Psyllid ID: psy17303


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MYCMSLYSLYFVLYVLIFFQCSSETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP
ccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccEEEEEEEEccEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccc
ccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccEEEEEEcccccccEccccccHHHHHHcEEcccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEccHHHHcccc
MYCMSLYSLYFVLYVLIFFQCSSETTVLAELKTILAGDKIDAVICVaggwaggnaAAKDFVKSADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAAnhlkpgglvslpgakpalegtp
MYCMSLYSLYFVLYVLIFFQCSSETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAANhlkpgglvslpgakpalegtp
MYCMslyslyfvlyvliffQCSSETTVLAELKTILAGDKIDAVICVaggwaggnaaaKDFVKSADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICvaggwavgnaaaKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP
*YCMSLYSLYFVLYVLIFFQCSSETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLV*************
*YCMSLYSLYFVLYVLIFFQCSSETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADNTLIPLL***************ILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPAL****
MYCMSLYSLYFVLYVLIFFQCSSETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP
MYCMSLYSLYFVLYVLIFFQCSSETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPAL****
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYCMSLYSLYFVLYVLIFFQCSSETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query159 2.2.26 [Sep-21-2011]
P09417244 Dihydropteridine reductas yes N/A 0.540 0.352 0.5 3e-20
Q3T0Z7242 Dihydropteridine reductas yes N/A 0.540 0.355 0.5 4e-20
P11348241 Dihydropteridine reductas yes N/A 0.540 0.356 0.5 4e-20
Q8MJ30243 Dihydropteridine reductas yes N/A 0.540 0.353 0.5 4e-20
Q8BVI4241 Dihydropteridine reductas yes N/A 0.540 0.356 0.488 2e-19
Q86A17231 Dihydropteridine reductas yes N/A 0.415 0.285 0.424 3e-07
>sp|P09417|DHPR_HUMAN Dihydropteridine reductase OS=Homo sapiens GN=QDPR PE=1 SV=2 Back     alignment and function desciption
 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 64/86 (74%)

Query: 74  WTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAA 133
           +T+    V AE+  +L  +K+DA++CVAGGWA GNA +K   K+ D+MW+QS+W+S +++
Sbjct: 60  FTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISS 119

Query: 134 TIAANHLKPGGLVSLPGAKPALEGTP 159
            +A  HLK GGL++L GAK AL+GTP
Sbjct: 120 HLATKHLKEGGLLTLAGAKAALDGTP 145




The product of this enzyme, tetrahydrobiopterin (BH-4), is an essential cofactor for phenylalanine, tyrosine, and tryptophan hydroxylases.
Homo sapiens (taxid: 9606)
EC: 1EC: .EC: 5EC: .EC: 1EC: .EC: 3EC: 4
>sp|Q3T0Z7|DHPR_BOVIN Dihydropteridine reductase OS=Bos taurus GN=QDPR PE=2 SV=1 Back     alignment and function description
>sp|P11348|DHPR_RAT Dihydropteridine reductase OS=Rattus norvegicus GN=Qdpr PE=1 SV=1 Back     alignment and function description
>sp|Q8MJ30|DHPR_PIG Dihydropteridine reductase OS=Sus scrofa GN=QDPR PE=2 SV=1 Back     alignment and function description
>sp|Q8BVI4|DHPR_MOUSE Dihydropteridine reductase OS=Mus musculus GN=Qdpr PE=1 SV=2 Back     alignment and function description
>sp|Q86A17|DHPR_DICDI Dihydropteridine reductase OS=Dictyostelium discoideum GN=qdpr PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
383866338237 PREDICTED: dihydropteridine reductase-li 0.616 0.413 0.56 5e-24
195135535235 GI16833 [Drosophila mojavensis] gi|19391 0.534 0.361 0.639 2e-23
157114407235 dihydropteridine reductase [Aedes aegypt 0.534 0.361 0.616 2e-23
157114409232 dihydropteridine reductase [Aedes aegypt 0.534 0.366 0.616 2e-23
312375153234 hypothetical protein AND_14502 [Anophele 0.534 0.363 0.616 3e-23
125980289235 GA18340 [Drosophila pseudoobscura pseudo 0.534 0.361 0.616 4e-23
195326223235 GM25120 [Drosophila sechellia] gi|194118 0.534 0.361 0.616 6e-23
195490952235 GE20807 [Drosophila yakuba] gi|194179458 0.534 0.361 0.616 8e-23
195375020235 GJ12582 [Drosophila virilis] gi|19415345 0.534 0.361 0.639 9e-23
195588955158 GD14155 [Drosophila simulans] gi|1941962 0.534 0.537 0.616 1e-22
>gi|383866338|ref|XP_003708627.1| PREDICTED: dihydropteridine reductase-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 74/100 (74%), Gaps = 2/100 (2%)

