Psyllid ID: psy17303
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 159 | ||||||
| 383866338 | 237 | PREDICTED: dihydropteridine reductase-li | 0.616 | 0.413 | 0.56 | 5e-24 | |
| 195135535 | 235 | GI16833 [Drosophila mojavensis] gi|19391 | 0.534 | 0.361 | 0.639 | 2e-23 | |
| 157114407 | 235 | dihydropteridine reductase [Aedes aegypt | 0.534 | 0.361 | 0.616 | 2e-23 | |
| 157114409 | 232 | dihydropteridine reductase [Aedes aegypt | 0.534 | 0.366 | 0.616 | 2e-23 | |
| 312375153 | 234 | hypothetical protein AND_14502 [Anophele | 0.534 | 0.363 | 0.616 | 3e-23 | |
| 125980289 | 235 | GA18340 [Drosophila pseudoobscura pseudo | 0.534 | 0.361 | 0.616 | 4e-23 | |
| 195326223 | 235 | GM25120 [Drosophila sechellia] gi|194118 | 0.534 | 0.361 | 0.616 | 6e-23 | |
| 195490952 | 235 | GE20807 [Drosophila yakuba] gi|194179458 | 0.534 | 0.361 | 0.616 | 8e-23 | |
| 195375020 | 235 | GJ12582 [Drosophila virilis] gi|19415345 | 0.534 | 0.361 | 0.639 | 9e-23 | |
| 195588955 | 158 | GD14155 [Drosophila simulans] gi|1941962 | 0.534 | 0.537 | 0.616 | 1e-22 |
| >gi|383866338|ref|XP_003708627.1| PREDICTED: dihydropteridine reductase-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 115 bits (289), Expect = 5e-24, Method: Compositional matrix adjust.
Identities = 56/100 (56%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
Query: 62 KSADNTLI--PLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSAD 119
+ AD +I P W Q +L E+ IL G+K+DA+ICVAGGWA GNA+ KDF+K++D
Sbjct: 41 EQADANVIVKPENDWQQQGVDILQEVTNILKGNKVDAIICVAGGWAGGNASHKDFIKNSD 100
Query: 120 IMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP 159
+MW+QSVWSS++A+ IAA+HLK GG +SL GAK AL TP
Sbjct: 101 LMWKQSVWSSIIASNIAAHHLKEGGFLSLTGAKAALAETP 140
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195135535|ref|XP_002012188.1| GI16833 [Drosophila mojavensis] gi|193918452|gb|EDW17319.1| GI16833 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|157114407|ref|XP_001652256.1| dihydropteridine reductase [Aedes aegypti] gi|94469144|gb|ABF18421.1| dihydropteridine reductase [Aedes aegypti] gi|108877300|gb|EAT41525.1| AAEL006836-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|157114409|ref|XP_001652257.1| dihydropteridine reductase [Aedes aegypti] gi|108877301|gb|EAT41526.1| AAEL006836-PB [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|312375153|gb|EFR22576.1| hypothetical protein AND_14502 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|125980289|ref|XP_001354169.1| GA18340 [Drosophila pseudoobscura pseudoobscura] gi|195174538|ref|XP_002028030.1| GL15041 [Drosophila persimilis] gi|54642473|gb|EAL31221.1| GA18340 [Drosophila pseudoobscura pseudoobscura] gi|194115752|gb|EDW37795.1| GL15041 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|195326223|ref|XP_002029829.1| GM25120 [Drosophila sechellia] gi|194118772|gb|EDW40815.1| GM25120 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|195490952|ref|XP_002093357.1| GE20807 [Drosophila yakuba] gi|194179458|gb|EDW93069.1| GE20807 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|195375020|ref|XP_002046301.1| GJ12582 [Drosophila virilis] gi|194153459|gb|EDW68643.1| GJ12582 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195588955|ref|XP_002084222.1| GD14155 [Drosophila simulans] gi|194196231|gb|EDX09807.1| GD14155 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 159 | ||||||
| FB|FBgn0035964 | 235 | Dhpr "Dihydropteridine reducta | 0.534 | 0.361 | 0.511 | 1.1e-18 | |
| WB|WBGene00011398 | 236 | qdpr-1 [Caenorhabditis elegans | 0.540 | 0.364 | 0.453 | 1.1e-16 | |
| UNIPROTKB|B7Z415 | 152 | QDPR "Quinoid dihydropteridine | 0.540 | 0.565 | 0.395 | 3.3e-15 | |
| UNIPROTKB|D6RGG7 | 162 | QDPR "Dihydropteridine reducta | 0.540 | 0.530 | 0.395 | 3.3e-15 | |
| UNIPROTKB|H0Y8F7 | 128 | QDPR "Dihydropteridine reducta | 0.540 | 0.671 | 0.395 | 3.3e-15 | |
| UNIPROTKB|P09417 | 244 | QDPR "Dihydropteridine reducta | 0.540 | 0.352 | 0.395 | 3.3e-15 | |
| UNIPROTKB|I3LKS6 | 243 | QDPR "Dihydropteridine reducta | 0.540 | 0.353 | 0.395 | 3.3e-15 | |
| RGD|619915 | 241 | Qdpr "quinoid dihydropteridine | 0.540 | 0.356 | 0.395 | 4.2e-15 | |
| UNIPROTKB|Q3T0Z7 | 242 | QDPR "Dihydropteridine reducta | 0.540 | 0.355 | 0.395 | 5.4e-15 | |
| UNIPROTKB|B3KW71 | 213 | QDPR "Dihydropteridine reducta | 0.496 | 0.370 | 0.417 | 5.4e-15 |
| FB|FBgn0035964 Dhpr "Dihydropteridine reductase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 225 (84.3 bits), Expect = 1.1e-18, P = 1.1e-18
Identities = 44/86 (51%), Positives = 60/86 (69%)
Query: 74 WTQIETTVLAELKTILAGDKIDAVICXXXXXXXXXXXXKDFVKSADIMWRQSVWSSVLAA 133
W + E TV++++ LAG+K+DAVIC KD K+AD+MW+QSV +S ++A
Sbjct: 53 WVEQEETVVSKVGESLAGEKLDAVICVAGGWAGGNAK-KDLAKNADLMWKQSVLTSAISA 111
Query: 134 TIAANHLKPGGLVSLPGAKPALEGTP 159
+AA HLK GGL++L GAKPALEGTP
Sbjct: 112 AVAAQHLKAGGLLALTGAKPALEGTP 137
|
|
| WB|WBGene00011398 qdpr-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7Z415 QDPR "Quinoid dihydropteridine reductase, isoform CRA_c" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D6RGG7 QDPR "Dihydropteridine reductase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0Y8F7 QDPR "Dihydropteridine reductase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P09417 QDPR "Dihydropteridine reductase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LKS6 QDPR "Dihydropteridine reductase" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|619915 Qdpr "quinoid dihydropteridine reductase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0Z7 QDPR "Dihydropteridine reductase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B3KW71 QDPR "Dihydropteridine reductase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 159 | |||
| cd05334 | 221 | cd05334, DHPR_SDR_c_like, dihydropteridine reducta | 1e-25 |
| >gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs | Back alignment and domain information |
|---|
Score = 97.0 bits (242), Expect = 1e-25
Identities = 43/97 (44%), Positives = 64/97 (65%), Gaps = 2/97 (2%)
Query: 63 SADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMW 122
A ++ +T+ V+A + + K+DA+ICVAGGWA G+A +K FVK+ D+MW
Sbjct: 40 DASIIVLDSDSFTEQAKQVVASVARL--SGKVDALICVAGGWAGGSAKSKSFVKNWDLMW 97
Query: 123 RQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP 159
