPLCQ-CGAALSVRHILF-CHQHVNIRNSLDTPPSLED 264
H+ +TH++L TK P C C L++ HI+ C + + R+ L P SLE+
Sbjct: 78 HSNITHSYLITKEPRPNCDTCNTPLTIEHIIINCPKFASSRHLLKNPSSLEE 129
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270002674|gb|EEZ99121.1| hypothetical protein TcasGA2_TC005227 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|427791807|gb|JAA61355.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427791321|gb|JAA61112.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|270015744|gb|EFA12192.1| hypothetical protein TcasGA2_TC004345 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|443733872|gb|ELU18078.1| hypothetical protein CAPTEDRAFT_197082 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|328696858|ref|XP_003240151.1| PREDICTED: hypothetical protein LOC100568880 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328720146|ref|XP_003246964.1| PREDICTED: hypothetical protein LOC100568990, partial [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|427798889|gb|JAA64896.1| Putative tick transposon, partial [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|189242251|ref|XP_001808188.1| PREDICTED: similar to pol-like protein [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
No hits with e-value below 0.001 by BLAST
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 285 | |||
| PF00075 | 132 | RNase_H: RNase H; InterPro: IPR002156 The RNase H | 97.11 | |
| PRK08719 | 147 | ribonuclease H; Reviewed | 97.04 | |
| PRK00203 | 150 | rnhA ribonuclease H; Reviewed | 96.78 | |
| PRK06548 | 161 | ribonuclease H; Provisional | 96.61 | |
| COG0328 | 154 | RnhA Ribonuclease HI [DNA replication, recombinati | 95.64 | |
| cd06222 | 130 | RnaseH RNase H (RNase HI) is an endonuclease that | 95.01 | |
| KOG3752|consensus | 371 | 92.21 | ||
| PF13966 | 86 | zf-RVT: zinc-binding in reverse transcriptase | 88.16 |
| >PF00075 RNase_H: RNase H; InterPro: IPR002156 The RNase H domain is responsible for hydrolysis of the RNA portion of RNA x DNA hybrids, and this activity requires the presence of divalent cations (Mg2+ or Mn2+) that bind its active site | Back alignment and domain information |
|---|
Probab=97.11 E-value=0.00018 Score=57.89 Aligned_cols=25 Identities=24% Similarity=0.294 Sum_probs=21.4
Q ss_pred cccccceeeeecCCCCc-CcchhHHhh
Q psy17175 117 AALSVRHILFCHQHDNA-AGVESLFLL 142 (285)
Q Consensus 117 ~~~~vr~~~WIPGH~gI-pGNE~AD~~ 142 (285)
....|+ |.|||||+|+ .|||.||++
T Consensus 101 ~~~~v~-~~~V~~H~~~~~~N~~aD~l 126 (132)
T PF00075_consen 101 RGIKVR-FRWVPGHSGVPQGNERADRL 126 (132)
T ss_dssp HSSEEE-EEESSSSSSSHHHHHHHHHH
T ss_pred cceEEe-eeeccCcCCCchhHHHHHHH
Confidence 355675 9999999999 599999987
|
This domain is a part of a large family of homologous RNase H enzymes of which the RNase HI protein from Escherichia coli is the best characterised []. Secondary structure predictions for the enzymes from E. coli, yeast, human liver and diverse retroviruses (such as Rous sarcoma virus and the Foamy viruses) supported, in every case, the five beta-strands (1 to 5) and four or five alpha-helices (A, B/C, D, E) that have been identified by crystallography in the RNase H domain of Human immunodeficiency virus 1 (HIV-1) reverse transcriptase and in E. coli RNase H []. Reverse transcriptase (RT) is a modular enzyme carrying polymerase and ribonuclease H (RNase H) activities in separable domains. Reverse transcriptase (RT) converts the single-stranded RNA genome of a retrovirus into a double-stranded DNA copy for integration into the host genome. This process requires ribonuclease H as well as RNA- and DNA-directed DNA polymerase activities. Retroviral RNase H is synthesised as part of the POL polyprotein that contains; an aspartyl protease, a reverse transcriptase, RNase H and