Query: 62  KSADNTLI--PLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSAD 119
           + AD  +I  P   W Q    +L E+  IL G+K+DA+ICVAGGWA GNA+ KDF+K++D
Sbjct: 41  EQADANVIVKPENDWQQQGVDILQEVTNILKGNKVDAIICVAGGWAGGNASHKDFIKNSD 100

Query: 120 IMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP 159
           +MW+QSVWSS++A+ IAA+HLK GG +SL GAK AL  TP
Sbjct: 101 LMWKQSVWSSIIASNIAAHHLKEGGFLSLTGAKAALAETP 140




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195135535|ref|XP_002012188.1| GI16833 [Drosophila mojavensis] gi|193918452|gb|EDW17319.1| GI16833 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|157114407|ref|XP_001652256.1| dihydropteridine reductase [Aedes aegypti] gi|94469144|gb|ABF18421.1| dihydropteridine reductase [Aedes aegypti] gi|108877300|gb|EAT41525.1| AAEL006836-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157114409|ref|XP_001652257.1| dihydropteridine reductase [Aedes aegypti] gi|108877301|gb|EAT41526.1| AAEL006836-PB [Aedes aegypti] Back     alignment and taxonomy information
>gi|312375153|gb|EFR22576.1| hypothetical protein AND_14502 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|125980289|ref|XP_001354169.1| GA18340 [Drosophila pseudoobscura pseudoobscura] gi|195174538|ref|XP_002028030.1| GL15041 [Drosophila persimilis] gi|54642473|gb|EAL31221.1| GA18340 [Drosophila pseudoobscura pseudoobscura] gi|194115752|gb|EDW37795.1| GL15041 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195326223|ref|XP_002029829.1| GM25120 [Drosophila sechellia] gi|194118772|gb|EDW40815.1| GM25120 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195490952|ref|XP_002093357.1| GE20807 [Drosophila yakuba] gi|194179458|gb|EDW93069.1| GE20807 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195375020|ref|XP_002046301.1| GJ12582 [Drosophila virilis] gi|194153459|gb|EDW68643.1| GJ12582 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195588955|ref|XP_002084222.1| GD14155 [Drosophila simulans] gi|194196231|gb|EDX09807.1| GD14155 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
FB|FBgn0035964235 Dhpr "Dihydropteridine reducta 0.534 0.361 0.511 1.1e-18
WB|WBGene00011398236 qdpr-1 [Caenorhabditis elegans 0.540 0.364 0.453 1.1e-16
UNIPROTKB|B7Z415152 QDPR "Quinoid dihydropteridine 0.540 0.565 0.395 3.3e-15
UNIPROTKB|D6RGG7162 QDPR "Dihydropteridine reducta 0.540 0.530 0.395 3.3e-15
UNIPROTKB|H0Y8F7128 QDPR "Dihydropteridine reducta 0.540 0.671 0.395 3.3e-15
UNIPROTKB|P09417244 QDPR "Dihydropteridine reducta 0.540 0.352 0.395 3.3e-15
UNIPROTKB|I3LKS6243 QDPR "Dihydropteridine reducta 0.540 0.353 0.395 3.3e-15
RGD|619915241 Qdpr "quinoid dihydropteridine 0.540 0.356 0.395 4.2e-15
UNIPROTKB|Q3T0Z7242 QDPR "Dihydropteridine reducta 0.540 0.355 0.395 5.4e-15
UNIPROTKB|B3KW71213 QDPR "Dihydropteridine reducta 0.496 0.370 0.417 5.4e-15
FB|FBgn0035964 Dhpr "Dihydropteridine reductase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 225 (84.3 bits), Expect = 1.1e-18, P = 1.1e-18
 Identities = 44/86 (51%), Positives = 60/86 (69%)

Query:    74 WTQIETTVLAELKTILAGDKIDAVICXXXXXXXXXXXXKDFVKSADIMWRQSVWSSVLAA 133
             W + E TV++++   LAG+K+DAVIC            KD  K+AD+MW+QSV +S ++A
Sbjct:    53 WVEQEETVVSKVGESLAGEKLDAVICVAGGWAGGNAK-KDLAKNADLMWKQSVLTSAISA 111

Query:   134 TIAANHLKPGGLVSLPGAKPALEGTP 159
              +AA HLK GGL++L GAKPALEGTP
Sbjct:   112 AVAAQHLKAGGLLALTGAKPALEGTP 137




GO:0004155 "6,7-dihydropteridine reductase activity" evidence=ISS;NAS
GO:0008152 "metabolic process" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
WB|WBGene00011398 qdpr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z415 QDPR "Quinoid dihydropteridine reductase, isoform CRA_c" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|D6RGG7 QDPR "Dihydropteridine reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y8F7 QDPR "Dihydropteridine reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P09417 QDPR "Dihydropteridine reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LKS6 QDPR "Dihydropteridine reductase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|619915 Qdpr "quinoid dihydropteridine reductase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0Z7 QDPR "Dihydropteridine reductase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B3KW71 QDPR "Dihydropteridine reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
cd05334221 cd05334, DHPR_SDR_c_like, dihydropteridine reducta 1e-25
>gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs Back     alignment and domain information
 Score = 97.0 bits (242), Expect = 1e-25
 Identities = 43/97 (44%), Positives = 64/97 (65%), Gaps = 2/97 (2%)

Query: 63  SADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMW 122
            A   ++    +T+    V+A +  +    K+DA+ICVAGGWA G+A +K FVK+ D+MW
Sbjct: 40  DASIIVLDSDSFTEQAKQVVASVARL--SGKVDALICVAGGWAGGSAKSKSFVKNWDLMW 97

Query: 123 RQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTP 159
           +Q++W+S +A+ +A  HL  GGL+ L GAK ALE TP
Sbjct: 98  KQNLWTSFIASHLATKHLLSGGLLVLTGAKAALEPTP 134


Dihydropteridine reductase is an NAD-binding protein related to the SDRs. It converts dihydrobiopterin into tetrahydrobiopterin, a cofactor necessary in catecholamines synthesis. Dihydropteridine reductase has the YXXXK of these tyrosine-dependent oxidoreductases, but lacks the typical upstream Asn and Ser catalytic residues. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs. Length = 221

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 159
KOG4022|consensus236 100.0
KOG4022|consensus236 99.83
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 98.36
PRK12747252 short chain dehydrogenase; Provisional 98.21
PRK06128300 oxidoreductase; Provisional 98.16
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 97.92
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 97.9
PRK12937245 short chain dehydrogenase; Provisional 97.87
PRK06077 252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.85
PRK07985294 oxidoreductase; Provisional 97.85
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 97.84
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 97.84
PRK06701290 short chain dehydrogenase; Provisional 97.8
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 97.78
PRK08339 263 short chain dehydrogenase; Provisional 97.78
PRK07370 258 enoyl-(acyl carrier protein) reductase; Validated 97.77
PRK08589 272 short chain dehydrogenase; Validated 97.77
PRK12746254 short chain dehydrogenase; Provisional 97.77
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 97.77
PRK07576 264 short chain dehydrogenase; Provisional 97.75
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 97.74
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 97.73
PRK12742237 oxidoreductase; Provisional 97.73
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 97.72
PRK06484 520 short chain dehydrogenase; Validated 97.69
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 97.68
PRK05872 296 short chain dehydrogenase; Provisional 97.67
PRK06172 253 short chain dehydrogenase; Provisional 97.66
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 97.65
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.63
PRK06947248 glucose-1-dehydrogenase; Provisional 97.63
PRK06398 258 aldose dehydrogenase; Validated 97.63
PRK05884223 short chain dehydrogenase; Provisional 97.63
PRK07578199 short chain dehydrogenase; Provisional 97.62
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.59
PRK12743 256 oxidoreductase; Provisional 97.58
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 97.54
PRK07890 258 short chain dehydrogenase; Provisional 97.54
PRK06500 249 short chain dehydrogenase; Provisional 97.53
PRK07791 286 short chain dehydrogenase; Provisional 97.53
PRK06953222 short chain dehydrogenase; Provisional 97.52
PRK06179 270 short chain dehydrogenase; Provisional 97.52
PRK06483236 dihydromonapterin reductase; Provisional 97.51
PRK09242 257 tropinone reductase; Provisional 97.51
PRK07814 263 short chain dehydrogenase; Provisional 97.51
PRK12935247 acetoacetyl-CoA reductase; Provisional 97.5
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 97.49
PRK08703239 short chain dehydrogenase; Provisional 97.49
PRK07832 272 short chain dehydrogenase; Provisional 97.48
PRK08267 260 short chain dehydrogenase; Provisional 97.47
PRK12824245 acetoacetyl-CoA reductase; Provisional 97.45
PRK07062 265 short chain dehydrogenase; Provisional 97.45
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 97.44
PRK08278 273 short chain dehydrogenase; Provisional 97.44
PRK05717 255 oxidoreductase; Validated 97.44
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 97.44
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 97.43
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.42
PRK12939250 short chain dehydrogenase; Provisional 97.41
PRK06124 256 gluconate 5-dehydrogenase; Provisional 97.41
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 97.41
PRK08265 261 short chain dehydrogenase; Provisional 97.4
PRK07063 260 short chain dehydrogenase; Provisional 97.4
PRK10538 248 malonic semialdehyde reductase; Provisional 97.4
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 97.4
PRK05693 274 short chain dehydrogenase; Provisional 97.39
PRK07067 257 sorbitol dehydrogenase; Provisional 97.39
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 97.39
PRK06139 330 short chain dehydrogenase; Provisional 97.38
PRK07041230 short chain dehydrogenase; Provisional 97.37
PRK06123248 short chain dehydrogenase; Provisional 97.37
PRK12829 264 short chain dehydrogenase; Provisional 97.37
PRK07023243 short chain dehydrogenase; Provisional 97.37
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 97.36
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 97.36
PRK08263 275 short chain dehydrogenase; Provisional 97.36
PRK07825 273 short chain dehydrogenase; Provisional 97.36
PRK07478 254 short chain dehydrogenase; Provisional 97.35
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 97.35
PRK08936 261 glucose-1-dehydrogenase; Provisional 97.35
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.34
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.33
PRK05650 270 short chain dehydrogenase; Provisional 97.33
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 97.33
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 97.32
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 97.32
PRK08643 256 acetoin reductase; Validated 97.31
PRK07035252 short chain dehydrogenase; Provisional 97.3
PRK06841255 short chain dehydrogenase; Provisional 97.29
PRK07856 252 short chain dehydrogenase; Provisional 97.27
PRK08862227 short chain dehydrogenase; Provisional 97.27
PRK06198 260 short chain dehydrogenase; Provisional 97.27
PRK09134 258 short chain dehydrogenase; Provisional 97.26
PRK06484 520 short chain dehydrogenase; Validated 97.26
PRK06125 259 short chain dehydrogenase; Provisional 97.25
PRK05855 582 short chain dehydrogenase; Validated 97.25
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.24
PRK05875 276 short chain dehydrogenase; Provisional 97.23
PRK07774250 short chain dehydrogenase; Provisional 97.23
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 97.22
PRK07523 255 gluconate 5-dehydrogenase; Provisional 97.21
PRK12744 257 short chain dehydrogenase; Provisional 97.21
PRK06182 273 short chain dehydrogenase; Validated 97.2
PRK06194 287 hypothetical protein; Provisional 97.18
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.18
PRK05993 277 short chain dehydrogenase; Provisional 97.17
PRK07069 251 short chain dehydrogenase; Validated 97.17
PRK07831262 short chain dehydrogenase; Provisional 97.17
PRK05876 275 short chain dehydrogenase; Provisional 97.17
PRK07097 265 gluconate 5-dehydrogenase; Provisional 97.15
PRK07024 257 short chain dehydrogenase; Provisional 97.15
PRK06482 276 short chain dehydrogenase; Provisional 97.13
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.13
PRK06949258 short chain dehydrogenase; Provisional 97.12
PRK07677 252 short chain dehydrogenase; Provisional 97.12
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 97.12
COG0300 265 DltE Short-chain dehydrogenases of various substra 97.11
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 97.1
PRK08277 278 D-mannonate oxidoreductase; Provisional 97.1
PRK06523 260 short chain dehydrogenase; Provisional 97.09
KOG0725|consensus 270 97.09
PRK07060245 short chain dehydrogenase; Provisional 97.09
PRK05867253 short chain dehydrogenase; Provisional 97.08
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 97.08
PRK08340 259 glucose-1-dehydrogenase; Provisional 97.07
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.06
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.05
TIGR02415 254 23BDH acetoin reductases. One member of this famil 97.05
PRK07109 334 short chain dehydrogenase; Provisional 97.04
PLN02253 280 xanthoxin dehydrogenase 97.04
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 97.04
PLN00015 308 protochlorophyllide reductase 97.02
PRK12428 241 3-alpha-hydroxysteroid dehydrogenase; Provisional 97.02
PRK12938246 acetyacetyl-CoA reductase; Provisional 97.01
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 97.01
PRK08628 258 short chain dehydrogenase; Provisional 96.99
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 96.99
PRK07102243 short chain dehydrogenase; Provisional 96.98
PRK06114 254 short chain dehydrogenase; Provisional 96.98
PRK06057 255 short chain dehydrogenase; Provisional 96.97
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 96.94
PRK08085 254 gluconate 5-dehydrogenase; Provisional 96.92
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 96.91
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 96.9
PRK09072 263 short chain dehydrogenase; Provisional 96.9
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 96.89
PRK08213 259 gluconate 5-dehydrogenase; Provisional 96.89
PRK07454241 short chain dehydrogenase; Provisional 96.89
PRK06180 277 short chain dehydrogenase; Provisional 96.88
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 96.88
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 96.87
PRK08219227 short chain dehydrogenase; Provisional 96.85
PRK06181 263 short chain dehydrogenase; Provisional 96.81
PRK06914 280 short chain dehydrogenase; Provisional 96.8
PRK08264238 short chain dehydrogenase; Validated 96.79
PRK08177225 short chain dehydrogenase; Provisional 96.78
KOG1205|consensus 282 96.76
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.75
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.74
PRK07326237 short chain dehydrogenase; Provisional 96.73
PRK06101 240 short chain dehydrogenase; Provisional 96.72
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 96.72
PLN02780 320 ketoreductase/ oxidoreductase 96.72
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.69
PRK08303 305 short chain dehydrogenase; Provisional 96.67
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.58
PRK07453 322 protochlorophyllide oxidoreductase; Validated 96.57
PRK07577234 short chain dehydrogenase; Provisional 96.56
KOG1210|consensus 331 96.56
COG1028251 FabG Dehydrogenases with different specificities ( 96.54
PRK07775 274 short chain dehydrogenase; Provisional 96.52
PRK05599 246 hypothetical protein; Provisional 96.43
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.42
PRK08324 681 short chain dehydrogenase; Validated 96.4
PRK09186 256 flagellin modification protein A; Provisional 96.37
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.36
PRK07904253 short chain dehydrogenase; Provisional 96.34
PRK06138 252 short chain dehydrogenase; Provisional 96.33
PRK12827249 short chain dehydrogenase; Provisional 96.31
PRK08226 263 short chain dehydrogenase; Provisional 96.3
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.27
PRK06924 251 short chain dehydrogenase; Provisional 96.22
PRK05866 293 short chain dehydrogenase; Provisional 96.2
PRK07201 657 short chain dehydrogenase; Provisional 96.1
PRK06940 275 short chain dehydrogenase; Provisional 96.08
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.01
PRK05854 313 short chain dehydrogenase; Provisional 96.0
PRK09009235 C factor cell-cell signaling protein; Provisional 95.98
PRK08251248 short chain dehydrogenase; Provisional 95.88
PRK09135249 pteridine reductase; Provisional 95.85
PRK08017 256 oxidoreductase; Provisional 95.85
PRK12828239 short chain dehydrogenase; Provisional 95.83
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 95.83
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 95.61
PRK09291 257 short chain dehydrogenase; Provisional 95.61
PRK12367 245 short chain dehydrogenase; Provisional 95.6
PRK07074 257 short chain dehydrogenase; Provisional 94.82
PRK06720169 hypothetical protein; Provisional 94.51
PRK06197 306 short chain dehydrogenase; Provisional 94.47
PRK06196 315 oxidoreductase; Provisional 94.44
smart00822180 PKS_KR This enzymatic domain is part of bacterial 93.94
PRK07424406 bifunctional sterol desaturase/short chain dehydro 92.86
PRK07806 248 short chain dehydrogenase; Provisional 92.72
KOG1204|consensus253 92.18
KOG1201|consensus 300 91.52
KOG4169|consensus 261 90.06
KOG1610|consensus 322 90.0
KOG1209|consensus 289 89.83
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 88.21
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 86.95
COG0623 259 FabI Enoyl-[acyl-carrier-protein] 86.29
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 85.53
PRK08267260 short chain dehydrogenase; Provisional 84.9
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 83.01
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 82.65
KOG1014|consensus 312 81.94
PLN02653 340 GDP-mannose 4,6-dehydratase 81.0
>KOG4022|consensus Back     alignment and domain information
Probab=100.00  E-value=2.2e-36  Score=248.51  Aligned_cols=98  Identities=53%  Similarity=0.924  Sum_probs=95.1

Q ss_pred             hhcCccccccccHHHHHHHHHHHHHHHhcCCccceeeeecccccCCCccchhhHHhHHHHHHhhhhHHHHHHHHHhhccC
Q psy17303         62 KSADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLK  141 (159)
Q Consensus        62 KnADiMlKp~ssWTQq~~~v~~~v~~~l~~~kvDaIicvAGGwagG~a~~~~~~~~~d~M~k~nv~ss~~~a~la~~~L~  141 (159)
                      ++++++++.+.+|+||+++|+++|.+.|+++|+|+|+||||||||||++++|++||+|+|||||+|||.|++++|++|||
T Consensus        41 Ad~sI~V~~~~swtEQe~~v~~~vg~sL~gekvDav~CVAGGWAGGnAksKdl~KNaDLMwKQSvwtSaIsa~lAt~HLK  120 (236)
T KOG4022|consen   41 ADSSILVDGNKSWTEQEQSVLEQVGSSLQGEKVDAVFCVAGGWAGGNAKSKDLVKNADLMWKQSVWTSAISAKLATTHLK  120 (236)
T ss_pred             ccceEEecCCcchhHHHHHHHHHHHHhhcccccceEEEeeccccCCCcchhhhhhchhhHHHHHHHHHHHHHHHHHhccC
Confidence            45678888889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCceEEeecCCCCCCCCC
Q psy17303        142 PGGLVSLPGAKPALEGTP  159 (159)
Q Consensus       142 ~gGllvltGA~aAL~~tp  159 (159)
                      |||||.||||+|||.|||
T Consensus       121 ~GGLL~LtGAkaAl~gTP  138 (236)
T KOG4022|consen  121 PGGLLQLTGAKAALGGTP  138 (236)
T ss_pred             CCceeeecccccccCCCC
Confidence            999999999999999998



>KOG4022|consensus Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
1ooe_A236 Structural Genomics Of Caenorhabditis Elegans : Dih 1e-16
1hdr_A244 The Crystallographic Structure Of A Human Dihydropt 2e-14
1dir_A241 Crystal Structure Of A Monoclinic Form Of Dihydropt 2e-14
>pdb|1OOE|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Dihydropteridine Reductase Length = 236 Back     alignment and structure

Iteration: 1

Score = 82.0 bits (201), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 39/86 (45%), Positives = 53/86 (61%) Query: 74 WTQIETTVLAELKTILAGDKIDAVICXXXXXXXXXXXXKDFVKSADIMWRQSVWSSVLAA 133 WT+ E ++L + + L G ++D V C KDFVK+AD+M +QSVWSS +AA Sbjct: 53 WTEQEQSILEQTASSLQGSQVDGVFCVAGGWAGGSASSKDFVKNADLMIKQSVWSSAIAA 112 Query: 134 TIAANHLKPGGLVSLPGAKPALEGTP 159 +A HLKPGGL+ L GA A+ TP Sbjct: 113 KLATTHLKPGGLLQLTGAAAAMGPTP 138
>pdb|1HDR|A Chain A, The Crystallographic Structure Of A Human Dihydropteridine Reductase Nadh Binary Complex Expressed In Escherichia Coli By A Cdna Constructed From Its Rat Homologue Length = 244 Back     alignment and structure
>pdb|1DIR|A Chain A, Crystal Structure Of A Monoclinic Form Of Dihydropteridine Reductase From Rat Liver Length = 241 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
1ooe_A236 Dihydropteridine reductase; structural genomics, P 1e-12
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 1e-10
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 1e-10
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
 Score = 61.9 bits (151), Expect = 1e-12
 Identities = 47/86 (54%), Positives = 64/86 (74%)

Query: 74  WTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAA 133
           WT+ E ++L +  + L G ++D V CVAGGWA G+A++KDFVK+AD+M +QSVWSS +AA
Sbjct: 53  WTEQEQSILEQTASSLQGSQVDGVFCVAGGWAGGSASSKDFVKNADLMIKQSVWSSAIAA 112

Query: 134 TIAANHLKPGGLVSLPGAKPALEGTP 159
            +A  HLKPGGL+ L GA  A+  TP
Sbjct: 113 KLATTHLKPGGLLQLTGAAAAMGPTP 138


>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 98.33
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 98.27
1ooe_A236 Dihydropteridine reductase; structural genomics, P 98.22
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 98.21
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 98.2
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 98.19
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 98.17
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 98.16
4e4y_A 244 Short chain dehydrogenase family protein; structur 98.13
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 98.12
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.09
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 98.04
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 98.03
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.02
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 98.02
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 98.02
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 98.02
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 98.0
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.99
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 97.98
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 97.97
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 97.97
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 97.97
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 97.95
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.94
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 97.94
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 97.92
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 97.92
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 97.91
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 97.9
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 97.89
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 97.88
3gem_A260 Short chain dehydrogenase; structural genomics, AP 97.87
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.87
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 97.86
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 97.86
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 97.86
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 97.86
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 97.86
4dqx_A 277 Probable oxidoreductase protein; structural genomi 97.86
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 97.85
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 97.84
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 97.84
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.83
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 97.83
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 97.83
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 97.82
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 97.82
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 97.82
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 97.81
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 97.81
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 97.8
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 97.78
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 97.78
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 97.77
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 97.76
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 97.76
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 97.76
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 97.75
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 97.75
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 97.75
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 97.75
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 97.74
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 97.73
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 97.72
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 97.72
3imf_A 257 Short chain dehydrogenase; structural genomics, in 97.71
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 97.71
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 97.7
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 97.69
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 97.69
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 97.69
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 97.68
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 97.68
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 97.68
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 97.67
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 97.67
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 97.67
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.67
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 97.67
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 97.66
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 97.66
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 97.66
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 97.65
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 97.65
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 97.65
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 97.64
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 97.64
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 97.64
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 97.64
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 97.64
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 97.64
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 97.64
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 97.64
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 97.63
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 97.63
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 97.63
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 97.63
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 97.63
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 97.62
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 97.62
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 97.62
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 97.61
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 97.61
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 97.6
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 97.6
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 97.6
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 97.59
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 97.59
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 97.58
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 97.58
1spx_A 278 Short-chain reductase family member (5L265); paral 97.58
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 97.57
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 97.57
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 97.57
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 97.57
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 97.56
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 97.56
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 97.56
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 97.56
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 97.56
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 97.55
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 97.55
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 97.55
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 97.54
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 97.54
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 97.54
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 97.54
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 97.54
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 97.53
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 97.53
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 97.53
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 97.5
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 97.5
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 97.49
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 97.48
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 97.47
1xhl_A 297 Short-chain dehydrogenase/reductase family member 97.47
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 97.47
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 97.47
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 97.47
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 97.46
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 97.46
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 97.45
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 97.45
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 97.44
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 97.44
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 97.44
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 97.44
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 97.44
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 97.44
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 97.43
3cxt_A 291 Dehydrogenase with different specificities; rossma 97.41
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 97.41
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 97.4
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 97.4
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 97.39
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 97.38
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 97.38
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 97.38
1xkq_A 280 Short-chain reductase family member (5D234); parra 97.38
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 97.37
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 97.35
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 97.34
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 97.34
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.33
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 97.32
3rih_A 293 Short chain dehydrogenase or reductase; structural 97.31
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 97.31
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 97.29
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 97.28
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 97.27
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 97.26
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.26
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 97.25
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.24
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 97.24
1xq1_A 266 Putative tropinone reducatse; structural genomics, 97.24
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 97.23
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 97.22
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 97.22
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 97.21
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 97.21
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 97.21
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 97.2
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 97.2
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.18
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 97.17
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 97.17
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 97.16
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 97.15
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 97.14
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.12
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 97.09
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 97.08
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 97.08
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.08
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 97.0
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 96.99
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 96.98
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 96.91
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 96.9
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 96.88
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 96.88
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 96.87
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 96.8
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 96.8
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 96.79
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 96.5
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 96.39
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 96.39
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 95.96
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 95.44
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 94.5
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 94.26
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 94.13
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 93.72
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 93.72
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 93.49
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 93.42
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 93.4
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 93.35
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 93.32
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 93.25
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 93.09
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 92.98
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 92.93
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 92.77
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 92.49
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 92.06
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 91.78
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 91.57
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 91.37
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 91.37
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 91.27
1xq6_A 253 Unknown protein; structural genomics, protein stru 90.47
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 90.05
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 89.77
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 89.21
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 88.77
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 88.57
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 88.28
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 88.2
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 87.98
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 87.96
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 87.89
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 87.5
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 87.14
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 87.13
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 86.88
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 86.74
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 86.66
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 86.6
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 86.41
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 86.25
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 85.97
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 85.95
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 84.82
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 84.67
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 84.16
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 84.15
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 83.31
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 83.17
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 82.78
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 82.52
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 82.41
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 82.17
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 82.17
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 81.75
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 81.52
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
Probab=98.33  E-value=9.8e-07  Score=73.49  Aligned_cols=82  Identities=21%  Similarity=0.248  Sum_probs=67.7

Q ss_pred             HHHHHHHHHHHHHHHhcCCccceeeeecccccCCCccchhhHHhHHHHHHhhhhHHHHHHHHHhhccCCCceEEeecCCC
Q psy17303         74 WTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKP  153 (159)
Q Consensus        74 WTQq~~~v~~~v~~~l~~~kvDaIicvAGGwagG~a~~~~~~~~~d~M~k~nv~ss~~~a~la~~~L~~gGllvltGA~a  153 (159)
                      ..+.++.+.+ +.+.++  ++|.+||-||+...++ ..+...++++++++.|+.+.|..++.+.|+|+++|.++++++.+
T Consensus        87 ~~~v~~~~~~-~~~~~G--~iDiLVNNAG~~~~~~-~~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~G~IInisS~~  162 (273)
T 4fgs_A           87 LAELDRLYEK-VKAEAG--RIDVLFVNAGGGSMLP-LGEVTEEQYDDTFDRNVKGVLFTVQKALPLLARGSSVVLTGSTA  162 (273)
T ss_dssp             HHHHHHHHHH-HHHHHS--CEEEEEECCCCCCCCC-TTSCCHHHHHHHHHHHTHHHHHHHHHHTTTEEEEEEEEEECCGG
T ss_pred             HHHHHHHHHH-HHHHcC--CCCEEEECCCCCCCCC-hhhccHHHHHHHHHHHhHHHHHHHHHHHHHHhhCCeEEEEeehh
Confidence            3444444444 455343  6999999999987776 57888999999999999999999999999999999999999998


Q ss_pred             CCCCCC
Q psy17303        154 ALEGTP  159 (159)
Q Consensus       154 AL~~tp  159 (159)
                      +..|.|
T Consensus       163 ~~~~~~  168 (273)
T 4fgs_A          163 GSTGTP  168 (273)
T ss_dssp             GGSCCT
T ss_pred             hccCCC
Confidence            887765



>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.41
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.37
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 98.33
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 98.14
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 98.14
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 98.13
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 98.11
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 98.09
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 98.08
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 98.07
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 98.07
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 98.06
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 98.04
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 98.02
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 98.0
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 97.99
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 97.97
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 97.95
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 97.94
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 97.94
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 97.93
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 97.92
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 97.91
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 97.89
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 97.88
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 97.88
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 97.85
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 97.84
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 97.84
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 97.8
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 97.79
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 97.77
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.73
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 97.72
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 97.7
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 97.7
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 97.7
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 97.66
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 97.65
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 97.61
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.6
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 97.59
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 97.58
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 97.57
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 97.56
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 97.54
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 97.49
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.47
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 97.44
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 97.42
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 97.37
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 97.29
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 97.09
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 97.08
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 97.07
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 96.63
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 95.97
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 95.45
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 95.35
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 95.15
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 94.76
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 94.68
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 91.05
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 90.66
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 87.7
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 87.65
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 83.11
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 80.42
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Dihydropteridin reductase (pteridine reductase)
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.41  E-value=6.8e-13  Score=104.03  Aligned_cols=96  Identities=46%  Similarity=0.837  Sum_probs=85.6

Q ss_pred             cCccccccccHHHHHHHHHHHHHHHhcCCccceeeeecccccCCCccchhhHHhHHHHHHhhhhHHHHHHHHHhhccCCC
Q psy17303         64 ADNTLIPLLFWTQIETTVLAELKTILAGDKIDAVICVAGGWAVGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPG  143 (159)
Q Consensus        64 ADiMlKp~ssWTQq~~~v~~~v~~~l~~~kvDaIicvAGGwagG~a~~~~~~~~~d~M~k~nv~ss~~~a~la~~~L~~g  143 (159)
                      .+...+.+..-.++.+++...+.+.++..++|.+||.||+|..++..+++..+++|++++.|+++.++.++.+.++|+++
T Consensus        42 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iD~lInnAG~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~m~~~  121 (236)
T d1dhra_          42 ASVIVKMTDSFTEQADQVTAEVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEG  121 (236)
T ss_dssp             EEEECCCCSCHHHHHHHHHHHHHHHHTTCCEEEEEECCCCCCCBCTTCTTHHHHHHHHHHHHHHHHHHHHHHHHHHEEEE
T ss_pred             ccceeecccCcHHHHHHHHHHHHHHhCCCCceEEEECCcccccccchhcCCHHHHHHHHHHcchHHHHHHHHHHHhcccc
Confidence            33444444667778888888888888888999999999999999999999999999999999999999999999999999


Q ss_pred             ceEEeecCCCCCCCCC
Q psy17303        144 GLVSLPGAKPALEGTP  159 (159)
Q Consensus       144 GllvltGA~aAL~~tp  159 (159)
                      |.++++++.+++.|.|
T Consensus       122 G~Iv~isS~~~~~~~~  137 (236)
T d1dhra_         122 GLLTLAGAKAALDGTP  137 (236)
T ss_dssp             EEEEEECCGGGGSCCT
T ss_pred             cceeEEccHHHcCCcc
Confidence            9999999999998875



>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure