Psyllid ID: psy17257

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------78

MYLTVHRGNEPESLVDQCIRYLLHSVDRFTFKFHDVNKFRCEDVKFRCEDVKFPREISEKFLSMYEKSGGIVIDSFVDTFLTKDITHMKSVKLRNAEVSDSGMQKLLSHHVQELELIKCANVSQASLEVLNMSSDQLYSLSLGPHCSMFPDCLESEVVVGEKQRADDFMMTDFEININGRATSSGSLTYKQRGYILKAPKLRRFSLIGHTLMSQSICTQLYRDMPHLTHLNLSKCMFLFDNKDLSFLAEFKDTLVSLVLFNVSIVKDNLDHICSLPLLRRLDISVSSDYPDYGNYSPNPNDMLSYIIFKLPHLVSLDISGTNLAGRGVAEFSSKGSPDVPYVTTDIPGLASRVDRPLEFLGLYGTKHGASHRHDIPALRVAGDCNEAQLLIAAKAYIDRPEMLQQVLNDLYHIFRYDTCVDIEHALVVVLEALDTHLTERHIQISGSANLFYIVKMKDRPVLSSLTKRHIITTILNGMHMHLEDDTMMRNGCLTLCQFKIPQDVQFDYDRLVRILLHIITEMEHESNSNGSNFVLRIAIYLLNSLACQVDNAHKILLGRLGVIKKMLRLIKDRIEKQRCDDILEVAWSAMWNVTDETAINCARFLNNGGMELFLNCLQYFPEKDELLRNMMGLLGNVAEVKSLRPKLMTSKFIEVFANLVSSKSDGIEVSYNAAGVLSHIASDGPEAWTIRYPAREKVLAKMVEAIERWPIDSERNINYRSFEPIIQLLRVYHTPECQHWSVWALANLTKVYPEKYCQVVEAEGGIELLQNLLDNENK

cccccccccccHHHHHHHHHHHHHcHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHccccccccccEEEccccccccHHHHHHHcccccEEEccccccccHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHcccccccEEEcccccccccHHHHHHHHcccccccEEEcccccccccHHHHHcccccccccccccccccccccccccccHHHHHHHHHcccccEEEcccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccEEcccccHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHcHHHHHHHHHHcccc

cEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEccccccEEEEEEEEcccccHHHHHHHHHcccEEEEEEEcccccHHHHHHHHcccccEEEEEcccccccccccccHHccccccHHHHHHHccccccccccEEEEEcccccccccccccccHHHHHHHcccccccHHHHHHHHcccccccEEEccccEEccccccHHHHHHHHHHHHEEHHHcHHHHHHHHHHHHHHHHHcEEEccccccccccccccccHHHHHHHHHHHccccEEEEEccccccHHHHHHHHcccccccccccccccccccccccccEEEEEEccccccccccccccEEEcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHEEEEEccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHcHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccEEEHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccHcEEEcccccHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHcccc

myltvhrgnepeslVDQCIRYLLHSVdrftfkfhdvnkfrcedvkfrcedvkfpREISEKFLSMYEKSGGIVIDSFVDTFLTKDIthmksvklrnaevsdSGMQKLLSHHVQELELIKCANVSQASLEVLNMSsdqlyslslgphcsmfpdclesevvvgekqraddfmmtdfeiningratssgsltykqrgyilkapklrrFSLIGHTLMSQSICTQLyrdmphlthlnlskcmflfdnkdlsFLAEFKDTLVSLVLFNVSIVkdnldhicslpllrrldisvssdypdygnyspnpndmLSYIIFKLphlvsldisgtnlagrgvaefsskgspdvpyvttdipglasrvdrpleflglygtkhgashrhdipalrvagdcNEAQLLIAAKAYIDRPEMLQQVLNDLYHIFRYDTCVDIEHALVVVLEALDTHLTERHIQISGSANLFYIVKmkdrpvlssltKRHIITTILNGmhmhleddtmmrngcltlcqfkipqdvqfDYDRLVRILLHIITEmehesnsngsnFVLRIAIYLLNSLACQVDNAHKILLGRLGVIKKMLRLIKDRIEKQRCDDILEVAWSAMWNVTDETAINCARFLNNGGMELFLNCLQYFPEKDELLRNMMGLLGNVAevkslrpklmTSKFIEVFANLVssksdgievsynAAGVLShiasdgpeawtiryPAREKVLAKMVEAIErwpidserninyrsfEPIIQLLRvyhtpecqhWSVWALANltkvypekyCQVVEAEGGIELLQNLLDNENK

myltvhrgnepeslVDQCIRYLLHSVDRFTFKfhdvnkfrcedvkfrcedvkFPREISEKFLSMYEKSGGIVIDSFVDTFLTKDITHMKSVKLRNAEVSDSGMQKLLSHHVQELELIKCANVSQASLEVLNMSSDQLYSLSLGPHCSMFPDCLESEVVVGEKQRADDFMMTDFEINIngratssgsltykQRGYILKAPKLRRFSLIGHTLMSQSICTQLYRDMPHLTHLNLSKCMFLFDNKDLSFLAEFKDTLVSLVLFNVSIVKDNLDHICSLPLLRRLDISVSSDYPDYGNYSPNPNDMLSYIIFKLPHLVSLDISGTNLAGRGVAEfsskgspdvpyVTTDIPGLASRVDRPLEFLGLYGTKHGASHRHDIPALRVAGDCNEAQLLIAAKAYIDRPEMLQQVLNDLYHIFRYDTCVDIEHALVVVLEALDTHLTERHIqisgsanlfyiVKMKDRPVLSSLTKRHIITTILNGMHMHLEDDTMMRNGCLTLCQFKIPQDVQFDYDRLVRILLHIITEmehesnsngSNFVLRIAIYLLNSLACQVDNAHKILLGRLGVIKKMLRLIKDRIEKQRCDDILEVAWSAMWNVTDETAINCARFLNNGGMELFLNCLQYFPEKDELLRNMMGLLGNVAEVKSLRPKLMTSKFIEVFANLVSSKSDGIEVSYNAAGVLShiasdgpeawTIRYPAREKVLAKMVEAIErwpidserninyRSFEPIIQLLRVYHTPECQHWSVWALANLTKVYPEKYCQVVEAEGGIELLqnlldnenk

*************LVDQCIRYLLHSVDRFTFKFHDVNKFRCEDVKFRCEDVKFPREISEKFLSMYEKSGGIVIDSFVDTFLTKDITHMKSVKLRNA******MQKLLSHHVQELELIKCANVSQASLEVLNMSSDQLYSLSLGPHCSMFPDCLESEVVVGEKQRADDFMMTDFEININGRATSSGSLTYKQRGYILKAPKLRRFSLIGHTLMSQSICTQLYRDMPHLTHLNLSKCMFLFDNKDLSFLAEFKDTLVSLVLFNVSIVKDNLDHICSLPLLRRLDISVSSDYPDYGNYSPNPNDMLSYIIFKLPHLVSLDISGTNLAGRGVAEF******DVPYVTTDIPGLASRVDRPLEFLGLYGTKHGASHRHDIPALRVAGDCNEAQLLIAAKAYIDRPEMLQQVLNDLYHIFRYDTCVDIEHALVVVLEALDTHLTERHIQISGSANLFYIVKMKDRPVLSSLTKRHIITTILNGMHMHLEDDTMMRNGCLTLCQFKIPQDVQFDYDRLVRILLHIITEMEHE**SNGSNFVLRIAIYLLNSLACQVDNAHKILLGRLGVIKKMLRLIKDRIEKQRCDDILEVAWSAMWNVTDETAINCARFLNNGGMELFLNCLQYFPEKDELLRNMMGLLGNVAEVKSLRPKLMTSKFIEVFANLVSSKSDGIEVSYNAAGVLSHIASDGPEAWTIRYPAREKVLAKMVEAIERWPIDSERNINYRSFEPIIQLLRVYHTPECQHWSVWALANLTKVYPEKYCQVVEAEGGIELLQNL******

*********EP**LVDQCIRYLLHSVDRFTFKFHDVNKFRCEDVKFRCEDVKFPREISEKFLSMYEKSGGIVIDSFVDTFLTKDITHMKSVKLRNAEVSDSGMQKLLSHHVQELELIKCANVSQASLEVLNMSSDQLYSLSLGPHCSMFPDCLESEVVVGEKQRADDFMMTDFEININGRATSSGSLTYKQRGYILKAPKLRRFSLIGHTLMSQSICTQLYRDMPHLTHLNLSKCMFLFDNKDLSFLAEFKDTLVSLVLFNVSIVKDNLDHICSLPLLRRLDISVSSDYPDYGNYSPNPNDMLSYIIFKLPHLVSLDISGTNLAGRGVAEFSSKGSPDVPYVTTDIPGLASRVDRPLEFLGLYGTKHGASHRHDIPALRVAGDCNEAQLLIAAKAYIDRPEMLQQVLNDLYHIFRYDTCVDIEHALVVVLEALDTHLTERHIQISGSANLFYIVKMKDRPVLSSLTKRHIITTILNGMHMHLEDDTMMRNGCLTLCQFKIPQDVQFDYDRLVRILLHIITEMEHESNSNGSNFVLRIAIYLLNSLACQVDNAHKILLGRLGVIKKMLRLIKDRIEKQRCDDILEVAWSAMWNVTDETAINCARFLNNGGMELFLNCLQYFPEKDELLRNMMGLLGNVAEVKSLRPKLMTSKFIEVFANLVSSKSDGIEVSYNAAGVLSHIASDGPEAWTIRYPAREKVLAKMVEAIERWPIDSERNINYRSFEPIIQLLRVYHTPECQHWSVWALANLTKVYPEKYCQVVEAEGGIELL**L******

*********EPESLVDQCIRYLLHSVDRFTFKFHDVNKFRCEDVKFRCEDVKFPREISEKFLSMYEKSGGIVIDSFVDTFLTKDITHMKSVKLRNAEVSDSGMQKLLSHHVQELELIKCANVSQASLEVLNMSSDQLYSLSLGPHCSMFPDCLESEVVVGEKQRADDFMMTDFEININGRATSSGSLTYKQRGYILKAPKLRRFSLIGHTLMSQSICTQLYRDMPHLTHLNLSKCMFLFDNKDLSFLAEFKDTLVSLVLFNVSIVKDNLDHICSLPLLRRLDISVSSDYPDYGNYSPNPNDMLSYIIFKLPHLVSLDISGTNLAGRGVAEFSSKGSPDVPYVTTDIPGLASRVDRPLEFLGLYGTKHGASHRHDIPALRVAGDCNEAQLLIAAKAYIDRPEMLQQVLNDLYHIFRYDTCVDIEHALVVVLEALDTHLTERHIQISGSANLFYIVKMKDRPVLSSLTKRHIITTILNGMHMHLEDDTMMRNGCLTLCQFKIPQDVQFDYDRLVRILLHIITEMEHESNSNGSNFVLRIAIYLLNSLACQVDNAHKILLGRLGVIKKMLRLIKDRIEKQRCDDILEVAWSAMWNVTDETAINCARFLNNGGMELFLNCLQYFPEKDELLRNMMGLLGNVAEVKSLRPKLMTSKFIEVFANLVSSKSDGIEVSYNAAGVLSHIASDGPEAWTIRYPAREKVLAKMVEAIERWPIDSERNINYRSFEPIIQLLRVYHTPECQHWSVWALANLTKVYPEKYCQVVEAEGGIELLQNLLDNENK