integrase. POL polyprotein undergoes specific enzymatic cleavage to yield the mature proteins. Bacterial RNase H 3.1.26.4 from EC catalyses endonucleolytic cleavage to 5'-phosphomonoester acting on RNA-DNA hybrids. The 3D structure of the RNase H domain from diverse bacteria and retroviruses has been solved [, , ]. All have four beta strands and four to five alpha helices. The E. coli RNase H1 protein binds a single Mg2+ ion cofactor in the active site of the enzyme. The divalent cation is bound by the carboxyl groups of four acidic residues, Asp-10, Glu-48, Asp-70, and Asp-134 []. The first three acidic residues are highly conserved in all bacterial and retroviral RNase H sequences. ; GO: 0003676 nucleic acid binding, 0004523 ribonuclease H activity; PDB: 3LP3_B 2KW4_A 3P1G_A 1RIL_A 2RPI_A 4EQJ_G 4EP2_B 3OTY_P 3U3G_D 2ZQB_D .... |
| >PRK08719 ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >PRK00203 rnhA ribonuclease H; Reviewed | Back alignment and domain information |
|---|
| >PRK06548 ribonuclease H; Provisional | Back alignment and domain information |
|---|
| >COG0328 RnhA Ribonuclease HI [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd06222 RnaseH RNase H (RNase HI) is an endonuclease that cleaves the RNA strand of an RNA/DNA hybrid in a not sequence-specific manner | Back alignment and domain information |
|---|
| >KOG3752|consensus | Back alignment and domain information |
|---|
| >PF13966 zf-RVT: zinc-binding in reverse transcriptase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 285 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 40.6 bits (94), Expect = 4e-04
Identities = 36/205 (17%), Positives = 60/205 (29%), Gaps = 45/205 (21%)
Query: 36 GLCQYYLKVIKP--TIEYWSTSNQNKRFQEVILTRMRIGHTRLTHNHLFTKTDPPLCQCG 93
C V++ + Y N R ++RI + L C
Sbjct: 190 KNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENC--- 246
Query: 94 AAL-------SVRHI----LSCHTKI---DPPLCQCGAALSVRHILFCHQHDNAAGVESL 139
L + + LSC + + +A + HI H E
Sbjct: 247 --LLVLLNVQNAKAWNAFNLSCKILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVK 304
Query: 140 FLLNAVLNSWIYKLCTTEDLK-------PFISFLI-------TSEWQNQWNHIPNTNKL- 184
LL L+ C +DL P +I + W N W H+ N +KL
Sbjct: 305 SLLLKYLD------CRPQDLPREVLTTNPRRLSIIAESIRDGLATWDN-WKHV-NCDKLT 356
Query: 185 KVIKPTIEYWSTSNQNKRFQE-VIL 208
+I+ ++ + K F +
Sbjct: 357 TIIESSLNVLEPAEYRKMFDRLSVF 381
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 285 | |||
| 3qio_A | 150 | GAG-POL polyprotein; RNAse H, inhibitor, nuclease, | 97.22 | |
| 2kq2_A | 147 | Ribonuclease H-related protein; PSI, NESG, protein | 97.21 | |
| 3h08_A | 146 | RNH (ribonuclease H); RNAse H, 3D-structure, endon | 97.07 | |
| 2e4l_A | 158 | Ribonuclease HI, RNAse HI; hydrolase, endoribonucl | 97.02 | |
| 1jl1_A | 155 | Ribonuclease HI; RNAse HI, protein stability, ther | 97.02 | |
| 2qkb_A | 154 | Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hy | 96.95 | |
| 3p1g_A | 165 | Xenotropic murine leukemia virus-related virus (X | 96.78 | |
| 1ril_A | 166 | Ribonuclease H; hydrolase(endoribonuclease); 2.80A | 96.71 | |
| 2zd1_A | 557 | Reverse transcriptase/ribonuclease H; P51/P66, het | 95.97 | |
| 1mu2_A | 555 | HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polym | 95.94 | |
| 2lsn_A | 165 | Reverse transcriptase; RNAse H, viral protein; NMR | 95.19 |
| >3qio_A GAG-POL polyprotein; RNAse H, inhibitor, nuclease, transferase, hydrolase- complex; HET: QID; 1.40A {Hiv-1 M} SCOP: c.55.3.1 PDB: 3qin_A* 3hyf_A* 1o1w_A 3lp3_A* 1hrh_A 3k2p_A* 1rdh_A | Back alignment and structure |
|---|
Probab=97.22 E-value=9.2e-05 Score=61.90 Aligned_cols=25 Identities=20% Similarity=0.215 Sum_probs=22.1
Q ss_pred cccccceeeeecCCCCcCcchhHHhh
Q psy17175 117 AALSVRHILFCHQHDNAAGVESLFLL 142 (285)
Q Consensus 117 ~~~~vr~~~WIPGH~gIpGNE~AD~~ 142 (285)
....|. +.|||||.|++|||.||++
T Consensus 116 ~~~~v~-~~wV~gH~g~~~Ne~AD~L 140 (150)
T 3qio_A 116 KKEKVY-LAWVPAHKGIGGNEQVDKL 140 (150)
T ss_dssp TCSEEE-EEECCTTSCCHHHHHHHHH
T ss_pred hcCceE-EEEccCcCCChhHHHHHHH
Confidence 355675 9999999999999999997
|
| >2kq2_A Ribonuclease H-related protein; PSI, NESG, protein structure, APO enzyme, structural genomics, protein structure initiative; NMR {Desulfitobacterium hafniense dcb-2} PDB: 2kw4_A | Back alignment and structure |
|---|
| >3h08_A RNH (ribonuclease H); RNAse H, 3D-structure, endonuclease, hydrolase, magnesium, metal-binding; 1.60A {Chlorobaculum tepidum} | Back alignment and structure |
|---|
| >2e4l_A Ribonuclease HI, RNAse HI; hydrolase, endoribonuclease; 2.00A {Shewanella oneidensis} PDB: 2zqb_A | Back alignment and structure |
|---|
| >1jl1_A Ribonuclease HI; RNAse HI, protein stability, thermostability, hydrogen exchange, cooperativity, hydrolase; 1.30A {Escherichia coli} SCOP: c.55.3.1 PDB: 1f21_A 1jxb_A 1g15_A 1rch_A 1rdd_A 1rnh_A* 2rn2_A 1rda_A 1law_A 1rdb_A 1lav_A 3aa4_A 1rbu_A 1gob_A 1rdc_A 1kvc_A 3aa3_A 3aa2_A 3aa5_X 1rbv_A ... | Back alignment and structure |
|---|
| >2qkb_A Ribonuclease H1, HS-RNAse HC, RNAse H1; RNA/DNA hybrid; 2.40A {Homo sapiens} PDB: 2qk9_A 2qkk_A* | Back alignment and structure |
|---|
| >3p1g_A Xenotropic murine leukemia virus-related virus (X H domain; XMRV, RNAse H, reverse transcriptase, transcription; 1.50A {Xenotropic mulv-related virus} PDB: 3v1q_A 3v1o_A 3v1r_A* 2hb5_A 4e89_A | Back alignment and structure |
|---|
| >1ril_A Ribonuclease H; hydrolase(endoribonuclease); 2.80A {Thermus thermophilus} SCOP: c.55.3.1 PDB: 2rpi_A | Back alignment and structure |
|---|
| >2zd1_A Reverse transcriptase/ribonuclease H; P51/P66, hetero dimer, NNRTI, nonnucleoside inhibitor, AIDS, HIV, rilpivirine, diarylpyrimidine, DAPY, DNA recombination; HET: T27; 1.80A {Human immunodeficiency virus 1} PDB: 3is9_A* 3irx_A* 2ze2_A* 3bgr_A* 3qlh_A* 3klf_A* 3qo9_A* 1dlo_A 1bqm_A 2be2_A* 1s6q_A* 1s6p_A* 1s9g_A* 1suq_A* 2b5j_A* 2b6a_A* 2ban_A* 1s9e_A* 1hni_A* 1hnv_A* ... | Back alignment and structure |
|---|
| >1mu2_A HIV-2 RT; HIV-2 reverse transcriptase, AIDS, polymerase, drug design, transferase; 2.35A {Human immunodeficiency virus 2} SCOP: c.55.3.1 e.8.1.2 PDB: 1mu2_B | Back alignment and structure |
|---|
| >2lsn_A Reverse transcriptase; RNAse H, viral protein; NMR {Simian foamy virus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 285 | |||
| d1jl1a_ | 152 | RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | 97.85 | |
| d1mu2a1 | 126 | HIV RNase H (Domain of reverse transcriptase) {Hum | 97.69 | |
| d1rila_ | 147 | RNase H (RNase HI) {Thermus thermophilus [TaxId: 2 | 97.66 |
| >d1jl1a_ c.55.3.1 (A:) RNase H (RNase HI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Ribonuclease H-like motif superfamily: Ribonuclease H-like family: Ribonuclease H domain: RNase H (RNase HI) species: Escherichia coli [TaxId: 562]
Probab=97.85 E-value=1.7e-06 Score=68.59 Aligned_cols=23 Identities=13% Similarity=0.063 Sum_probs=21.0
Q ss_pred cccceeeeecCCCCcCcchhHHhh
Q psy17175 119 LSVRHILFCHQHDNAAGVESLFLL 142 (285)
Q Consensus 119 ~~vr~~~WIPGH~gIpGNE~AD~~ 142 (285)
..|+ |.|||||+|++|||.||+|
T Consensus 112 ~~V~-~~wV~gH~g~~gNe~AD~L 134 (152)
T d1jl1a_ 112 HQIK-WEWVKGHAGHPENERADEL 134 (152)
T ss_dssp CEEE-EEECCSSTTCHHHHHHHHH
T ss_pred ceeE-EEEecccCCCccHHHHHHH
Confidence 4686 9999999999999999997
|
| >d1mu2a1 c.55.3.1 (A:430-555) HIV RNase H (Domain of reverse transcriptase) {Human immunodeficiency virus type 2 [TaxId: 11709]} | Back information, alignment and structure |
|---|
| >d1rila_ c.55.3.1 (A:) RNase H (RNase HI) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|