+Q++W+S +A+ +A HL GGL+ L GAK ALE TP
Sbjct: 98 KQNLWTSFIASHLATKHLLSGGLLVLTGAKAALEPTP 134
|
Dihydropteridine reductase is an NAD-binding protein related to the SDRs. It converts dihydrobiopterin into tetrahydrobiopterin, a cofactor necessary in catecholamines synthesis. Dihydropteridine reductase has the YXXXK of these tyrosine-dependent oxidoreductases, but lacks the typical upstream Asn and Ser catalytic residues. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs. Length = 221 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| KOG4022|consensus | 236 | 100.0 | ||
| KOG4022|consensus | 236 | 99.83 | ||
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 98.36 | |
| PRK12747 | 252 | short chain dehydrogenase; Provisional | 98.21 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 98.16 | |
| PRK06997 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.92 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.9 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 97.87 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 97.85 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 97.85 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.84 | |
| PRK08415 | 274 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.84 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 97.8 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.78 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 97.78 | |
| PRK07370 | 258 | enoyl-(acyl carrier protein) reductase; Validated | 97.77 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 97.77 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 97.77 | |
| PRK08159 | 272 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.77 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 97.75 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 97.74 | |
| PF13561 | 241 | adh_short_C2: Enoyl-(Acyl carrier protein) reducta | 97.73 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 97.73 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.72 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 97.69 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.68 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 97.67 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 97.66 | |
| PLN02730 | 303 | enoyl-[acyl-carrier-protein] reductase | 97.65 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 97.63 | |
| PRK06947 | 248 | glucose-1-dehydrogenase; Provisional | 97.63 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 97.63 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 97.63 | |
| PRK07578 | 199 | short chain dehydrogenase; Provisional | 97.62 | |
| PRK12859 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 97.59 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 97.58 | |
| PRK06300 | 299 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.54 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 97.54 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 97.53 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 97.53 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 97.52 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 97.52 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 97.51 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 97.51 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 97.51 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 97.5 | |
| PRK08690 | 261 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.49 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 97.49 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 97.48 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 97.47 | |
| PRK12824 | 245 | acetoacetyl-CoA reductase; Provisional | 97.45 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 97.45 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.44 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 97.44 | |
| PRK05717 | 255 | oxidoreductase; Validated | 97.44 | |
| PRK09730 | 247 | putative NAD(P)-binding oxidoreductase; Provisiona | 97.44 | |
| COG4221 | 246 | Short-chain alcohol dehydrogenase of unknown speci | 97.43 | |
| PRK06550 | 235 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 97.42 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 97.41 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 97.41 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 97.41 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 97.4 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 97.4 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 97.4 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 97.4 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 97.39 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 97.39 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 97.39 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 97.38 | |
| PRK07041 | 230 | short chain dehydrogenase; Provisional | 97.37 | |
| PRK06123 | 248 | short chain dehydrogenase; Provisional | 97.37 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 97.37 | |
| PRK07023 | 243 | short chain dehydrogenase; Provisional | 97.37 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.36 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 97.36 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 97.36 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 97.36 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 97.35 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 97.35 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 97.35 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 97.34 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 97.33 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 97.33 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 97.33 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 97.32 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisiona | 97.32 | |
| PRK08643 | 256 | acetoin reductase; Validated | 97.31 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 97.3 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 97.29 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 97.27 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 97.27 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 97.27 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 97.26 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 97.26 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 97.25 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 97.25 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 97.24 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 97.23 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 97.23 | |
| TIGR01830 | 239 | 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re | 97.22 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 97.21 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 97.21 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 97.2 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 97.18 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 97.18 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 97.17 | |
| PRK07069 | 251 | short chain dehydrogenase; Validated | 97.17 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 97.17 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 97.17 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 97.15 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 97.15 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 97.13 | |
| PRK12748 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 97.13 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 97.12 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 97.12 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 97.12 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 97.11 | |
| TIGR02685 | 267 | pter_reduc_Leis pteridine reductase. Pteridine red | 97.1 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 97.1 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 97.09 | |
| KOG0725|consensus | 270 | 97.09 | ||
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 97.09 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 97.08 | |
| TIGR01831 | 239 | fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas | 97.08 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 97.07 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 97.06 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 97.05 | |
| TIGR02415 | 254 | 23BDH acetoin reductases. One member of this famil | 97.05 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 97.04 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 97.04 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 97.04 | |
| PLN00015 | 308 | protochlorophyllide reductase | 97.02 | |
| PRK12428 | 241 | 3-alpha-hydroxysteroid dehydrogenase; Provisional | 97.02 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 97.01 | |
| TIGR01500 | 256 | sepiapter_red sepiapterin reductase. This model de | 97.01 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 96.99 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 96.99 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 96.98 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 96.98 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 96.97 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 96.94 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 96.92 | |
| TIGR01829 | 242 | AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy | 96.91 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 96.9 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 96.9 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 96.89 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 96.89 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 96.89 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 96.88 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 96.88 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 96.87 | |
| PRK08219 | 227 | short chain dehydrogenase; Provisional | 96.85 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 96.81 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 96.8 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 96.79 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 96.78 | |
| KOG1205|consensus | 282 | 96.76 | ||
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.75 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.74 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 96.73 | |
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 96.72 | |
| TIGR01289 | 314 | LPOR light-dependent protochlorophyllide reductase | 96.72 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 96.72 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.69 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 96.67 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.58 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 96.57 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 96.56 | |
| KOG1210|consensus | 331 | 96.56 | ||
| COG1028 | 251 | FabG Dehydrogenases with different specificities ( | 96.54 | |
| PRK07775 | 274 | short chain dehydrogenase; Provisional | 96.52 | |
| PRK05599 | 246 | hypothetical protein; Provisional | 96.43 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.42 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 96.4 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 96.37 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.36 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 96.34 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 96.33 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 96.31 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 96.3 | |
| PRK12745 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 96.27 | |
| PRK06924 | 251 | short chain dehydrogenase; Provisional | 96.22 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 96.2 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 96.1 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 96.08 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.01 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 96.0 | |
| PRK09009 | 235 | C factor cell-cell signaling protein; Provisional | 95.98 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 95.88 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 95.85 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 95.85 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 95.83 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 95.83 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 95.61 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 95.61 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 95.6 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 94.82 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 94.51 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 94.47 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 94.44 | |
| smart00822 | 180 | PKS_KR This enzymatic domain is part of bacterial | 93.94 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 92.86 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 92.72 | |
| KOG1204|consensus | 253 | 92.18 | ||
| KOG1201|consensus | 300 | 91.52 | ||
| KOG4169|consensus | 261 | 90.06 | ||
| KOG1610|consensus | 322 | 90.0 | ||
| KOG1209|consensus | 289 | 89.83 | ||
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 88.21 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 86.95 | |
| COG0623 | 259 | FabI Enoyl-[acyl-carrier-protein] | 86.29 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 85.53 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 84.9 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 83.01 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 82.65 | |
| KOG1014|consensus | 312 | 81.94 | ||
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 81.0 |
| >KOG4022|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.2e-36 Score=248.51 Aligned_cols=98 Identities=53% Similarity=0.924 Sum_probs=95.1
Q ss_pred hhcCccccccccHHHHHHHHHHHHHHHhcCCccceeeeecccccCCCccchhhHHhHHHHHHhhhhHHHHHHHHHhhccC
Q psy17303 62 KSADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLK 141 (159)
Q Consensus 62 KnADiMlKp~ssWTQq~~~v~~~v~~~l~~~kvDaIicvAGGwagG~a~~~~~~~~~d~M~k~nv~ss~~~a~la~~~L~ 141 (159)
++++++++.+.+|+||+++|+++|.+.|+++|+|+|+||||||||||++++|++||+|+|||||+|||.|++++|++|||
T Consensus 41 Ad~sI~V~~~~swtEQe~~v~~~vg~sL~gekvDav~CVAGGWAGGnAksKdl~KNaDLMwKQSvwtSaIsa~lAt~HLK 120 (236)
T KOG4022|consen 41 ADSSILVDGNKSWTEQEQSVLEQVGSSLQGEKVDAVFCVAGGWAGGNAKSKDLVKNADLMWKQSVWTSAISAKLATTHLK 120 (236)
T ss_pred ccceEEecCCcchhHHHHHHHHHHHHhhcccccceEEEeeccccCCCcchhhhhhchhhHHHHHHHHHHHHHHHHHhccC
Confidence 45678888889999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCceEEeecCCCCCCCCC
Q psy17303 142 PGGLVSLPGAKPALEGTP 159 (159)
Q Consensus 142 ~gGllvltGA~aAL~~tp 159 (159)
|||||.||||+|||.|||
T Consensus 121 ~GGLL~LtGAkaAl~gTP 138 (236)
T KOG4022|consen 121 PGGLLQLTGAKAALGGTP 138 (236)
T ss_pred CCceeeecccccccCCCC
Confidence 999999999999999998
|
|
| >KOG4022|consensus | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >PRK12747 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06997 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08415 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08159 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02730 enoyl-[acyl-carrier-protein] reductase | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06947 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07578 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06300 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06953 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08690 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07832 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12824 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK09730 putative NAD(P)-binding oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07041 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06123 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07023 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08063 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05650 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PRK07889 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07069 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02685 pter_reduc_Leis pteridine reductase | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0725|consensus | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02415 23BDH acetoin reductases | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00015 protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12938 acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01500 sepiapter_red sepiapterin reductase | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK08219 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1205|consensus | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01289 LPOR light-dependent protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1210|consensus | Back alignment and domain information |
|---|
| >COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK07775 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05599 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06924 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09009 C factor cell-cell signaling protein; Provisional | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06720 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1204|consensus | Back alignment and domain information |
|---|
| >KOG1201|consensus | Back alignment and domain information |
|---|
| >KOG4169|consensus | Back alignment and domain information |
|---|
| >KOG1610|consensus | Back alignment and domain information |
|---|
| >KOG1209|consensus | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >COG0623 FabI Enoyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >KOG1014|consensus | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 159 | ||||
| 1ooe_A | 236 | Structural Genomics Of Caenorhabditis Elegans : Dih | 1e-16 | ||
| 1hdr_A | 244 | The Crystallographic Structure Of A Human Dihydropt | 2e-14 | ||
| 1dir_A | 241 | Crystal Structure Of A Monoclinic Form Of Dihydropt | 2e-14 |
| >pdb|1OOE|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Dihydropteridine Reductase Length = 236 | Back alignment and structure |
|
| >pdb|1HDR|A Chain A, The Crystallographic Structure Of A Human Dihydropteridine Reductase Nadh Binary Complex Expressed In Escherichia Coli By A Cdna Constructed From Its Rat Homologue Length = 244 | Back alignment and structure |
| >pdb|1DIR|A Chain A, Crystal Structure Of A Monoclinic Form Of Dihydropteridine Reductase From Rat Liver Length = 241 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 159 | |||
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 1e-12 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 1e-10 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 1e-10 |
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 | Back alignment and structure |
|---|
Score = 61.9 bits (151), Expect = 1e-12
Identities = 47/86 (54%), Positives = 64/86 (74%)
Query: 74 WTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAA 133
WT+ E ++L + + L G ++D V CVAGGWA G+A++KDFVK+AD+M +QSVWSS +AA
Sbjct: 53 WTEQEQSILEQTASSLQGSQVDGVFCVAGGWAGGSASSKDFVKNADLMIKQSVWSSAIAA 112
Query: 134 TIAANHLKPGGLVSLPGAKPALEGTP 159
+A HLKPGGL+ L GA A+ TP
Sbjct: 113 KLATTHLKPGGLLQLTGAAAAMGPTP 138
|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 98.33 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 98.27 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 98.22 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 98.21 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 98.2 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 98.19 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 98.17 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 98.16 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 98.13 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 98.12 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 98.09 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 98.04 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 98.03 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 98.02 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 98.02 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 98.02 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 98.02 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 98.0 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 97.99 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 97.98 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 97.97 | |
| 3lt0_A | 329 | Enoyl-ACP reductase; triclosan, triclosan variant, | 97.97 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 97.97 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 97.95 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 97.94 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 97.94 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 97.92 | |
| 1d7o_A | 297 | Enoyl-[acyl-carrier protein] reductase (NADH) PRE; | 97.92 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 97.91 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 97.9 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 97.89 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 97.88 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 97.87 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 97.87 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 97.86 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 97.86 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 97.86 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 97.86 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 97.86 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 97.86 | |
| 2ptg_A | 319 | Enoyl-acyl carrier reductase; apicomplexa, enoyl ( | 97.85 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 97.84 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 97.84 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 97.83 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 97.83 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 97.83 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 97.82 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 97.82 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 97.82 | |
| 2o2s_A | 315 | Enoyl-acyl carrier reductase; enoyl reductase, tri | 97.81 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 97.81 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 97.8 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 97.78 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 97.78 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 97.77 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 97.76 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 97.76 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 97.76 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 97.75 | |
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 97.75 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 97.75 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 97.75 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 97.74 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 97.73 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 97.72 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 97.72 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 97.71 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 97.71 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 97.7 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 97.69 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 97.69 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 97.69 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 97.68 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 97.68 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 97.68 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 97.67 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 97.67 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 97.67 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 97.67 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 97.67 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 97.66 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 97.66 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 97.66 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 97.65 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 97.65 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 97.65 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 97.64 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 97.64 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 97.64 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 97.64 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 97.64 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 97.64 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 97.64 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 97.64 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 97.63 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 97.63 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 97.63 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 97.63 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 97.63 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 97.62 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 97.62 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 97.62 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 97.61 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 97.61 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 97.6 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 97.6 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 97.6 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 97.59 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 97.59 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 97.58 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 97.58 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 97.58 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 97.57 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 97.57 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 97.57 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 97.57 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 97.56 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 97.56 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 97.56 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 97.56 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 97.56 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 97.55 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 97.55 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 97.55 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 97.54 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 97.54 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 97.54 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 97.54 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 97.54 | |
| 1zmo_A | 244 | Halohydrin dehalogenase; haloalcohol dehalogenase, | 97.53 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 97.53 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 97.53 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 97.5 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 97.5 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 97.49 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 97.48 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 97.47 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 97.47 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 97.47 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 97.47 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 97.47 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 97.46 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 97.46 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 97.45 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 97.45 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 97.44 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 97.44 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 97.44 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 97.44 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 97.44 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 97.44 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 97.43 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 97.41 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 97.41 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 97.4 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 97.4 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 97.39 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 97.38 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 97.38 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 97.38 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 97.38 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 97.37 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 97.35 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 97.34 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 97.34 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 97.33 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 97.32 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 97.31 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 97.31 | |
| 1jtv_A | 327 | 17 beta-hydroxysteroid dehydrogenase type 1; stero | 97.29 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 97.28 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 97.27 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 97.26 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 97.26 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 97.25 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 97.24 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 97.24 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 97.24 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 97.23 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 97.22 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 97.22 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 97.21 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 97.21 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 97.21 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 97.2 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 97.2 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 97.18 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 97.17 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 97.17 | |
| 1edo_A | 244 | Beta-keto acyl carrier protein reductase; nucleoti | 97.16 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 97.15 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 97.14 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 97.12 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 97.09 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 97.08 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 97.08 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 97.08 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 97.0 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 96.99 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 96.98 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 96.91 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 96.9 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 96.88 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 96.88 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 96.87 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 96.8 | |
| 1gz6_A | 319 | Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF | 96.8 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 96.79 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 96.5 | |
| 3qp9_A | 525 | Type I polyketide synthase pikaii; rossmann fold, | 96.39 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 96.39 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 95.96 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 95.44 | |
| 3mje_A | 496 | AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. | 94.5 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 94.26 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 94.13 | |
| 2ggs_A | 273 | 273AA long hypothetical DTDP-4-dehydrorhamnose red | 93.72 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 93.72 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 93.49 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 93.42 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 93.4 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 93.35 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 93.32 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 93.25 | |
| 2z5l_A | 511 | Tylkr1, tylactone synthase starter module and modu | 93.09 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 92.98 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 92.93 | |
| 1db3_A | 372 | GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya | 92.77 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 92.49 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 92.06 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 91.78 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 91.57 | |
| 3zu3_A | 405 | Putative reductase YPO4104/Y4119/YP_4011; oxidored | 91.37 | |
| 2fr1_A | 486 | Erythromycin synthase, eryai; short chain dehydrog | 91.37 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 91.27 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 90.47 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 90.05 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 89.77 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 89.21 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 88.77 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 88.57 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 88.28 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 88.2 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 87.98 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 87.96 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 87.89 | |
| 4b8w_A | 319 | GDP-L-fucose synthase; oxidoreductase; HET: NAP GD | 87.5 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 87.14 | |
| 3s8m_A | 422 | Enoyl-ACP reductase; rossmann fold, oxidoreductase | 87.13 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 86.88 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 86.74 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 86.66 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 86.6 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 86.41 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 86.25 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 85.97 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 85.95 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 84.82 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 84.67 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 84.16 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 84.15 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 83.31 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 83.17 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 82.78 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 82.52 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 82.41 | |
| 4eue_A | 418 | Putative reductase CA_C0462; TER, biofuel, synthet | 82.17 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 82.17 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 81.75 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 81.52 |
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
Probab=98.33 E-value=9.8e-07 Score=73.49 Aligned_cols=82 Identities=21% Similarity=0.248 Sum_probs=67.7
Q ss_pred HHHHHHHHHHHHHHHhcCCccceeeeecccccCCCccchhhHHhHHHHHHhhhhHHHHHHHHHhhccCCCceEEeecCCC
Q psy17303 74 WTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKP 153 (159)
Q Consensus 74 WTQq~~~v~~~v~~~l~~~kvDaIicvAGGwagG~a~~~~~~~~~d~M~k~nv~ss~~~a~la~~~L~~gGllvltGA~a 153 (159)
..+.++.+.+ +.+.++ ++|.+||-||+...++ ..+...++++++++.|+.+.|..++.+.|+|+++|.++++++.+
T Consensus 87 ~~~v~~~~~~-~~~~~G--~iDiLVNNAG~~~~~~-~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~G~IInisS~~ 162 (273)
T 4fgs_A 87 LAELDRLYEK-VKAEAG--RIDVLFVNAGGGSMLP-LGEVTEEQYDDTFDRNVKGVLFTVQKALPLLARGSSVVLTGSTA 162 (273)
T ss_dssp HHHHHHHHHH-HHHHHS--CEEEEEECCCCCCCCC-TTSCCHHHHHHHHHHHTHHHHHHHHHHTTTEEEEEEEEEECCGG
T ss_pred HHHHHHHHHH-HHHHcC--CCCEEEECCCCCCCCC-hhhccHHHHHHHHHHHhHHHHHHHHHHHHHHhhCCeEEEEeehh
Confidence 3444444444 455343 6999999999987776 57888999999999999999999999999999999999999998
Q ss_pred CCCCCC
Q psy17303 154 ALEGTP 159 (159)
Q Consensus 154 AL~~tp 159 (159)
+..|.|
T Consensus 163 ~~~~~~ 168 (273)
T 4fgs_A 163 GSTGTP 168 (273)
T ss_dssp GGSCCT
T ss_pred hccCCC
Confidence 887765
|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* | Back alignment and structure |
|---|
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A | Back alignment and structure |
|---|
| >3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* | Back alignment and structure |
|---|
| >2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 159 | |||
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 99.41 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 99.37 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 98.33 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 98.14 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 98.14 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 98.13 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 98.11 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 98.09 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 98.08 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 98.07 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 98.07 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 98.06 | |
| d1zmta1 | 252 | Halohydrin dehalogenase HheC {Agrobacterium tumefa | 98.04 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 98.02 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 98.0 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 97.99 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 97.97 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 97.95 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 97.94 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 97.94 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 97.93 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 97.92 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 97.91 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 97.89 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 97.88 | |
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 97.88 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 97.85 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 97.84 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 97.84 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 97.8 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 97.79 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 97.77 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 97.73 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 97.72 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 97.7 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 97.7 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 97.7 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 97.66 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 97.65 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 97.61 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 97.6 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 97.59 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 97.58 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 97.57 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 97.56 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 97.54 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 97.49 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 97.47 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 97.44 | |
| d1uh5a_ | 329 | Enoyl-ACP reductase {Malaria parasite (Plasmodium | 97.42 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 97.37 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 97.29 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 97.09 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 97.08 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 97.07 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 96.63 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 95.97 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 95.45 | |
| d1e7wa_ | 284 | Dihydropteridin reductase (pteridine reductase) {L | 95.35 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 95.15 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 94.76 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 94.68 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 91.05 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 90.66 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 87.7 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 87.65 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 83.11 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 80.42 |
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: Dihydropteridin reductase (pteridine reductase) species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.41 E-value=6.8e-13 Score=104.03 Aligned_cols=96 Identities=46% Similarity=0.837 Sum_probs=85.6
Q ss_pred cCccccccccHHHHHHHHHHHHHHHhcCCccceeeeecccccCCCccchhhHHhHHHHHHhhhhHHHHHHHHHhhccCCC
Q psy17303 64 ADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPG 143 (159)
Q Consensus 64 ADiMlKp~ssWTQq~~~v~~~v~~~l~~~kvDaIicvAGGwagG~a~~~~~~~~~d~M~k~nv~ss~~~a~la~~~L~~g 143 (159)
.+...+.+..-.++.+++...+.+.++..++|.+||.||+|..++..+++..+++|++++.|+++.++.++.+.++|+++
T Consensus 42 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iD~lInnAG~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~m~~~ 121 (236)
T d1dhra_ 42 ASVIVKMTDSFTEQADQVTAEVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEG 121 (236)
T ss_dssp EEEECCCCSCHHHHHHHHHHHHHHHHTTCCEEEEEECCCCCCCBCTTCTTHHHHHHHHHHHHHHHHHHHHHHHHHHEEEE
T ss_pred ccceeecccCcHHHHHHHHHHHHHHhCCCCceEEEECCcccccccchhcCCHHHHHHHHHHcchHHHHHHHHHHHhcccc
Confidence 33444444667778888888888888888999999999999999999999999999999999999999999999999999
Q ss_pred ceEEeecCCCCCCCCC
Q psy17303 144 GLVSLPGAKPALEGTP 159 (159)
Q Consensus 144 GllvltGA~aAL~~tp 159 (159)
|.++++++.+++.|.|
T Consensus 122 G~Iv~isS~~~~~~~~ 137 (236)
T d1dhra_ 122 GLLTLAGAKAALDGTP 137 (236)
T ss_dssp EEEEEECCGGGGSCCT
T ss_pred cceeEEccHHHcCCcc
Confidence 9999999999998875
|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|