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		778	2.2.26 [Sep-21-2011]
Q9W0E8		793	Protein zer-1 homolog OS=	yes	N/A	0.872	0.856	0.496	0.0
Q7Z7L7		766	Protein zer-1 homolog OS=	yes	N/A	0.921	0.936	0.386	1e-135
Q5RAG3		766	Protein zer-1 homolog OS=	yes	N/A	0.921	0.936	0.386	1e-135
Q80ZJ6		779	Protein zer-1 homolog OS=	yes	N/A	0.921	0.920	0.376	1e-131
Q2WF59		895	Zyg eleven-related protei	yes	N/A	0.723	0.629	0.410	1e-122
Q9C0D3		744	Protein zyg-11 homolog B	no	N/A	0.865	0.904	0.255	6e-57
A0JMZ3		732	Protein zyg-11 homolog OS	N/A	N/A	0.656	0.698	0.278	4e-56
Q3UFS0		744	Protein zyg-11 homolog B	no	N/A	0.865	0.904	0.253	4e-56
Q5TYQ1		746	Protein zyg-11 homolog OS	no	N/A	0.602	0.628	0.269	3e-53
Q6WRX3		759	Protein zyg-11 homolog A	no	N/A	0.867	0.889	0.238	2e-38

>sp\|Q9W0E8\|ZER1_DROME Protein zer-1 homolog OS=Drosophila melanogaster GN=CG12084 PE=2 SV=2	Back alignment and function desciption

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/765 (49%), Positives = 473/765 (61%), Gaps = 86/765 (11%)

Query: 51  VKFPREISEKFLSMYEKSGGIVIDSFVDTFLTKDITHMKSVKLRNAEVSDSGMQKLLSHH 110
           +  P EI + FL  Y++    + DS +  F     T +K V LRN+ +S  G++ L+ H 
Sbjct: 50  IVLPNEICDGFLENYQRFNRPLDDSVIRLFEDTHRTSLKIVNLRNSTLSSIGLETLMRHK 109

Query: 111 VQELELIKCANVSQASLEVLNMSSDQLYSLSLG--PHCSMFPDCLESEVVVGEKQRADDF 168
           +  L L  C  +S  S  +L    D L SL LG   H   + +  E E V        DF
Sbjct: 110 LFALSLWYCDMISVGSHHLLAHYGDSLRSLELGISSHLLQYAEPNEKEPV--------DF 161

Query: 169 MMTDFEININGRATSSGSLTYKQRGYILKAPKLRRFSLIGHTLMSQSICTQLYRDMPHLT 228
            +T                           P LRR  L G  +  +     L+     L 
Sbjct: 162 QLT--------------------------CPHLRRLVLNGVVMHHRLQFAHLH----DLG 191

Query: 229 HLNLSKCMFLFDNKDLSFLAEFKDTLVSLVLFNVSIVKDNLDHICSLPLLRRLDISVSSD 288
           HL+L+ C  +  N  L  L    + L +L+LFNV  + + L  IC L  L  LDIS+SS 
Sbjct: 192 HLDLTSC--VLANFSLEALGSLPN-LHTLILFNVWPIANQLHAICCLRRLCTLDISISSS 248

Query: 289 YPDYGNYSPNPNDMLSYIIFKLPHLVSLDISGTNLAGRGVAEFSS------KGSPDVP-- 340
              +G Y   P+  L  ++  L HL  LDISGTNLAG GVA   S      + SP +   
Sbjct: 249 GNGHGTYDL-PDQTLEMLMDNLRHLTHLDISGTNLAGNGVATKESTTTSGMQQSPKMEQH 307

Query: 341 YVTTDIPGLASRVDRPLEFLGLYGTKHGASHRHDIPALRVAGDCNEAQLLIAAKAYIDRP 400
           +  TDIPGLASR  RPL+FLGLY T H A  RHDIPAL VAGD NE Q+L AA+ Y DRP
Sbjct: 308 FALTDIPGLASRTQRPLQFLGLYHTAHWACKRHDIPALEVAGDANEQQILTAARYYHDRP 367

Query: 401 EMLQQVLNDLYHIFRYDTCVDIEHALVVVLEALDTHLTERHIQISGSANLFYIVKMKDRP 460
            +L +VLNDLYH+FR++ C DI  AL VVL A+D HL  +H+QISGSA LFYIVK +DR 
Sbjct: 368 VLLTRVLNDLYHLFRFENCKDIHTALDVVLSAMDRHLKFKHMQISGSATLFYIVKGRDRS 427

Query: 461 VLSSLTKRHIITTILNGMHMHLEDDTMMRNGCLTLCQFKIPQDVQFDYDRLVRILLHIIT 520
              +L + HII T+LNGM MH+ DDTM+RNG LTL QF +P DV F+Y+RL++ILLH ++
Sbjct: 428 KFGALLRNHIIRTLLNGMEMHITDDTMLRNGYLTLTQFHMPVDVLFEYERLIKILLHGVS 487

Query: 521 EMEHESNSNGSNFVLRIAIYLLNSLACQVDNAHKILLGRLGVIKKMLRLIKDRIEKQRCD 580
           + E E       FV RIAIYLLN+LACQVD   K+ LG LGV+  M  LIKDR+ +   D
Sbjct: 488 KTEQEG------FVQRIAIYLLNTLACQVDGRQKLFLGELGVVSTMFTLIKDRLTRSVFD 541

Query: 581 DILEVAWSAMWNVTDETAINCARFLNNGGMELFLNCLQYFPEKDELLRNMMGLLGNVAEV 640
           D++EVAWS MWNVTDETAINC RFL+  GME FL CL  FP++DELLRNMMGLLGNVAEV
Sbjct: 542 DVMEVAWSTMWNVTDETAINCKRFLDGRGMEYFLKCLHTFPDRDELLRNMMGLLGNVAEV 601

Query: 641 KSLRPKLMTSKFIEVFANLVSSKSDGIE----------------------------VSYN 672
           K LRPKLMT +FIEVFA L+ S SDGIE                            VSYN
Sbjct: 602 KWLRPKLMTQEFIEVFARLLDSLSDGIEVGGASASVVARVREREMASANHAYLRFQVSYN 661

Query: 673 AAGVLSHIASDGPEAWTIRYPAREKVLAKMVEAIERWPIDSERNINYRSFEPIIQLLRVY 732
           AAGVL+HIASDG +AWTI+ P+RE VL +MV AI+RW I SERNINYRSFEPI+ L+R Y
Sbjct: 662 AAGVLAHIASDGADAWTIKTPSREHVLERMVAAIQRWNIKSERNINYRSFEPILSLVRCY 721

Query: 733 HTPECQHWSVWALANLTKVYPEKYCQVVEAEGGIELLQNLLDNEN 777
            TP+CQHW+VWALANLT+VYPEKYC++VE E GI++L  L+++E+
Sbjct: 722 ETPQCQHWAVWALANLTQVYPEKYCKLVEQENGIQILNELIEHES 766

Probably acts as target recruitment subunit in an E3 ubiquitin ligase complex CG12084-cul-2-elongin BC.
Drosophila melanogaster (taxid: 7227)

>sp\|Q7Z7L7\|ZER1_HUMAN Protein zer-1 homolog OS=Homo sapiens GN=ZER1 PE=1 SV=1	Back alignment and function description

>sp\|Q5RAG3\|ZER1_PONAB Protein zer-1 homolog OS=Pongo abelii GN=ZER1 PE=2 SV=1	Back alignment and function description

>sp\|Q80ZJ6\|ZER1_MOUSE Protein zer-1 homolog OS=Mus musculus GN=Zer1 PE=1 SV=1	Back alignment and function description

>sp\|Q2WF59\|ZER1_CAEEL Zyg eleven-related protein 1 OS=Caenorhabditis elegans GN=zer-1 PE=1 SV=1	Back alignment and function description

>sp\|Q9C0D3\|ZY11B_HUMAN Protein zyg-11 homolog B OS=Homo sapiens GN=ZYG11B PE=1 SV=2	Back alignment and function description

>sp\|A0JMZ3\|ZYG11_XENLA Protein zyg-11 homolog OS=Xenopus laevis GN=zyg-11 PE=2 SV=1	Back alignment and function description

>sp\|Q3UFS0\|ZY11B_MOUSE Protein zyg-11 homolog B OS=Mus musculus GN=Zyg11b PE=2 SV=2	Back alignment and function description

>sp\|Q5TYQ1\|ZYG11_DANRE Protein zyg-11 homolog OS=Danio rerio GN=zyg11 PE=2 SV=1	Back alignment and function description

>sp\|Q6WRX3\|ZY11A_HUMAN Protein zyg-11 homolog A OS=Homo sapiens GN=ZYG11A PE=2 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		778
91079981		793	PREDICTED: similar to AGAP005961-PA [Tri	0.913	0.896	0.489	0.0
270003243		778	hypothetical protein TcasGA2_TC002447 [T	0.913	0.913	0.489	0.0
442629414		765	CG12084, isoform B [Drosophila melanogas	0.872	0.887	0.515	0.0
170045935		759	conserved hypothetical protein [Culex qu	0.865	0.886	0.514	0.0
158295078		770	AGAP005961-PA [Anopheles gambiae str. PE	0.867	0.876	0.506	0.0
312376718		782	hypothetical protein AND_12361 [Anophele	0.904	0.900	0.493	0.0
157115101		758	hypothetical protein AaeL_AAEL007083 [Ae	0.863	0.886	0.506	0.0
195427511		781	GK17205 [Drosophila willistoni] gi\|19415	0.875	0.871	0.5	0.0
24655224		793	CG12084, isoform A [Drosophila melanogas	0.872	0.856	0.496	0.0
194747301		790	GF25033 [Drosophila ananassae] gi\|190623	0.872	0.859	0.496	0.0

>gi\|91079981\|ref\|XP_970437.1\| PREDICTED: similar to AGAP005961-PA [Tribolium castaneum]	Back alignment and taxonomy information

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/773 (48%), Positives = 500/773 (64%), Gaps = 62/773 (8%)

Query: 9   NEPESLVDQCIRYLLHSVDRFTFKFHDVNKFRCEDVKFRCEDVKFPREISEKFLSMYEKS 68
           + PESL+D C  Y+ +++D          + R +      E V  P EI EKFL++   S
Sbjct: 38  SSPESLLDICFNYINNNLDTICVSCKITGRLRLK------EGVHLPVEICEKFLNVRSNS 91

Query: 69  GGIVIDSFVDTFLTKDITHMKSVKLRNAEVSDSGMQKLLSHHVQELELIKCANVSQASLE 128
              V  +F+  F  +  T +K V+LR+ +++D  ++ LL H + EL++    N+S   ++
Sbjct: 92  LVRVNSNFIHIFRDRQSTRLKRVRLRDIDITDRDLEVLLRHRLSELDVSYVPNLSSGCIK 151

Query: 129 VLNMSSDQLYSLSLGPHCSMFPDCLESEVVVGEKQRADDFMMTDFEININGRATSSGSLT 188
            L      L SL++G    +FP  +  ++   E+                          
Sbjct: 152 HLTEYGTLLTSLTIGEETEIFPTKIFGKLKFTEE-------------------------- 185

Query: 189 YKQRGYILKAPKLRRFSLIGHTLMSQSICTQLYRDMPHLTHLNLSKCMFLFDNKDLSFLA 248
           +  RG+I  AP L++ +L     +       L R    LTHL+LS C         S L 
Sbjct: 186 HYDRGFIFLAPNLKKLTLKRLNALQPDFFVLLLRHFSALTHLDLSGC---------SDLG 236

Query: 249 EFKDT-----LVSLVLFNVSIVKDNLDHICSLPLLRRLDISVSSDYPDYGNYSPNPNDML 303
            F+ T     L SLVL+NV+ +++ +  IC L  LR LDIS S +  + G Y  N   +L
Sbjct: 237 GFEYTEHLVNLTSLVLYNVTGLENMVPAICKLKSLRHLDISQSRE--ENGRYE-NGGQIL 293

Query: 304 SYIIFKLPHLVSLDISGTNLAGRGVAEFSSKGSPDVPYVTTDIPGLASRVDRPLEFLGLY 363
           + I+  LP L SLDISGTNLAGRGVA+ +S   P    V +DIP L+SR++ P ++LGLY
Sbjct: 294 TTIVNNLPKLTSLDISGTNLAGRGVADVAS--GP----VASDIPALSSRMNNPFQYLGLY 347

Query: 364 GTKHGASHRHDIPALRVAGDCNEAQLLIAAKAYIDRPEMLQQVLNDLYHIFRYDTCVDIE 423
            T H A  RHDIPA  +AG+ NE Q+L+AA A++DR +MLQ+VLN+L+H+ R+++C  + 
Sbjct: 348 ETSHDACLRHDIPAKLIAGNANEEQILVAALAFLDRTDMLQKVLNELFHLLRFESCAYVG 407

Query: 424 HALVVVLEALDTHLTERHIQISGSANLFYIVKMKDRPVLSSL-TKRHIITTILNGMHMHL 482
            AL +VL+A++ HLTERH+QISGSA LFYIVK   + +  ++  KR IIT +LNGM +H 
Sbjct: 408 QALNIVLDAMNRHLTERHVQISGSATLFYIVKGTGKQLHDAVRVKRRIITALLNGMSVHR 467

Query: 483 EDDTMMRNGCLTLCQFKIPQDVQFDYDRLVRILLHIITEMEHESNSNGSNFVLRIAIYLL 542
            D+TMMRNGCLTLCQFKIP DV FDY+RLV ILLH +  M  ES      FV RI IYLL
Sbjct: 468 TDETMMRNGCLTLCQFKIPSDVLFDYERLVDILLHSVHGMAQES------FVQRIGIYLL 521

Query: 543 NSLACQVDNAHKILLGRLGVIKKMLRLIKDRIEKQRCDDILEVAWSAMWNVTDETAINCA 602
           NSLACQVD   K  LG LG I KM+ LI DR+E+  CDD+LEVAWS MWNVTDET  NC 
Sbjct: 522 NSLACQVDRQQKAKLGELGAIDKMIWLIADRLERGHCDDVLEVAWSTMWNVTDETPSNCR 581

Query: 603 RFLNNGGMELFLNCLQYFPEKDELLRNMMGLLGNVAEVKSLRPKLMTSKFIEVFANLVSS 662
           +FL   GME FL CL+ FP KDELLRNMMGLLGNVAEV+ LR  L+TSK++ VF++L+ S
Sbjct: 582 KFLEIKGMEYFLQCLEKFPNKDELLRNMMGLLGNVAEVRELRHFLVTSKYLTVFSDLLDS 641

Query: 663 KSDGIEVSYNAAGVLSHIASDGPEAWTIRYPAREKVLAKMVEAIERWPIDSERNINYRSF 722
           +SDGIEVSYNAAGV+SHIASDGP+ W +  P R  VL KMV AI+RW ++S+RNINYRSF
Sbjct: 642 RSDGIEVSYNAAGVISHIASDGPDVWLVFQPTRAYVLNKMVRAIDRWDLNSQRNINYRSF 701

Query: 723 EPIIQLLRVYHTPECQHWSVWALANLTKVYPEKYCQVVEAEGGIELLQNLLDN 775
           EPI+ L++VYHTPECQ W+VWALAN+TKVYPEKYC ++E EGG+ELLQ L+++
Sbjct: 702 EPILYLVKVYHTPECQKWAVWALANMTKVYPEKYCSLIEKEGGLELLQELIEH 754

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|270003243\|gb\|EEZ99690.1\| hypothetical protein TcasGA2_TC002447 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|442629414\|ref\|NP_001261257.1\| CG12084, isoform B [Drosophila melanogaster] gi\|440215124\|gb\|AGB93952.1\| CG12084, isoform B [Drosophila melanogaster]	Back alignment and taxonomy information

>gi\|170045935\|ref\|XP_001850545.1\| conserved hypothetical protein [Culex quinquefasciatus] gi\|167868778\|gb\|EDS32161.1\| conserved hypothetical protein [Culex quinquefasciatus]	Back alignment and taxonomy information

>gi\|158295078\|ref\|XP_316001.4\| AGAP005961-PA [Anopheles gambiae str. PEST] gi\|157015863\|gb\|EAA11702.5\| AGAP005961-PA [Anopheles gambiae str. PEST]	Back alignment and taxonomy information

>gi\|312376718\|gb\|EFR23725.1\| hypothetical protein AND_12361 [Anopheles darlingi]	Back alignment and taxonomy information

>gi\|157115101\|ref\|XP_001658112.1\| hypothetical protein AaeL_AAEL007083 [Aedes aegypti] gi\|108877016\|gb\|EAT41241.1\| AAEL007083-PA [Aedes aegypti]	Back alignment and taxonomy information

>gi\|195427511\|ref\|XP_002061820.1\| GK17205 [Drosophila willistoni] gi\|194157905\|gb\|EDW72806.1\| GK17205 [Drosophila willistoni]	Back alignment and taxonomy information

>gi\|24655224\|ref\|NP_612112.1\| CG12084, isoform A [Drosophila melanogaster] gi\|74872019\|sp\|Q9W0E8.2\|ZER1_DROME RecName: Full=Protein zer-1 homolog; AltName: Full=Zyg-11 homolog B-like protein gi\|21711673\|gb\|AAM75027.1\| LD02105p [Drosophila melanogaster] gi\|23092775\|gb\|AAF47500.2\| CG12084, isoform A [Drosophila melanogaster] gi\|220943210\|gb\|ACL84148.1\| CG12084-PA [synthetic construct]	Back alignment and taxonomy information

>gi\|194747301\|ref\|XP_001956091.1\| GF25033 [Drosophila ananassae] gi\|190623373\|gb\|EDV38897.1\| GF25033 [Drosophila ananassae]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		778
UNIPROTKB\|Q7Z7L7		766	ZER1 "Protein zer-1 homolog" [	0.690	0.701	0.455	1e-128
UNIPROTKB\|Q5RAG3		766	ZER1 "Protein zer-1 homolog" [	0.690	0.701	0.455	2.7e-128
UNIPROTKB\|F1MJP6		769	ZER1 "Uncharacterized protein"	0.710	0.719	0.448	7e-128
UNIPROTKB\|E2RQA0		766	ZER1 "Uncharacterized protein"	0.710	0.721	0.446	7e-128
UNIPROTKB\|F1RR66		766	ZER1 "Uncharacterized protein"	0.710	0.721	0.448	7e-128
UNIPROTKB\|F1LQI6		779	Zer1 "Protein Zer1" [Rattus no	0.712	0.711	0.436	4.5e-124
UNIPROTKB\|F1NI66		769	ZER1 "Uncharacterized protein"	0.712	0.720	0.445	3.6e-121
UNIPROTKB\|Q2WF59		895	zer-1 "Zyg eleven-related prot	0.691	0.601	0.427	4.2e-117
MGI\|MGI:2442511		779	Zer1 "zyg-11 related, cell cyc	0.709	0.708	0.436	3.9e-115
MGI\|MGI:2685277		744	Zyg11b "zyg-ll family member B	0.667	0.697	0.292	4.9e-64

UNIPROTKB\|Q7Z7L7 ZER1 "Protein zer-1 homolog" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

 Score = 1185 (422.2 bits), Expect = 1.0e-128, Sum P(2) = 1.0e-128
 Identities = 254/558 (45%), Positives = 362/558 (64%)

Query:   220 LYRDMPHLTHLNLSKCMFLFDNKDLSFLAEFKDTLVSLVLFNVSIVKDNLDHICSLPLLR 279
             L R +  L  L+LS         D +FL ++KD+LVSLVL+N+ +  D++  I  L  LR
Sbjct:   194 LLRPLNSLAALDLSG----IQTSDAAFLTQWKDSLVSLVLYNMDLSDDHIRVIVQLHKLR 249

Query:   280 RLDISVSSDYPDYGNYSPNPNDMLSYIIFKLPHLVSLDISGTN-LAGRGVAEFSSK-GSP 337
              LDIS       Y  +     ++LS  + KL +L+SLDISG   L    +++   + G  
Sbjct:   250 HLDIS-RDRLSSYYKFKLT-REVLSLFVQKLGNLMSLDISGHMILENCSISKMEEEAGQT 307

Query:   338 DV-PYVTTDIPGLASRVDRPLEFLGLYGTKHGASHRHDIPALRVAGDCNEAQLLIAAKAY 396
              + P  ++ IP  A +  RPL+FLGL+  ++       IPA +V+GD NE Q+L A +AY
Sbjct:   308 SIEPSKSSIIPFRALK--RPLQFLGLF--ENSLCRLTHIPAYKVSGDKNEEQVLNAIEAY 363

Query:   397 ID-RPEMLQQVLNDLYHIFRYDTCVDIEHALVVVLEALDTHLTERHIQISGSANLFYIVK 455
              + RPE+  + +N L+ I R + C  +  AL +V+ AL  H  +R+IQ++GSA LFY+  
Sbjct:   364 TEHRPEITSRAINLLFDIARIERCNQLLRALKLVITALKCHKYDRNIQVTGSAALFYLTN 423

Query:   456 MKDRPVLSSLTKRHIITTILNGMHMHLEDDTMMRNGCLTLCQFKIPQDVQFDYDRLVRIL 515
              + R   S   +R +I  +LNGM  + ++ T+ RN CLTLC F IP++++F Y R+  +L
Sbjct:   424 SEYRSEQSVKLRRQVIQVVLNGMESY-QEVTVQRNCCLTLCNFSIPEELEFQYRRVNELL 482

Query:   516 LHIITEMEHESNSNGSNFVLRIAIYLLNSLACQVDNAHKILLGRLGVIKKMLRLIKDRIE 575
             L I+     + +      + RIA++L N+L CQVDN HK  +G++G +  ML+LI+ ++ 
Sbjct:   483 LSILNPTRQDES------IQRIAVHLCNALVCQVDNDHKEAVGKMGFVVTMLKLIQKKLL 536

Query:   576 KQRCDDILEVAWSAMWNVTDETAINCARFLNNGGMELFLNCLQYFPEKDELLRNMMGLLG 635
              + CD ++E +WSA+WN+TDET  NC  FLN  GM+LFL+CL+ FPEK EL RNM+GLLG
Sbjct:   537 DKTCDQVMEFSWSALWNITDETPDNCEMFLNFNGMKLFLDCLKEFPEKQELHRNMLGLLG 596

Query:   636 NVAEVKSLRPKLMTSKFIEVFANLVSSKSDGIEVSYNAAGVLSHIASDGPEAWTIRYPAR 695
             NVAEVK LRP+LMTS+FI VF+NL+ SK+DGIEVSYNA GVLSHI  DGPEAW +  P R
Sbjct:   597 NVAEVKELRPQLMTSQFISVFSNLLESKADGIEVSYNACGVLSHIMFDGPEAWGVCEPQR 656

Query:   696 EKVLAKMVEAIERWPIDSERNINYRSFEPIIQLLRVYHTPECQHWSVWALANLTKVYPEK 755
             E+V  +M  AI+ W I+S RNINYRSFEPI++LL    +P  QHW+ WAL NL  VYP+K
Sbjct:   657 EEVEERMWAAIQSWDINSRRNINYRSFEPILRLLPQGISPVSQHWATWALYNLVSVYPDK 716

Query:   756 YCQVVEAEGGIELLQNLL 773
             YC ++  EGG+ LL++++
Sbjct:   717 YCPLLIKEGGMPLLRDII 734

GO:0000221 "vacuolar proton-transporting V-type ATPase, V1 domain" evidence=IEA

GO:0015991 "ATP hydrolysis coupled proton transport" evidence=IEA

GO:0046961 "proton-transporting ATPase activity, rotational mechanism" evidence=IEA

GO:0051438 "regulation of ubiquitin-protein ligase activity" evidence=IMP

GO:0031462 "Cul2-RING ubiquitin ligase complex" evidence=IDA

GO:0004842 "ubiquitin-protein ligase activity" evidence=IMP

GO:0016567 "protein ubiquitination" evidence=IMP

UNIPROTKB\|Q5RAG3 ZER1 "Protein zer-1 homolog" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MJP6 ZER1 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RQA0 ZER1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RR66 ZER1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1LQI6 Zer1 "Protein Zer1" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NI66 ZER1 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2WF59 zer-1 "Zyg eleven-related protein 1" [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

MGI\|MGI:2442511 Zer1 "zyg-11 related, cell cycle regulator" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

MGI\|MGI:2685277 Zyg11b "zyg-ll family member B, cell cycle regulator" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q80ZJ6	ZER1_MOUSE	No assigned EC number	0.3765	0.9215	0.9204	yes	N/A
Q7Z7L7	ZER1_HUMAN	No assigned EC number	0.3866	0.9215	0.9360	yes	N/A
Q2WF59	ZER1_CAEEL	No assigned EC number	0.4101	0.7236	0.6290	yes	N/A
Q9W0E8	ZER1_DROME	No assigned EC number	0.4967	0.8727	0.8562	yes	N/A
Q5RAG3	ZER1_PONAB	No assigned EC number	0.3866	0.9215	0.9360	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		778
cd00020		120	cd00020, ARM, Armadillo/beta-catenin-like repeats	3e-08
cd00020		120	cd00020, ARM, Armadillo/beta-catenin-like repeats	0.002

>gnl\|CDD\|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats	Back alignment and domain information

 Score = 52.3 bits (126), Expect = 3e-08
 Identities = 27/128 (21%), Positives = 56/128 (43%), Gaps = 10/128 (7%)

Query: 556 LLGRLGVIKKMLRLIKDRIEKQRCDDILEVAWSAMWNVTDETAINCARFLNNGGMELFLN 615
            + + G +  ++ L+         +   E AW A+ N++     N    +  GG+   + 
Sbjct: 2   AVIQAGGLPALVSLLS----SSDENVQREAAW-ALSNLSAGNNDNIQAVVEAGGLPALVQ 56

Query: 616 CLQYFPEKDELLRNMMGLLGNVAEVKSLRPKLMTSK-FIEVFANLVSSKSDGIEVSYNAA 674
            L+   E +E+++  +  L N+A        ++     +    NL+ S ++ I+   NA 
Sbjct: 57  LLK--SEDEEVVKAALWALRNLAAGPEDNKLIVLEAGGVPKLVNLLDSSNEDIQ--KNAT 112

Query: 675 GVLSHIAS 682
           G LS++AS
Sbjct: 113 GALSNLAS 120

An approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila segment polarity gene armadillo; these repeats were also found in the mammalian armadillo homolog beta-catenin, the junctional plaque protein plakoglobin, the adenomatous polyposis coli (APC) tumor suppressor protein, and a number of other proteins. ARM has been implicated in mediating protein-protein interactions, but no common features among the target proteins recognized by the ARM repeats have been identified; related to the HEAT domain; three consecutive copies of the repeat are represented by this alignment model. Length = 120

>gnl\|CDD\|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		778
KOG3665\|consensus		699		100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.36
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.34
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.25
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	99.24
KOG3207\|consensus		505		99.18
KOG4194\|consensus		873		99.17
KOG2120\|consensus		419		99.12
KOG4341\|consensus		483		99.12
KOG2120\|consensus		419		99.1
KOG4341\|consensus		483		99.09
KOG4194\|consensus		873		99.06
KOG1909\|consensus		382		98.98
KOG0444\|consensus		1255		98.95
KOG0444\|consensus		1255		98.85
KOG3665\|consensus		699		98.83
KOG1909\|consensus		382		98.79
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.78
PLN03210		1153	Resistant to P. syringae 6; Provisional	98.71
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.71
PLN03210		1153	Resistant to P. syringae 6; Provisional	98.65
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.63
KOG0618\|consensus		1081		98.63
KOG3207\|consensus		505		98.52
KOG0618\|consensus		1081		98.51
KOG0617\|consensus		264		98.42
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	98.36
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	98.33
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.33
KOG0617\|consensus		264		98.26
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	98.21
KOG1947\|consensus		482		98.19
PLN03200		2102	cellulose synthase-interactive protein; Provisiona	98.18
KOG1259\|consensus		490		98.18
KOG1259\|consensus		490		98.16
KOG2982\|consensus		418		98.13
KOG0472\|consensus		565		98.13
KOG1947\|consensus		482		98.12
KOG1859\|consensus		1096		98.09
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	98.05
KOG0166\|consensus		514		98.0
cd00020		120	ARM Armadillo/beta-catenin-like repeats. An approx	98.0
KOG0472\|consensus		565		97.9
KOG4237\|consensus		498		97.86
PLN03150		623	hypothetical protein; Provisional	97.75
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	97.74
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	97.72
KOG2123\|consensus		388		97.63
KOG2982\|consensus		418		97.58
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	97.54
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	97.54
PLN03150		623	hypothetical protein; Provisional	97.5
KOG1644\|consensus		233		97.26
KOG1859\|consensus		1096		97.23
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	97.2
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.12
PF05804		708	KAP: Kinesin-associated protein (KAP)	97.09
KOG2739\|consensus		260		97.03
KOG2739\|consensus		260		96.85
KOG0166\|consensus		514		96.84
KOG0531\|consensus		414		96.8
KOG4224\|consensus		550		96.77
KOG1644\|consensus		233		96.73
PF05804		708	KAP: Kinesin-associated protein (KAP)	96.72
PF04826		254	Arm_2: Armadillo-like; InterPro: IPR006911 This en	96.71
KOG0532\|consensus		722		96.71
KOG0531\|consensus		414		96.67
KOG4308\|consensus		478		96.67
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	96.67
PF03224		312	V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004	96.52
KOG4224\|consensus		550		96.51
cd00020		120	ARM Armadillo/beta-catenin-like repeats. An approx	96.46
KOG3864\|consensus		221		96.45
KOG4658\|consensus		889		96.04
KOG1048\|consensus		717		96.03
KOG4237\|consensus		498		95.81
KOG4658\|consensus		889		95.78
KOG4579\|consensus		177		95.63
KOG2122\|consensus		2195		95.46
KOG4199\|consensus		461		95.28
PF00514		41	Arm: Armadillo/beta-catenin-like repeat; InterPro:	95.13
PRK15386		426	type III secretion protein GogB; Provisional	94.8
KOG0532\|consensus		722		94.67
PF10508		503	Proteasom_PSMB: Proteasome non-ATPase 26S subunit;	94.55
KOG2123\|consensus		388		94.51
KOG3864\|consensus		221		94.25
KOG4308\|consensus		478		94.01
smart00185		41	ARM Armadillo/beta-catenin-like repeats. Approx. 4	93.82
KOG4199\|consensus		461		93.73
PRK15386		426	type III secretion protein GogB; Provisional	93.59
KOG2160\|consensus		342		93.43
KOG4579\|consensus		177		93.39
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	92.03
COG5064		526	SRP1 Karyopherin (importin) alpha [Intracellular t	90.76
PF01602		526	Adaptin_N: Adaptin N terminal region; InterPro: IP	89.53
KOG1410\|consensus		1082		89.26
PF03224		312	V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004	88.55
KOG1222\|consensus		791		88.51
COG5064		526	SRP1 Karyopherin (importin) alpha [Intracellular t	88.44
KOG1241\|consensus		859		87.65
PF10508		503	Proteasom_PSMB: Proteasome non-ATPase 26S subunit;	87.45
KOG1020\|consensus		1692		87.3
KOG3763\|consensus		585		86.97
PF04826		254	Arm_2: Armadillo-like; InterPro: IPR006911 This en	86.8
PRK14707		2710	hypothetical protein; Provisional	85.63
smart00367		26	LRR_CC Leucine-rich repeat - CC (cysteine-containi	83.61
PRK09687		280	putative lyase; Provisional	83.44
KOG3763\|consensus		585		83.08
KOG0414\|consensus		1251		83.03
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	82.81
KOG0168\|consensus		1051		81.91
PF11701		157	UNC45-central: Myosin-binding striated muscle asse	81.88
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	81.76
PF05536		543	Neurochondrin: Neurochondrin	81.68
PF13516		24	LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI	81.38

>KOG3665\|consensus	Back alignment and domain information

Probab=100.00  E-value=2.9e-75  Score=677.94  Aligned_cols=655  Identities=30%  Similarity=0.432  Sum_probs=557.9

Q ss_pred             CCcHHHHHHHHHHhhHHHhhhhcCCCcccccccccccccCCCCChHHHHHHHHHHHhcCCcccchhhHhhccCCCCceeE
Q psy17257         11 PESLVDQCIRYLLHSVDRFTFKFHDVNKFRCEDVKFRCEDVKFPREISEKFLSMYEKSGGIVIDSFVDTFLTKDITHMKS   90 (778)
Q Consensus        11 p~sL~dlCi~~v~~ni~~~~~~~~~~~~~~~~~~~~~~~~~~LP~ei~~~ll~~l~~~~~~l~d~~~~~f~~~~~~~L~~   90 (778)
                      ++||.++-...++.+|.       .|. +       ......|+++.++++...++......+......+..  ..++++
T Consensus         2 ~~sl~~~a~~~ia~~i~-------ng~-y-------~~~~~~ld~~sSn~i~~~ll~~~~~~~~~~~~~~~~--~f~ltk   64 (699)
T KOG3665|consen    2 VSSLADIACQKIAEYIQ-------NGS-Y-------NNLQYELDPKSSNKIYSELLLKKFELTPEFLERIIR--KFNLTK   64 (699)
T ss_pred             CCchhhhhHHHHHHHHh-------cCC-c-------cccceecChhhhHHHHHHHHhccCCCchhHHHhhhh--hheeEE
Confidence            57899999999999887       343 3       446678999999999998887544345555555543  379999


Q ss_pred             EEeeCCccCHHHHHhhccCCccEEecCCCCCCCHh----------HH-HH-HH-hcCCCCceeecCCCCCCCccccchhh
Q psy17257         91 VKLRNAEVSDSGMQKLLSHHVQELELIKCANVSQA----------SL-EV-LN-MSSDQLYSLSLGPHCSMFPDCLESEV  157 (778)
Q Consensus        91 L~L~~~~isd~~l~~L~~~~L~~LdLs~~~~lt~~----------~l-~~-L~-~~~~~L~~L~Ls~c~~~~~~~~~~~~  157 (778)
                      +++.+..+....++.+..+.|++|.|++...+...          .+ .. +. ++.++|++|+++|......+|..   
T Consensus        65 i~l~~~~~~~~~~~~l~~~~L~sl~LGnl~~~k~~~~~~~~idi~~lL~~~Ln~~sr~nL~~LdI~G~~~~s~~W~~---  141 (699)
T KOG3665|consen   65 IDLKNVTLQHQTLEMLRKQDLESLKLGNLDKIKQDYLDDATIDIISLLKDLLNEESRQNLQHLDISGSELFSNGWPK---  141 (699)
T ss_pred             eeccceecchhHHHHHhhccccccCCcchHhhhhhhhhhhhccHHHHHHHHHhHHHHHhhhhcCccccchhhccHHH---
Confidence            99999999999999888777999999887533221          11 11 22 36689999999996655333321   


Q ss_pred             hhccccccccccccchhhhcccCCCCCCCcccchhhhhhcCCCccEEEecCCcccChhHHHHHhccCCCCCeEeccCccc
Q psy17257        158 VVGEKQRADDFMMTDFEININGRATSSGSLTYKQRGYILKAPKLRRFSLIGHTLMSQSICTQLYRDMPHLTHLNLSKCMF  237 (778)
Q Consensus       158 ~l~e~~p~~~~l~~d~~l~i~~~~~~~g~l~~~~~~~~~~l~~L~~L~Ls~~~l~s~~~l~~~~~~lp~L~~LdLS~~~i  237 (778)
                                                         .+...+|+|++|.++|..+ ..+++..++.++|+|.+||||++++
T Consensus       142 -----------------------------------kig~~LPsL~sL~i~~~~~-~~~dF~~lc~sFpNL~sLDIS~TnI  185 (699)
T KOG3665|consen  142 -----------------------------------KIGTMLPSLRSLVISGRQF-DNDDFSQLCASFPNLRSLDISGTNI  185 (699)
T ss_pred             -----------------------------------HHhhhCcccceEEecCcee-cchhHHHHhhccCccceeecCCCCc
Confidence                                               2336899999999999999 6777888999999999999999999


Q ss_pred             cCCcccchHHHhccccccEEEcCCCCCcc-hhhHhhcCCCCccEEeccCCCCCCCCCCCCCCchhhHHHHHhcCCCCCEE
Q psy17257        238 LFDNKDLSFLAEFKDTLVSLVLFNVSIVK-DNLDHICSLPLLRRLDISVSSDYPDYGNYSPNPNDMLSYIIFKLPHLVSL  316 (778)
Q Consensus       238 ~~~~~~l~~L~~l~~~L~~L~L~~~~~~~-~~~~~l~~L~~L~~LdLS~~~~~~~~g~~~~~p~~~L~~~~~~lp~L~~L  316 (778)
                      +    ++.+++.+ .+|++|.|.+..+.. ..+..+++|++|++||+|......  +.  .....+++. ...||+|++|
T Consensus       186 ~----nl~GIS~L-knLq~L~mrnLe~e~~~~l~~LF~L~~L~vLDIS~~~~~~--~~--~ii~qYlec-~~~LpeLrfL  255 (699)
T KOG3665|consen  186 S----NLSGISRL-KNLQVLSMRNLEFESYQDLIDLFNLKKLRVLDISRDKNND--DT--KIIEQYLEC-GMVLPELRFL  255 (699)
T ss_pred             c----CcHHHhcc-ccHHHHhccCCCCCchhhHHHHhcccCCCeeecccccccc--ch--HHHHHHHHh-cccCccccEE
Confidence            9    89999999 699999999999865 677889999999999999998732  11  122345553 6789999999


Q ss_pred             eecCCCCCCCccccccCCCCCCCCCccCCccccccccCccceEeeccccCCC-CccccCCCceEEeCCCCHHHHHHHHHh
Q psy17257        317 DISGTNLAGRGVAEFSSKGSPDVPYVTTDIPGLASRVDRPLEFLGLYGTKHG-ASHRHDIPALRVAGDCNEAQLLIAAKA  395 (778)
Q Consensus       317 DLSgn~l~~~~~~~~~~~~s~~~~~~~~~i~~l~~~~~~~L~~L~L~~t~~~-~~~~~~i~~l~v~g~~~~~qil~al~~  395 (778)
                      |+||+.+..+-+ +                 .++. .||+|+.+++.+|... ++..++++   +.+.++.+....++.|
T Consensus       256 DcSgTdi~~~~l-e-----------------~ll~-sH~~L~~i~~~~~~~~~~~~~~~i~---~ln~at~~s~i~~L~~  313 (699)
T KOG3665|consen  256 DCSGTDINEEIL-E-----------------ELLN-SHPNLQQIAALDCLALSAVSSTEIR---VLNTATLDSSIQALTY  313 (699)
T ss_pred             ecCCcchhHHHH-H-----------------HHHH-hCccHhhhhhhhhhccccccccCce---eeeecchhHHHHHHHH
Confidence            999998865433 2                 3674 9999999999987644 22234444   5555556666666666


Q ss_pred             cC--ChHHHHHHHHHHHHHhcc---ccccCChHHHHHHHHHHHHhhccccchhHHHHHHHHHHHhcCCCCCCChHHHHHH
Q psy17257        396 YI--DRPEMLQQVLNDLYHIFR---YDTCVDIEHALVVVLEALDTHLTERHIQISGSANLFYIVKMKDRPVLSSLTKRHI  470 (778)
Q Consensus       396 y~--~R~~~~~~aL~~L~~l~~---~~~~~~~~e~l~lV~~am~~h~~~~~vq~~gsacL~~L~~~~~~~~~~~~~~~~~  470 (778)
                      |.  +|+..+.++++.++.+++   ...+.+.++|+++|+.+|+.|+.  ..|..|+|||++|+++.. .++++.++..+
T Consensus       314 ~~~l~r~~~v~~cl~~l~~~~~~~~~~~~~~~~~~l~~i~~sm~~~~s--~~~i~~~~CL~~i~~~~~-~~l~~~~~~~~  390 (699)
T KOG3665|consen  314 YLNLKRPSEVSRCLNELLDLLKSLDSTREYDISECLKLIINSMNTFSS--SNQIQGSACLIHIVKHTK-QRLSPLLVSLL  390 (699)
T ss_pred             HHHhcChHHHHHHHHHHHHHHHHhhhhhhhhHHHHHHHHHHHHHhcCC--hhhhhHHHHHHHHHHhhh-hccChHHHHHH
Confidence            65  588899999999999887   33455789999999999999998  788999999999999998 89999999999


Q ss_pred             HHHHHHHHhcCCCchhhhhhHHhhhccCcCCccccccHHHHHHHHHHHHhhhcccCCCCCCchhHHHHHHHHHHHhccCC
Q psy17257        471 ITTILNGMHMHLEDDTMMRNGCLTLCQFKIPQDVQFDYDRLVRILLHIITEMEHESNSNGSNFVLRIAIYLLNSLACQVD  550 (778)
Q Consensus       471 i~~LL~am~~~~~~~~l~~n~~l~l~~~~il~~~~f~~~~~~~~~l~~~~~~~~d~~~~~~~~~~~~av~il~~l~~~~s  550 (778)
                      +..||++|+.   ..++++|+++++|++.++....+++.+.   ++.+..++.+|      +..|+.++.+....++++.
T Consensus       391 l~~LLn~v~~---~~~~~~~~~~~~~~~i~~~~~~~~~~~~---~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~  458 (699)
T KOG3665|consen  391 LKVLLNLVEK---LDTLDSNDELTLCNSIILLLSLLVSRRK---LLSVLDHHEQD------NIQQRLTVCLSISTACQVV  458 (699)
T ss_pred             HHHHHHhhhc---ccccccchhHHHHHHHHHHHHHHHHHHH---Hhhccchhhhh------hhhHHHHHhhcchhHHHHH
Confidence            9999999988   4578999999999999999999999887   88888888877      8888888888889999999


Q ss_pred             HHHHHHhhhhhhHHHHHHHHHHHHhhhccchhHHHHHHHHHhcccccHHHHHHHHhcCChHHHHHHHhhCCCcHHHHHHH
Q psy17257        551 NAHKILLGRLGVIKKMLRLIKDRIEKQRCDDILEVAWSAMWNVTDETAINCARFLNNGGMELFLNCLQYFPEKDELLRNM  630 (778)
Q Consensus       551 ~~~~~~l~~~~~~~~ll~~i~~~~~~~~~d~~l~~~~s~lwn~tde~p~~c~~f~~~~g~~~~~~~l~~f~~~~~l~~~~  630 (778)
                      ..++...+..+++..++..+. +.....|+.+++|+  ++|++||++|++|+.|++.+|++++++|++.| ++.+++++|
T Consensus       459 ~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~--~l~~~t~~~~~~C~~~l~~~g~~~~~~~l~~f-~~~~~~~~i  534 (699)
T KOG3665|consen  459 SITKVNVGELGIVLTLLLRIK-LRKIYWCDDVLEFT--ALWNITDENPETCKEFLDNGGMKLLFKCLESF-DNEELHRKI  534 (699)
T ss_pred             HHHHhccchhHHHHHHHHHHH-hhccchhhHHHHHH--HHHhhhcCCHHHHHHHHhcccHHHHHHHHhhc-cchhHHHHH
Confidence            999999999999999999999 88888999999998  99999999999999999999999999999999 899999999


Q ss_pred             HhhhhhhhhhhhhhhcccchhHHH--HHHHhhccCCCCchhhHHHHHHHHHHhccCCCccccccccHHHHHHHHHHHhcc
Q psy17257        631 MGLLGNVAEVKSLRPKLMTSKFIE--VFANLVSSKSDGIEVSYNAAGVLSHIASDGPEAWTIRYPAREKVLAKMVEAIER  708 (778)
Q Consensus       631 lgll~niaev~~l~~~l~~~~~i~--~~~~ll~~~~~~~evsy~a~gilahl~~~~~~~w~~~~~~r~~~~~~~~~~i~~  708 (778)
                      ||+++|+|+|.++++.+|..+++.  +|..++..+ +++|+||+|||||||++++|++  +...+.|+++.+.|+++|.+
T Consensus       535 l~~l~n~~~~~~~~~~~~~~~~~~~~~f~~~~~~w-~~~ersY~~~siLa~ll~~~~~--~~~~~~r~~~~~~l~e~i~~  611 (699)
T KOG3665|consen  535 LGLLGNLAEVLELRELLMIFEFIDFSVFKVLLNKW-DSIERSYNAASILALLLSDSEK--TTECVFRNSVNELLVEAISR  611 (699)
T ss_pred             HHHHHHHHHHhhhhhhhhHHHHHHHHHHHHHHhhc-chhhHHHHHHHHHHHHHhCCCc--CccccchHHHHHHHHHHhhc
Confidence            999999999999999999999988  888877776 7899999999999999999988  45789999999999999999


Q ss_pred             CCCCCccceecccchh-hHHhhccCCCchhhHHHHHHHHHhcccCCccccchhhhhchHHHHHHHhhcc
Q psy17257        709 WPIDSERNINYRSFEP-IIQLLRVYHTPECQHWSVWALANLTKVYPEKYCQVVEAEGGIELLQNLLDNE  776 (778)
Q Consensus       709 w~~~~~~~v~yrsf~p-~~~ll~~~~~~~~q~wa~wa~~~~~~~~~~~y~~~~~~e~g~~~l~~~~~~~  776 (778)
                      |+.+..++++||||.| |.+++++++.||+||||+||++|++++||+ ||+++.++||.+.+.++..++
T Consensus       612 ~~~~~~~~~~~~~f~~~~~~il~~s~~~g~~lWal~ti~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~  679 (699)
T KOG3665|consen  612 WLTSEIRVINDRSFFPRILRILRLSKSDGSQLWALWTIKNVLEQNKE-YCKLVRESNGFELIENIRVLS  679 (699)
T ss_pred             cCccceeehhhhhcchhHHHHhcccCCCchHHHHHHHHHHHHHcChh-hhhhhHhccchhhhhhcchhH
Confidence            9999999999999999 999999999999999999999999999999 999999999999999887653

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG3207\|consensus	Back alignment and domain information

>KOG4194\|consensus	Back alignment and domain information

>KOG2120\|consensus	Back alignment and domain information

>KOG4341\|consensus	Back alignment and domain information

>KOG2120\|consensus	Back alignment and domain information

>KOG4341\|consensus	Back alignment and domain information

>KOG4194\|consensus	Back alignment and domain information

>KOG1909\|consensus	Back alignment and domain information

>KOG0444\|consensus	Back alignment and domain information

>KOG0444\|consensus	Back alignment and domain information

>KOG3665\|consensus	Back alignment and domain information

>KOG1909\|consensus	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0618\|consensus	Back alignment and domain information

>KOG3207\|consensus	Back alignment and domain information

>KOG0618\|consensus	Back alignment and domain information

>KOG0617\|consensus	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>KOG0617\|consensus	Back alignment and domain information

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>KOG1947\|consensus	Back alignment and domain information

>PLN03200 cellulose synthase-interactive protein; Provisional	Back alignment and domain information

>KOG1259\|consensus	Back alignment and domain information

>KOG1259\|consensus	Back alignment and domain information

>KOG2982\|consensus	Back alignment and domain information

>KOG0472\|consensus	Back alignment and domain information

>KOG1947\|consensus	Back alignment and domain information

>KOG1859\|consensus	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG0166\|consensus	Back alignment and domain information

>cd00020 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>KOG0472\|consensus	Back alignment and domain information

>KOG4237\|consensus	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>KOG2123\|consensus	Back alignment and domain information

>KOG2982\|consensus	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>KOG1644\|consensus	Back alignment and domain information

>KOG1859\|consensus	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF05804 KAP: Kinesin-associated protein (KAP)	Back alignment and domain information

>KOG2739\|consensus	Back alignment and domain information

>KOG2739\|consensus	Back alignment and domain information

>KOG0166\|consensus	Back alignment and domain information

>KOG0531\|consensus	Back alignment and domain information

>KOG4224\|consensus	Back alignment and domain information

>KOG1644\|consensus	Back alignment and domain information

>PF05804 KAP: Kinesin-associated protein (KAP)	Back alignment and domain information

>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function	Back alignment and domain information

>KOG0532\|consensus	Back alignment and domain information

>KOG0531\|consensus	Back alignment and domain information

>KOG4308\|consensus	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>KOG4224\|consensus	Back alignment and domain information

>cd00020 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>KOG3864\|consensus	Back alignment and domain information

>KOG4658\|consensus	Back alignment and domain information

>KOG1048\|consensus	Back alignment and domain information

>KOG4237\|consensus	Back alignment and domain information

>KOG4658\|consensus	Back alignment and domain information

>KOG4579\|consensus	Back alignment and domain information

>KOG2122\|consensus	Back alignment and domain information

>KOG4199\|consensus	Back alignment and domain information

>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG0532\|consensus	Back alignment and domain information

>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells	Back alignment and domain information

>KOG2123\|consensus	Back alignment and domain information

>KOG3864\|consensus	Back alignment and domain information

>KOG4308\|consensus	Back alignment and domain information

>smart00185 ARM Armadillo/beta-catenin-like repeats	Back alignment and domain information

>KOG4199\|consensus	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>KOG2160\|consensus	Back alignment and domain information

>KOG4579\|consensus	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion]	Back alignment and domain information

>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>KOG1410\|consensus	Back alignment and domain information

>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane	Back alignment and domain information

>KOG1222\|consensus	Back alignment and domain information

>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion]	Back alignment and domain information

>KOG1241\|consensus	Back alignment and domain information

>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells	Back alignment and domain information

>KOG1020\|consensus	Back alignment and domain information

>KOG3763\|consensus	Back alignment and domain information

>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function	Back alignment and domain information

>PRK14707 hypothetical protein; Provisional	Back alignment and domain information

>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily	Back alignment and domain information

>PRK09687 putative lyase; Provisional	Back alignment and domain information

>KOG3763\|consensus	Back alignment and domain information

>KOG0414\|consensus	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

>KOG0168\|consensus	Back alignment and domain information

>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF05536 Neurochondrin: Neurochondrin	Back alignment and domain information

>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		778
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	2e-17
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	9e-16
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	7e-12
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	2e-09
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	1e-15
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	9e-15
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	2e-12
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	3e-11
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	3e-06
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	1e-15
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	5e-15
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	6e-13
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	5e-07
3oqs_A		510	Importin subunit alpha-2; importin alpha, karyophe	6e-15
3oqs_A		510	Importin subunit alpha-2; importin alpha, karyophe	3e-10
3oqs_A		510	Importin subunit alpha-2; importin alpha, karyophe	8e-09
3nmz_A		458	APC variant protein; protein-protein complex, arma	7e-13
3nmz_A		458	APC variant protein; protein-protein complex, arma	9e-08
3nmz_A		458	APC variant protein; protein-protein complex, arma	9e-08
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	7e-13
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	2e-09
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	3e-09
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	2e-04
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	2e-12
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	2e-04
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	3e-04
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	3e-12
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	1e-08
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	9e-12
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	9e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	4e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-07
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	8e-11
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	9e-11
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	1e-10
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	6e-05
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	8e-05
1xqr_A		296	HSPBP1 protein; armadillo repeat, superhelical twi	6e-09
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	5e-08
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	7e-08
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	1e-05
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-07
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	1e-05
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-07
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-06
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	7e-06
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	7e-04
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	1e-06
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	2e-05
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	3e-05
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	6e-04
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	7e-05
3tt9_A		233	Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	7e-05

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644	Back alignment and structure

 Score = 85.4 bits (211), Expect = 2e-17
 Identities = 38/269 (14%), Positives = 92/269 (34%), Gaps = 28/269 (10%)

Query: 528 SNGSNFVLRIAIYLLNSLACQVDNAHKILLGRLGVIKKMLRLIKDRIEKQRCDDILEVAW 587
            +  + VL  AI  L++L    +   K+ +   G ++KM+ L+            L +  
Sbjct: 108 GSPVDSVLFYAITTLHNLLLHQEG-AKMAVRLAGGLQKMVALLNKT-----NVKFLAITT 161

Query: 588 SAMWNVTDETAINCARFLNNGGMELFLNCLQYFPEKDELLRNMMGLLGNVAEVKSLRPKL 647
             +  +      +    L +GG +  +N ++     ++LL     +L  ++   S +P +
Sbjct: 162 DCLQILAYGNQESKLIILASGGPQALVNIMRT-YTYEKLLWTTSRVLKVLSVCSSNKPAI 220

Query: 648 MTSKFIEVFANLVSSKSDGIEVSYNAAGVLSHIASDGPEAWTIRYPA-----------RE 696
           + +  ++     ++  S    +  N    L ++ SD                        
Sbjct: 221 VEAGGMQALGLHLTDPSQ--RLVQNCLWTLRNL-SDAATKQEGMEGLLGTLVQLLGSDDI 277

Query: 697 KVLAKMVEAIERWPIDSERN----INYRSFEPIIQLLRVYHT-PECQHWSVWALANLTKV 751
            V+      +     ++ +N          E +++ +       +    ++ AL +LT  
Sbjct: 278 NVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSR 337

Query: 752 YP--EKYCQVVEAEGGIELLQNLLDNENK 778
           +   E     V    G+ ++  LL   + 
Sbjct: 338 HQEAEMAQNAVRLHYGLPVVVKLLHPPSH 366

PyMOL of 2z6h

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780	Back alignment and structure

>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510	Back alignment and structure

>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510	Back alignment and structure

>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252	Back alignment and structure

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210	Back alignment and structure

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584	Back alignment and structure

>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176	Back alignment and structure

>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		778
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.67
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.64
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.57
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.56
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.54
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.53
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.53
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.52
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.5
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.5
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.5
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.49
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.49
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.48
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.48
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.47
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.47
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.47
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.47
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.47
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.46
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.46
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.45
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.44
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.44
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.44
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.43
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.43
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.43
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.42
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.42
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.41
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.41
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.4
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.39
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	99.39
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.39
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.39
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.38
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.38
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.38
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.37
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.37
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.37
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.37
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.37
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.36
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.36
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.35
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.35
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.35
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.35
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.35
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.35
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.35
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.34
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.34
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.34
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.34
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.34
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.34
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.34
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	99.33
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.33
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.33
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.33
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.32
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.32
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.32
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.31
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.31
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.29
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.29
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.29
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.28
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.27
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.27
3ul1_B		510	Importin subunit alpha-2; arm repeat, armadillo re	99.27
4b8j_A		528	Importin subunit alpha-1A; transport protein, nucl	99.25
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.25
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.25
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.24
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.23
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.23
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.23
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.22
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.22
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.22
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.22
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.22
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.22
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.2
3tpo_A		529	Importin subunit alpha-2; nuclear import, protein	99.2
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.2
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.19
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.18
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	99.18
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	99.18
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	99.17
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.17
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	99.17
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.15
4hxt_A		252	De novo protein OR329; structural genomics, PSI-bi	99.15
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.12
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.12
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.12
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	99.11
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.1
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.09
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.09
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.09
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.08
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.07
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.06
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.05
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.05
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	99.05
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	99.03
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.02
1jdh_A		529	Beta-catenin; beta-catenin, protein-protein comple	99.01
4b8j_A		528	Importin subunit alpha-1A; transport protein, nucl	99.0
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	98.99
3nmz_A		458	APC variant protein; protein-protein complex, arma	98.99
3nmz_A		458	APC variant protein; protein-protein complex, arma	98.98
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.97
3tpo_A		529	Importin subunit alpha-2; nuclear import, protein	98.97
3ul1_B		510	Importin subunit alpha-2; arm repeat, armadillo re	98.96
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.94
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.94
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	98.94
2z6h_A		644	Catenin beta-1, beta-catenin; C-terminal domain, a	98.94
3e6j_A		229	Variable lymphocyte receptor diversity region; var	98.93
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	98.93
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.92
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.92
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.91
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	98.91
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	98.91
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	98.9
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.9
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	98.88
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	98.88
3now_A		810	UNC-45 protein, SD10334P; armadillo repeat, HSP90,	98.88
4hxt_A		252	De novo protein OR329; structural genomics, PSI-bi	98.86
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.84
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	98.84
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.83
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	98.82
3nmw_A		354	APC variant protein; ARMADIILO repeats domain, cel	98.82
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	98.81
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.81
1xm9_A		457	Plakophilin 1; armadillo repeat, cell adhesion; 2.	98.8
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.78
2z6g_A		780	B-catenin; FULL-length, beta-catenin, cell adhesio	98.75
2jdq_A		450	Importin alpha-1 subunit; transport, PB2 subunit,	98.75
4db6_A		210	Armadillo repeat protein; solenoid repeat, armadil	98.75
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.74
4db8_A		252	Armadillo-repeat protein; solenoid repeat, de novo	98.71
1wa5_B		530	Importin alpha subunit; nuclear transport/complex,	98.71
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.69
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.69
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.68
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	98.65
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.65
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	98.63
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.59
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.56
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.52
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.52
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	98.49
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.46
3l6x_A		584	Catenin delta-1; catenin, armadillo, ARM, JMD, CE	98.45
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.4
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.36
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.34
1xqr_A		296	HSPBP1 protein; armadillo repeat, superhelical twi	98.3
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.27
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.27
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.24
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.23
3opb_A		778	SWI5-dependent HO expression protein 4; heat and a	98.18
1xqr_A		296	HSPBP1 protein; armadillo repeat, superhelical twi	98.18
3tt9_A		233	Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	98.05
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	97.96
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.85
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	97.7
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	97.65
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	97.64
3opb_A		778	SWI5-dependent HO expression protein 4; heat and a	97.58
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	97.55
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	97.43
3tt9_A		233	Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	97.41
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	97.37
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	96.71
4fdd_A		852	Transportin-1; heat repeats, karyopherin, nuclear	94.72
2bpt_A		861	Importin beta-1 subunit; nuclear transport, nucleo	93.83
2bpt_A		861	Importin beta-1 subunit; nuclear transport, nucleo	93.69
1qgr_A		876	Protein (importin beta subunit); transport recepto	93.35
1ibr_B		462	P95, importin beta-1 subunit, nuclear factor; smal	93.03
1qgr_A		876	Protein (importin beta subunit); transport recepto	92.25
1w63_A		618	Adapter-related protein complex 1 gamma 1 subunit;	92.16
4fdd_A		852	Transportin-1; heat repeats, karyopherin, nuclear	91.13
4gmo_A		684	Putative uncharacterized protein; ARM, heat, solen	90.56
1oyz_A		280	Hypothetical protein YIBA; structural genomics, PS	89.34
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	86.72
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	86.46
3ltj_A		201	Alpharep-4; protein engineering, heat-like repeat,	85.76
3grl_A		651	General vesicular transport factor P115; vesicle t	85.6
1b3u_A		588	Protein (protein phosphatase PP2A); scaffold prote	85.26
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	84.85
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	84.38
2vgl_B		591	AP-2 complex subunit beta-1; cytoplasmic vesicle,	83.84
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	82.76
1b3u_A		588	Protein (protein phosphatase PP2A); scaffold prote	81.72
1oyz_A		280	Hypothetical protein YIBA; structural genomics, PS	81.61
4gmo_A		684	Putative uncharacterized protein; ARM, heat, solen	81.61
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	80.17

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

Probab=99.67  E-value=8.9e-16  Score=165.85  Aligned_cols=214  Identities=22%  Similarity=0.241  Sum_probs=121.1

Q ss_pred             CCCChHHHHHHHHHHH-----hcCCcccchhhHhhccCCCCceeEEEeeCCccCHHHHHhhc------------------
Q psy17257         51 VKFPREISEKFLSMYE-----KSGGIVIDSFVDTFLTKDITHMKSVKLRNAEVSDSGMQKLL------------------  107 (778)
Q Consensus        51 ~~LP~ei~~~ll~~l~-----~~~~~l~d~~~~~f~~~~~~~L~~L~L~~~~isd~~l~~L~------------------  107 (778)
                      ..||.|+..+|+..+.     ... .+...+..+..++  ..++.++++++.+.+..+..+.                  
T Consensus        10 ~~LP~eil~~If~~L~~~d~~~~~-~vc~~W~~~~~~~--~~~~~l~l~~~~~~~~~~~~~~~~~l~~L~l~~n~l~~~~   86 (336)
T 2ast_B           10 DSLPDELLLGIFSCLCLPELLKVS-GVCKRWYRLASDE--SLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPL   86 (336)
T ss_dssp             SSSCHHHHHHHHTTSCHHHHHHTT-SSCHHHHHHHTCS--TTSSEEECTTCBCCHHHHHHHHHTTCSEEECTTCEECSCC
T ss_pred             hhCCHHHHHHHHHhCCHHHHHHHH-HHHHHHHHHhcCc--hhheeeccccccCCHHHHHhhhhccceEEEcCCccccccc
Confidence            5689999988876432     233 3666666665443  3577888887777765554331                  


Q ss_pred             -----cCCccEEecCCCCCCCHhHHHHHHhcCCCCceeecCCCCCCCccccchhhhhccccccccccccchhhhcccCCC
Q psy17257        108 -----SHHVQELELIKCANVSQASLEVLNMSSDQLYSLSLGPHCSMFPDCLESEVVVGEKQRADDFMMTDFEININGRAT  182 (778)
Q Consensus       108 -----~~~L~~LdLs~~~~lt~~~l~~L~~~~~~L~~L~Ls~c~~~~~~~~~~~~~l~e~~p~~~~l~~d~~l~i~~~~~  182 (778)
                           .++|++|++++| .+++..+..+...+++|++|++++|...  +..+                            
T Consensus        87 ~~~~~~~~L~~L~L~~~-~l~~~~~~~~~~~~~~L~~L~L~~~~l~--~~~~----------------------------  135 (336)
T 2ast_B           87 AEHFSPFRVQHMDLSNS-VIEVSTLHGILSQCSKLQNLSLEGLRLS--DPIV----------------------------  135 (336)
T ss_dssp             CSCCCCBCCCEEECTTC-EECHHHHHHHHTTBCCCSEEECTTCBCC--HHHH----------------------------
T ss_pred             hhhccCCCCCEEEccCC-CcCHHHHHHHHhhCCCCCEEeCcCcccC--HHHH----------------------------
Confidence                 256777777777 4766656655566778888888777542  1111                            


Q ss_pred             CCCCcccchhhhhhcCCCccEEEecCC-cccChhHHHHHhccCCCCCeEeccCc-cccCCcccch-HHHhccc-cccEEE
Q psy17257        183 SSGSLTYKQRGYILKAPKLRRFSLIGH-TLMSQSICTQLYRDMPHLTHLNLSKC-MFLFDNKDLS-FLAEFKD-TLVSLV  258 (778)
Q Consensus       183 ~~g~l~~~~~~~~~~l~~L~~L~Ls~~-~l~s~~~l~~~~~~lp~L~~LdLS~~-~i~~~~~~l~-~L~~l~~-~L~~L~  258 (778)
                                ..+..+++|++|++++| .+ ++..++..+..+++|++|++++| .++ +. .+. .+..+ + +|++|+
T Consensus       136 ----------~~l~~~~~L~~L~L~~~~~l-~~~~l~~~~~~~~~L~~L~l~~~~~l~-~~-~~~~~~~~l-~~~L~~L~  201 (336)
T 2ast_B          136 ----------NTLAKNSNLVRLNLSGCSGF-SEFALQTLLSSCSRLDELNLSWCFDFT-EK-HVQVAVAHV-SETITQLN  201 (336)
T ss_dssp             ----------HHHTTCTTCSEEECTTCBSC-CHHHHHHHHHHCTTCCEEECCCCTTCC-HH-HHHHHHHHS-CTTCCEEE
T ss_pred             ----------HHHhcCCCCCEEECCCCCCC-CHHHHHHHHhcCCCCCEEcCCCCCCcC-hH-HHHHHHHhc-ccCCCEEE
Confidence                      11244666666666666 34 55455555566666666666666 554 11 122 24444 4 666666


Q ss_pred             cCCC--CCcc-hhhHhhcCCCCccEEeccCCCCCCCCCCCCCCchhhHHHHHhcCCCCCEEeecCCC
Q psy17257        259 LFNV--SIVK-DNLDHICSLPLLRRLDISVSSDYPDYGNYSPNPNDMLSYIIFKLPHLVSLDISGTN  322 (778)
Q Consensus       259 L~~~--~~~~-~~~~~l~~L~~L~~LdLS~~~~~~~~g~~~~~p~~~L~~~~~~lp~L~~LDLSgn~  322 (778)
                      +++|  .+++ .++..+..+++|++|++++|..+++.+         +. .+..+++|+.|++++|.
T Consensus       202 l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~---------~~-~l~~l~~L~~L~l~~~~  258 (336)
T 2ast_B          202 LSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDC---------FQ-EFFQLNYLQHLSLSRCY  258 (336)
T ss_dssp             CCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGG---------GG-GGGGCTTCCEEECTTCT
T ss_pred             eCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCcCCHHH---------HH-HHhCCCCCCEeeCCCCC
Confidence            6666  3332 333444556666666666665322110         11 24455666666666664

PyMOL of 2ast

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ...	Back alignment and structure

>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens}	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A	Back alignment and structure

>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens}	Back alignment and structure

>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens}	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B	Back alignment and structure

>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ...	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24	Back alignment and structure

>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens}	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio}	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster}	Back alignment and structure

>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster}	Back alignment and structure

>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene}	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A	Back alignment and structure

>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio}	Back alignment and structure

>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A	Back alignment and structure

>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct}	Back alignment and structure

>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A*	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A*	Back alignment and structure

>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B*	Back alignment and structure

>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A	Back alignment and structure

>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A	Back alignment and structure

>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A	Back alignment and structure

>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A	Back alignment and structure

>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A	Back alignment and structure

>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1	Back alignment and structure

>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B*	Back alignment and structure

>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A	Back alignment and structure

>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic}	Back alignment and structure

>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A	Back alignment and structure

>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A	Back alignment and structure

>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16	Back alignment and structure

>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		778
d1jdha_		529	a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens)	7e-08
d1q1sc_		434	a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus	6e-04
d1wa5b_		503	a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S	7e-04
d1koha1		162	c.10.2.3 (A:201-362) mRNA export factor tap {Human	0.003
d1xm9a1		457	a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo	0.004

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529	Back information, alignment and structure


class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: beta-Catenin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 53.4 bits (126), Expect = 7e-08
 Identities = 38/244 (15%), Positives = 83/244 (34%), Gaps = 10/244 (4%)

Query: 535 LRIAIYLLNSLACQVDNAHKILLGRLGVIKKMLRLIKDRIEKQRCDDILEVAWSAMWNVT 594
           +      + S     +  +K+++ ++G I+ ++R +    +++   +    A   + +  
Sbjct: 282 VVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRH 341

Query: 595 DETAINCARFLNNGGMELFLNCLQYFPEKDELLRNMMGLLGNVAEVKSLRPKLMTSKFIE 654
            E  +       + G+ + +  L   P    L++  +GL+ N+A   +    L     I 
Sbjct: 342 QEAEMAQNAVRLHYGLPVVVKLLHP-PSHWPLIKATVGLIRNLALCPANHAPLREQGAIP 400

Query: 655 VFANLVSSKSDGIEVSYNAAGVLSHIASDGPEAWTIRYPAREKVLAKMVEAIERWPIDSE 714
               L+       +   +  G       +G     I       +     +   R  I   
Sbjct: 401 RLVQLLVRAHQDTQRRTSMGGTQQQFV-EGVRMEEIVEGCTGALHILARDVHNRIVIRGL 459

Query: 715 RNINYRSFEPIIQLLRVYHTPECQHWSVWALANLTKVYPEKYCQVVEAEGGIELLQNLLD 774
             I        +QLL        Q  +   L  L +   ++  + +EAEG    L  LL 
Sbjct: 460 NTI-----PLFVQLLY-SPIENIQRVAAGVLCELAQD--KEAAEAIEAEGATAPLTELLH 511

Query: 775 NENK 778
           + N+
Sbjct: 512 SRNE 515

PyMOL of d1jdha_

>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434	Back information, alignment and structure

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		778
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.67
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.65
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.28
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.26
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.26
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.24
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.24
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	99.22
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.22
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.2
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.19
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.15
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.11
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.08
d1q1sc_		434	Importin alpha {Mouse (Mus musculus) [TaxId: 10090	99.04
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.03
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.03
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.01
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	99.0
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	98.95
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.92
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	98.92
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	98.91
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.91
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	98.9
d1q1sc_		434	Importin alpha {Mouse (Mus musculus) [TaxId: 10090	98.86
d1jdha_		529	beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	98.85
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.83
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.73
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.72
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.66
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	98.61
d1jdha_		529	beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	98.58
d1xqra1		264	Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi	98.56
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.52
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	98.48
d1wa5b_		503	Karyopherin alpha {Baker's yeast (Saccharomyces ce	98.45
d1wa5b_		503	Karyopherin alpha {Baker's yeast (Saccharomyces ce	98.38
d1xm9a1		457	Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	98.17
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	98.16
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	98.07
d1xm9a1		457	Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	98.06
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.05
d2ifga3		156	High affinity nerve growth factor receptor, N-term	97.98
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	97.97
d1xqra1		264	Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi	97.94
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	97.79
d2ifga3		156	High affinity nerve growth factor receptor, N-term	97.75
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	97.74
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	97.7
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.65
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.46
d1qgra_		876	Importin beta {Human (Homo sapiens) [TaxId: 9606]}	90.12
d1ibrb_		458	Importin beta {Human (Homo sapiens) [TaxId: 9606]}	88.82
d2vglb_		579	Adaptin beta subunit N-terminal fragment {Human (H	82.82
d1b3ua_		588	Constant regulatory domain of protein phosphatase	82.67
d1b3ua_		588	Constant regulatory domain of protein phosphatase	82.46
d2bpta1		861	Importin beta {Baker's yeast (Saccharomyces cerevi	81.22

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.67  E-value=3.3e-16  Score=163.51  Aligned_cols=185  Identities=21%  Similarity=0.223  Sum_probs=142.5

Q ss_pred             CCCceeEEEeeCCccCHHHHHhhc--cCCccEEecCCCCCCCHhHHHHHHhcCCCCceeecCCCCCCCccccchhhhhcc
Q psy17257         84 DITHMKSVKLRNAEVSDSGMQKLL--SHHVQELELIKCANVSQASLEVLNMSSDQLYSLSLGPHCSMFPDCLESEVVVGE  161 (778)
Q Consensus        84 ~~~~L~~L~L~~~~isd~~l~~L~--~~~L~~LdLs~~~~lt~~~l~~L~~~~~~L~~L~Ls~c~~~~~~~~~~~~~l~e  161 (778)
                      ...+|++|+|++|.+++.++..+.  +++|++|++++| .+++..+..++. +++|++|++++|..+++.+..       
T Consensus        44 ~~~~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~-~l~~~~~~~l~~-~~~L~~L~Ls~c~~itd~~l~-------  114 (284)
T d2astb2          44 SPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTLAK-NSNLVRLNLSGCSGFSEFALQ-------  114 (284)
T ss_dssp             CCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTC-BCCHHHHHHHTT-CTTCSEEECTTCBSCCHHHHH-------
T ss_pred             cCCCCCEEECCCCccCHHHHHHHHHhCCCccccccccc-CCCcHHHHHHhc-CCCCcCccccccccccccccc-------
Confidence            336899999999999998887543  789999999999 699888888864 689999999999877543321       


Q ss_pred             ccccccccccchhhhcccCCCCCCCcccchhhhhhcCCCccEEEecCCcccChhHHHHHhcc-CCCCCeEeccCcc--cc
Q psy17257        162 KQRADDFMMTDFEININGRATSSGSLTYKQRGYILKAPKLRRFSLIGHTLMSQSICTQLYRD-MPHLTHLNLSKCM--FL  238 (778)
Q Consensus       162 ~~p~~~~l~~d~~l~i~~~~~~~g~l~~~~~~~~~~l~~L~~L~Ls~~~l~s~~~l~~~~~~-lp~L~~LdLS~~~--i~  238 (778)
                                                     .+...+++|++|++++|..++++++...+.. +++|+.|+++++.  ++
T Consensus       115 -------------------------------~l~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~  163 (284)
T d2astb2         115 -------------------------------TLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQ  163 (284)
T ss_dssp             -------------------------------HHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSC
T ss_pred             -------------------------------hhhHHHHhccccccccccccccccchhhhcccccccchhhhcccccccc
Confidence                                           2346789999999999865477776555544 6899999999763  43


Q ss_pred             CCcccchHH-HhccccccEEEcCCCC-CcchhhHhhcCCCCccEEeccCCCCCCCCCCCCCCchhhHHHHHhcCCCCCEE
Q psy17257        239 FDNKDLSFL-AEFKDTLVSLVLFNVS-IVKDNLDHICSLPLLRRLDISVSSDYPDYGNYSPNPNDMLSYIIFKLPHLVSL  316 (778)
Q Consensus       239 ~~~~~l~~L-~~l~~~L~~L~L~~~~-~~~~~~~~l~~L~~L~~LdLS~~~~~~~~g~~~~~p~~~L~~~~~~lp~L~~L  316 (778)
                       +. .+..+ ..+ ++|++|++++|. +++..+..+.++++|++|++++|..++++|.         . .+..+|+|+.|
T Consensus       164 -~~-~l~~l~~~~-~~L~~L~L~~~~~itd~~~~~l~~~~~L~~L~L~~C~~i~~~~l---------~-~L~~~~~L~~L  230 (284)
T d2astb2         164 -KS-DLSTLVRRC-PNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETL---------L-ELGEIPTLKTL  230 (284)
T ss_dssp             -HH-HHHHHHHHC-TTCSEEECTTCTTCCGGGGGGGGGCTTCCEEECTTCTTCCGGGG---------G-GGGGCTTCCEE
T ss_pred             -cc-ccccccccc-ccccccccccccCCCchhhhhhcccCcCCEEECCCCCCCChHHH---------H-HHhcCCCCCEE
Confidence             22 34444 456 799999999875 5677788889999999999999876554321         1 25779999999


Q ss_pred             eecCC
Q psy17257        317 DISGT  321 (778)
Q Consensus       317 DLSgn  321 (778)
                      |++||
T Consensus       231 ~l~~~  235 (284)
T d2astb2         231 QVFGI  235 (284)
T ss_dssp             ECTTS
T ss_pred             eeeCC
Confidence            99998

PyMOL of d2astb2

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure