Psyllid ID: psy17441

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------46

MFQHINFDIQYVNKGVTFSATGIQMDPNPILTALSVCKFLISERVYAVIVSHPLTGDLSPAAVSYTSGFYHIPVIGISSRDSAFSDKNIHVSFLRTVPPYSHQADVWVELLKHFNYMKVIFIHSSDTDGRALLGRFQTTSQNQEDDVEIKVQVEAVIEFEPGLTTFKDQLYEMKNAQARVYLMYASKQDAEIIFKDAQYLNMTETGYVWIVTEQALTAKNVPVGIIGLKLVNATNEDAHIRDSIYVLTSALKEMNQSAVITEAPQDCDNSGSIWETGKPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFRLSNSDNTEEDALNLSSAIWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLERPKTKLTGINDARLRNTMENLTCATVKGSAVDMYFRRQVELSNMYRTMEANNYDTAEDAIADVKI

cccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEccccccccHHHHHHHHHcccccEEEEEcccccccccccccEEEEEccccHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHccccccEEEEEEEEEEEEEccccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccEEcccccccccccHHHHHHHHHHHHHHHccccccccccccccccEEEEcccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHccccccEEEEEcccccHHHHHHccHHHHHHHHHHHHcccccHHHHHHHccc

ccHHcccccccccccEEEEEEEEEccccHHHHHHHHHHHHHHccEEEEEEEcccccccccccEEEccccEEcEEEEEEccccccccccEEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHcccccccccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHEHEEHccHHHHHHHHHHHHHHHcccccEEEEEEcccEcEEEccccccccccccccccHHEHccccEEEEEEEEcHHHHHEEccccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHcccHHHEEEEEEccccHHHHHHccHHHHHHHHHHHHcccccHHHHHEEEcc

MFQHINFDIqyvnkgvtfsatgiqmdpnpiLTALSVCKFLISERVYAVIVshpltgdlspaavsytsgfyhipvigissrdsafsdknihvsflrtvppyshqADVWVELLKHFNYMKVIFIHSSDTDGRALLGrfqttsqnqedDVEIKVQVEAVIEFEPGLTTFKDQLYEMKNAQARVYLMYASKQDAEIIFKDAQYLNMTETGYVWIVTEQaltaknvpvGIIGLKlvnatnedahirDSIYVLTSALKEMnqsaviteapqdcdnsgsiwetgkpsrsstLVSFLQPFSNTLWILVMVSVHVVALVLYLLDrfspfgrfrlsnsdnteeDALNLSSAIWFAWGVLLnsgigegtprsFSARVLGMVWAGFAMIIVASYTANLAAFLVLerpktkltgindarlRNTMENLTCATVKGSAVDMYFRRQVELSNMyrtmeannydtaedaiadvki

mfqhinfdIQYVNKGVTFSATGIQMDPNPILTALSVCKFLISERVYAVIVSHPLTGDLSPAAVSYTSGFYHIPVIGISSRDSAFSDKNIHVSFLRTVPPYSHQADVWVELLKHFNYMKVIFIHSSDTDGRALLGRFqttsqnqeddVEIKVQVEAVIEFEPGLTTFKDQLYEMKNAQARVYLMYASKQDAEIIFKDAQYLNMTETGYVWIVTEQALTAKNVPVGIIGLKlvnatnedahIRDSIYVLTSALKEMNQSAVIteapqdcdnsgSIWETGKPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFRLSNSDNTEEDALNLSSAIWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLERPktkltgindarlrntmenltcatvkgsavdmYFRRQVELSNMyrtmeannydtaedaiadvki

MFQHINFDIQYVNKGVTFSATGIQMDPNPILTALSVCKFLISERVYAVIVSHPLTGDLSPAAVSYTSGFYHIPVIGISSRDSAFSDKNIHVSFLRTVPPYSHQADVWVELLKHFNYMKVIFIHSSDTDGRALLGRFQTTSQNQEDDVEIKVQVEAVIEFEPGLTTFKDQLYEMKNAQARVYLMYASKQDAEIIFKDAQYLNMTETGYVWIVTEQALTAKNVPVGIIGLKLVNATNEDAHIRDSIYVLTSALKEMNQSAVITEAPQDCDNSGSIWETGKPSRSSTLVSFLQPFSNTLWIlvmvsvhvvalvlyllDRFSPFGRFRLSNSDNTEEDALNLSSAIWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLERPKTKLTGINDARLRNTMENLTCATVKGSAVDMYFRRQVELSNMYRTMEANNYDTAEDAIADVKI

***HINFDIQYVNKGVTFSATGIQMDPNPILTALSVCKFLISERVYAVIVSHPLTGDLSPAAVSYTSGFYHIPVIGISSRDSAFSDKNIHVSFLRTVPPYSHQADVWVELLKHFNYMKVIFIHSSDTDGRALLGRFQ********DVEIKVQVEAVIEFEPGLTTFKDQLYEMKNAQARVYLMYASKQDAEIIFKDAQYLNMTETGYVWIVTEQALTAKNVPVGIIGLKLVNATNEDAHIRDSIYVLTSALKEMNQSAVI***********************TLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFRLS*******DALNLSSAIWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLERPKTKLTGINDARLRNTMENLTCATVKGSAVDMYFRRQVELSNMYRTM*****************

MFQHIN*DIQYVNKGVTFSATGIQMDPNPILTALSVCKFLISERVYAVIVSHPLTGDLSPAAVSYTSGFYHIPVIGISSRD************LRTVPPYSHQADVWVELLKHFNYMKVIFIHSSDTDGRALLGRFQTTSQNQEDDVEIKVQVEAVIEFEPGLTT*KDQLYEMKNAQARVYLMYASKQDAEIIFKDAQYLNMTETGYVWIVTEQALTAKNVPVGIIGLKLVNATNEDAHIRDSIYVLTSALKEMNQSAVITEAPQDCDNSGS***********TLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFR**********ALNLSSAIWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLERPKTKLTGINDARLRNTMENLTCATVKGSAVDMYFRRQVELSNMYRTMEANNYDTAEDAIADVKI

MFQHINFDIQYVNKGVTFSATGIQMDPNPILTALSVCKFLISERVYAVIVSHPLTGDLSPAAVSYTSGFYHIPVIGISSRDSAFSDKNIHVSFLRTVPPYSHQADVWVELLKHFNYMKVIFIHSSDTDGRALLGRFQT********VEIKVQVEAVIEFEPGLTTFKDQLYEMKNAQARVYLMYASKQDAEIIFKDAQYLNMTETGYVWIVTEQALTAKNVPVGIIGLKLVNATNEDAHIRDSIYVLTSALKEMNQSAVITEAPQDCDNSGSIWETGKPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFRLSNSDNTEEDALNLSSAIWFAWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLERPKTKLTGINDARLRNTMENLTCATVKGSAVDMYFRRQVELSNMYRTMEANNYDTAEDAIADVKI

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		458	2.2.26 [Sep-21-2011]
B4MU83		982	Glutamate [NMDA] receptor	N/A	N/A	0.600	0.280	0.659	1e-105
B3LZ39		994	Glutamate [NMDA] receptor	N/A	N/A	0.602	0.277	0.649	1e-104
B4LZB5		984	Glutamate [NMDA] receptor	N/A	N/A	0.600	0.279	0.655	1e-104
Q296F7		1004	Glutamate [NMDA] receptor	yes	N/A	0.606	0.276	0.645	1e-104
B4JHV0		982	Glutamate [NMDA] receptor	N/A	N/A	0.600	0.280	0.652	1e-104
B4GF83		1004	Glutamate [NMDA] receptor	N/A	N/A	0.606	0.276	0.645	1e-104
B4QWW7		997	Glutamate [NMDA] receptor	N/A	N/A	0.602	0.276	0.646	1e-103
B4I414		997	Glutamate [NMDA] receptor	N/A	N/A	0.602	0.276	0.646	1e-103
B4PVB0		997	Glutamate [NMDA] receptor	N/A	N/A	0.602	0.276	0.646	1e-103
Q24418		997	Glutamate [NMDA] receptor	yes	N/A	0.602	0.276	0.646	1e-103

>sp\|B4MU83\|NMDA1_DROWI Glutamate [NMDA] receptor subunit 1 OS=Drosophila willistoni GN=Nmdar1 PE=3 SV=1	Back alignment and function desciption

 Score =  383 bits (983), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 182/276 (65%), Positives = 220/276 (79%), Gaps = 1/276 (0%)

Query: 4   HINFDIQYVNKGVTFSATGIQMDPNPILTALSVCKFLISERVYAVIVSHPLT-GDLSPAA 62
           H+NFD QYV + VT+    I+MD NPI T  +VC  LI +RVYAV+VSH  T GDLSPAA
Sbjct: 49  HLNFDQQYVPRKVTYYEKTIRMDKNPIKTVFNVCNKLIEKRVYAVVVSHEQTSGDLSPAA 108

Query: 63  VSYTSGFYHIPVIGISSRDSAFSDKNIHVSFLRTVPPYSHQADVWVELLKHFNYMKVIFI 122
           VSYTSGFY IPVIGISSRD+AFSDKNIHVSFLRTVPPY HQADVW+E+L HF+Y KVI I
Sbjct: 109 VSYTSGFYSIPVIGISSRDAAFSDKNIHVSFLRTVPPYYHQADVWLEMLSHFSYTKVIII 168

Query: 123 HSSDTDGRALLGRFQTTSQNQEDDVEIKVQVEAVIEFEPGLTTFKDQLYEMKNAQARVYL 182
           HSSDTDGRA+LGRFQTTSQ   DDV+++  VE ++EFEP LT+F + L  MK AQ+RVYL
Sbjct: 169 HSSDTDGRAILGRFQTTSQTYYDDVDVRATVEMIVEFEPKLTSFSEHLTYMKTAQSRVYL 228

Query: 183 MYASKQDAEIIFKDAQYLNMTETGYVWIVTEQALTAKNVPVGIIGLKLVNATNEDAHIRD 242
           MYAS +DA+IIF+DA+  NMT+ G+VWIVTEQAL A N P G++GL+L +A ++  HIRD
Sbjct: 229 MYASTEDAQIIFRDARDHNMTQEGHVWIVTEQALFANNTPEGVLGLQLEHAHSDKGHIRD 288

Query: 243 SIYVLTSALKEMNQSAVITEAPQDCDNSGSIWETGK 278
           S+YVL SA+KEM  +  I EAP+DC +S   WE+GK
Sbjct: 289 SVYVLASAIKEMISNETIAEAPKDCGDSAVNWESGK 324

NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine. This protein plays a key role in synaptic plasticity, synaptogenesis, excitotoxicity, memory acquisition and learning. It mediates neuronal functions in glutamate neurotransmission. Is involved in the cell surface targeting of NMDA receptors. Plays a role in associative learning and in long-term memory consolidation.
Drosophila willistoni (taxid: 7260)

>sp\|B3LZ39\|NMDA1_DROAN Glutamate [NMDA] receptor subunit 1 OS=Drosophila ananassae GN=Nmdar1 PE=3 SV=1	Back alignment and function description

>sp\|B4LZB5\|NMDA1_DROVI Glutamate [NMDA] receptor subunit 1 OS=Drosophila virilis GN=Nmdar1 PE=3 SV=1	Back alignment and function description

>sp\|Q296F7\|NMDA1_DROPS Glutamate [NMDA] receptor subunit 1 OS=Drosophila pseudoobscura pseudoobscura GN=Nmdar1 PE=3 SV=1	Back alignment and function description

>sp\|B4JHV0\|NMDA1_DROGR Glutamate [NMDA] receptor subunit 1 OS=Drosophila grimshawi GN=Nmdar1 PE=3 SV=1	Back alignment and function description

>sp\|B4GF83\|NMDA1_DROPE Glutamate [NMDA] receptor subunit 1 OS=Drosophila persimilis GN=Nmdar1 PE=3 SV=1	Back alignment and function description

>sp\|B4QWW7\|NMDA1_DROSI Glutamate [NMDA] receptor subunit 1 OS=Drosophila simulans GN=Nmdar1 PE=3 SV=1	Back alignment and function description

>sp\|B4I414\|NMDA1_DROSE Glutamate [NMDA] receptor subunit 1 OS=Drosophila sechellia GN=Nmdar1 PE=3 SV=1	Back alignment and function description

>sp\|B4PVB0\|NMDA1_DROYA Glutamate [NMDA] receptor subunit 1 OS=Drosophila yakuba GN=Nmdar1 PE=3 SV=1	Back alignment and function description

>sp\|Q24418\|NMDA1_DROME Glutamate [NMDA] receptor subunit 1 OS=Drosophila melanogaster GN=Nmdar1 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		458
91090776		946	PREDICTED: similar to NMDA-type glutamat	0.600	0.290	0.803	1e-132
307214882		1001	Glutamate [NMDA] receptor subunit zeta-1	0.600	0.274	0.807	1e-129
322787090		956	hypothetical protein SINV_00626 [Solenop	0.600	0.287	0.8	1e-129
68124044		413	NMDA-type glutamate receptor subunit 1,	0.598	0.663	0.799	1e-128
332025508		962	Glutamate [NMDA] receptor subunit 1 [Acr	0.596	0.283	0.803	1e-128
68124042		381	NMDA-type glutamate receptor subunit 1,	0.604	0.727	0.790	1e-128
380030143		957	PREDICTED: LOW QUALITY PROTEIN: glutamat	0.604	0.289	0.790	1e-127
58585096		953	NMDA receptor 1 [Apis mellifera] gi\|3311	0.604	0.290	0.790	1e-127
242006424		940	N-methyl-D-aspartate receptor, putative	0.606	0.295	0.780	1e-126
307189011		965	Glutamate [NMDA] receptor subunit zeta-1	0.600	0.284	0.789	1e-126

>gi\|91090776\|ref\|XP_969654.1\| PREDICTED: similar to NMDA-type glutamate receptor 1 [Tribolium castaneum] gi\|270013267\|gb\|EFA09715.1\| hypothetical protein TcasGA2_TC011848 [Tribolium castaneum]	Back alignment and taxonomy information

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 221/275 (80%), Positives = 249/275 (90%)

Query: 4   HINFDIQYVNKGVTFSATGIQMDPNPILTALSVCKFLISERVYAVIVSHPLTGDLSPAAV 63
           H+NFD QYV KGVT+  T I MDPNPI TAL+VCK+LI+ RVYAV+VSHPLTGDLSPAAV
Sbjct: 48  HLNFDSQYVPKGVTYYDTAILMDPNPIKTALNVCKYLITSRVYAVVVSHPLTGDLSPAAV 107

Query: 64  SYTSGFYHIPVIGISSRDSAFSDKNIHVSFLRTVPPYSHQADVWVELLKHFNYMKVIFIH 123
           SYTSGFYHIPVIGISSRDSAFSDKNIHVSFLRTVPPYSHQADVWVE+LKHFNY KVIFIH
Sbjct: 108 SYTSGFYHIPVIGISSRDSAFSDKNIHVSFLRTVPPYSHQADVWVEMLKHFNYKKVIFIH 167

Query: 124 SSDTDGRALLGRFQTTSQNQEDDVEIKVQVEAVIEFEPGLTTFKDQLYEMKNAQARVYLM 183
           SSDTDGRALLGRFQTTSQ+ EDDVEIKVQVE++IEFEPGL TFK+QL +MKNAQ+RVYLM
Sbjct: 168 SSDTDGRALLGRFQTTSQSLEDDVEIKVQVESIIEFEPGLETFKEQLSDMKNAQSRVYLM 227

Query: 184 YASKQDAEIIFKDAQYLNMTETGYVWIVTEQALTAKNVPVGIIGLKLVNATNEDAHIRDS 243
           YASK DA++IF+DA   NMT+ GY WIVTEQAL A N+P GI+GL+LVNATNE AHI+DS
Sbjct: 228 YASKTDAQVIFRDAAEFNMTDAGYAWIVTEQALVANNIPEGILGLRLVNATNEKAHIKDS 287

Query: 244 IYVLTSALKEMNQSAVITEAPQDCDNSGSIWETGK 278
           IYVL SAL+++NQ+  ITEAP+DCD+SG IWETG+
Sbjct: 288 IYVLASALRDLNQTKEITEAPKDCDDSGQIWETGR 322

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|307214882\|gb\|EFN89750.1\| Glutamate [NMDA] receptor subunit zeta-1 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|322787090\|gb\|EFZ13311.1\| hypothetical protein SINV_00626 [Solenopsis invicta]	Back alignment and taxonomy information

>gi\|68124044\|emb\|CAJ09692.1\| NMDA-type glutamate receptor subunit 1, variant 4 (NR1.4) [Apis mellifera carnica]	Back alignment and taxonomy information

>gi\|332025508\|gb\|EGI65671.1\| Glutamate [NMDA] receptor subunit 1 [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|68124042\|emb\|CAJ09691.1\| NMDA-type glutamate receptor subunit 1, variant 3 (NR1.3) [Apis mellifera carnica]	Back alignment and taxonomy information

>gi\|380030143\|ref\|XP_003698715.1\| PREDICTED: LOW QUALITY PROTEIN: glutamate [NMDA] receptor subunit 1-like [Apis florea]	Back alignment and taxonomy information

>gi\|58585096\|ref\|NP_001011573.1\| NMDA receptor 1 [Apis mellifera] gi\|33114005\|gb\|AAP94623.1\| NMDA-type glutamate receptor 1 [Apis mellifera] gi\|68124060\|emb\|CAJ09700.1\| NMDA-type glutamate receptor subunit 1, variant 1 (NR1.1) [Apis mellifera carnica]	Back alignment and taxonomy information

>gi\|242006424\|ref\|XP_002424050.1\| N-methyl-D-aspartate receptor, putative [Pediculus humanus corporis] gi\|212507356\|gb\|EEB11312.1\| N-methyl-D-aspartate receptor, putative [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|307189011\|gb\|EFN73528.1\| Glutamate [NMDA] receptor subunit zeta-1 [Camponotus floridanus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		458
UNIPROTKB\|B4MU83		982	Nmdar1 "Glutamate [NMDA] recep	0.600	0.280	0.659	8.4e-175
UNIPROTKB\|B3LZ39		994	Nmdar1 "Glutamate [NMDA] recep	0.602	0.277	0.649	1.2e-173
UNIPROTKB\|B4GF83		1004	Nmdar1 "Glutamate [NMDA] recep	0.606	0.276	0.645	1.6e-173
UNIPROTKB\|Q296F7		1004	Nmdar1 "Glutamate [NMDA] recep	0.606	0.276	0.645	1.6e-173
UNIPROTKB\|B4LZB5		984	Nmdar1 "Glutamate [NMDA] recep	0.600	0.279	0.655	3.2e-173
UNIPROTKB\|B3P2E5		997	Nmdar1 "Glutamate [NMDA] recep	0.602	0.276	0.646	3.2e-173
UNIPROTKB\|B4PVB0		997	Nmdar1 "Glutamate [NMDA] recep	0.602	0.276	0.646	3.2e-173
UNIPROTKB\|B4I414		997	Nmdar1 "Glutamate [NMDA] recep	0.602	0.276	0.646	3.2e-173
UNIPROTKB\|B4QWW7		997	Nmdar1 "Glutamate [NMDA] recep	0.602	0.276	0.646	3.2e-173
FB\|FBgn0010399		997	Nmdar1 "NMDA receptor 1" [Dros	0.602	0.276	0.646	3.2e-173

UNIPROTKB\|B4MU83 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila willistoni (taxid:7260)]	Back alignment and assigned GO terms

 Score = 948 (338.8 bits), Expect = 8.4e-175, Sum P(2) = 8.4e-175
 Identities = 182/276 (65%), Positives = 220/276 (79%)

Query:     4 HINFDIQYVNKGVTFSATGIQMDPNPILTALSVCKFLISERVYAVIVSHPLT-GDLSPAA 62
             H+NFD QYV + VT+    I+MD NPI T  +VC  LI +RVYAV+VSH  T GDLSPAA
Sbjct:    49 HLNFDQQYVPRKVTYYEKTIRMDKNPIKTVFNVCNKLIEKRVYAVVVSHEQTSGDLSPAA 108

Query:    63 VSYTSGFYHIPVIGISSRDSAFSDKNIHVSFLRTVPPYSHQADVWVELLKHFNYMKVIFI 122
             VSYTSGFY IPVIGISSRD+AFSDKNIHVSFLRTVPPY HQADVW+E+L HF+Y KVI I
Sbjct:   109 VSYTSGFYSIPVIGISSRDAAFSDKNIHVSFLRTVPPYYHQADVWLEMLSHFSYTKVIII 168

Query:   123 HSSDTDGRALLGRFQTTSQNQEDDVEIKVQVEAVIEFEPGLTTFKDQLYEMKNAQARVYL 182
             HSSDTDGRA+LGRFQTTSQ   DDV+++  VE ++EFEP LT+F + L  MK AQ+RVYL
Sbjct:   169 HSSDTDGRAILGRFQTTSQTYYDDVDVRATVEMIVEFEPKLTSFSEHLTYMKTAQSRVYL 228

Query:   183 MYASKQDAEIIFKDAQYLNMTETGYVWIVTEQALTAKNVPVGIIGLKLVNATNEDAHIRD 242
             MYAS +DA+IIF+DA+  NMT+ G+VWIVTEQAL A N P G++GL+L +A ++  HIRD
Sbjct:   229 MYASTEDAQIIFRDARDHNMTQEGHVWIVTEQALFANNTPEGVLGLQLEHAHSDKGHIRD 288

Query:   243 SIYVLTSALKEMNQSAVITEAPQDCDNSGSIWETGK 278
             S+YVL SA+KEM  +  I EAP+DC +S   WE+GK
Sbjct:   289 SVYVLASAIKEMISNETIAEAPKDCGDSAVNWESGK 324

GO:0004970 "ionotropic glutamate receptor activity" evidence=ISS

GO:0007268 "synaptic transmission" evidence=ISS

GO:0007616 "long-term memory" evidence=ISS

GO:0008355 "olfactory learning" evidence=ISS

GO:0017146 "N-methyl-D-aspartate selective glutamate receptor complex" evidence=ISS

GO:0035235 "ionotropic glutamate receptor signaling pathway" evidence=ISS

GO:0042391 "regulation of membrane potential" evidence=ISS

GO:0045211 "postsynaptic membrane" evidence=ISS

GO:0055074 "calcium ion homeostasis" evidence=ISS

UNIPROTKB\|B3LZ39 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila ananassae (taxid:7217)]	Back alignment and assigned GO terms

UNIPROTKB\|B4GF83 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila persimilis (taxid:7234)]	Back alignment and assigned GO terms

UNIPROTKB\|Q296F7 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila pseudoobscura pseudoobscura (taxid:46245)]	Back alignment and assigned GO terms

UNIPROTKB\|B4LZB5 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila virilis (taxid:7244)]	Back alignment and assigned GO terms

UNIPROTKB\|B3P2E5 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila erecta (taxid:7220)]	Back alignment and assigned GO terms

UNIPROTKB\|B4PVB0 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila yakuba (taxid:7245)]	Back alignment and assigned GO terms

UNIPROTKB\|B4I414 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila sechellia (taxid:7238)]	Back alignment and assigned GO terms

UNIPROTKB\|B4QWW7 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila simulans (taxid:7240)]	Back alignment and assigned GO terms

FB\|FBgn0010399 Nmdar1 "NMDA receptor 1" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q296F7	NMDA1_DROPS	No assigned EC number	0.6451	0.6069	0.2768	yes	N/A
Q24418	NMDA1_DROME	No assigned EC number	0.6462	0.6026	0.2768	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		458
cd06379		377	cd06379, PBP1_iGluR_NMDA_NR1, N-terminal leucine/i	1e-125
cd06367		362	cd06367, PBP1_iGluR_NMDA, N-terminal leucine/isole	2e-78
pfam00060		268	pfam00060, Lig_chan, Ligand-gated ion channel	9e-40
cd06269		298	cd06269, PBP1_glutamate_receptors_like, Family C G	5e-35
cd06351		328	cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leuci	1e-31
pfam01094		343	pfam01094, ANF_receptor, Receptor family ligand bi	1e-26
cd04509		299	cd04509, PBP1_ABC_transporter_GCPR_C_like, Family	2e-23
cd06350		348	cd06350, PBP1_GPCR_family_C_like, Ligand-binding d	3e-21
cd06366		350	cd06366, PBP1_GABAb_receptor, Ligand-binding domai	1e-18
cd06363		410	cd06363, PBP1_Taste_receptor, Ligand-binding domai	3e-17
cd06378		362	cd06378, PBP1_iGluR_NMDA_NR2, N-terminal leucine/i	1e-13
cd06364		510	cd06364, PBP1_CaSR, Ligand-binding domain of the C	2e-12
cd06352		389	cd06352, PBP1_NPR_GC_like, Ligand-binding domain o	2e-10
cd01391		269	cd01391, Periplasmic_Binding_Protein_Type_1, Type	2e-10
cd06362		452	cd06362, PBP1_mGluR, Ligand binding domain of the	2e-08
cd06268		298	cd06268, PBP1_ABC_transporter_LIVBP_like, Periplas	3e-08
cd06375		458	cd06375, PBP1_mGluR_groupII, Ligand binding domain	5e-08
cd06361		403	cd06361, PBP1_GPC6A_like, Ligand-binding domain of	1e-06
cd06374		472	cd06374, PBP1_mGluR_groupI, Ligand binding domain	8e-05
cd06370		404	cd06370, PBP1_Speract_GC_like, Ligand-binding doma	1e-04
cd06368		324	cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leuc	2e-04
smart00079		133	smart00079, PBPe, Eukaryotic homologues of bacteri	9e-04
COG0683		366	COG0683, LivK, ABC-type branched-chain amino acid	0.001
cd06386		387	cd06386, PBP1_NPR_C_like, Ligand-binding domain of	0.002
cd06372		391	cd06372, PBP1_GC_G_like, Ligand-binding domain of	0.003

>gnl\|CDD\|107374 cd06379, PBP1_iGluR_NMDA_NR1, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor	Back alignment and domain information

 Score =  367 bits (945), Expect = e-125
 Identities = 148/277 (53%), Positives = 199/277 (71%), Gaps = 5/277 (1%)

Query: 4   HINFDIQYVNKGVTFSATGIQMDPNPILTALSVCKFLISERVYAVIVSHPLTGD--LSPA 61
             N + ++ ++ +  +AT I  DPNPI TALSVC+ LIS +VYAVIVSHP T +  L+P 
Sbjct: 41  AANVE-RHGSRKIKLNATTITHDPNPIQTALSVCEQLISNQVYAVIVSHPPTSNDHLTPT 99

Query: 62  AVSYTSGFYHIPVIGISSRDSAFSDKNIHVSFLRTVPPYSHQADVWVELLKHFNYMKVIF 121
           +VSYT+GFY IPV+GIS+RDS FSDKNIH+SFLRTVPPYSHQADVW+E+L+ F + KVI 
Sbjct: 100 SVSYTAGFYRIPVVGISTRDSIFSDKNIHLSFLRTVPPYSHQADVWLEMLRSFKWNKVIL 159

Query: 122 IHSSDTDGRALLGRFQTTSQNQEDDVEIKVQVEAVIEFEPGLTTFKDQLYEMKNAQARVY 181
           + S D +GRA   RF+T  + +E + +IK  VE V+EFEPG       L E K   +RV 
Sbjct: 160 LVSDDHEGRAAQKRFETLLEEREIEFKIK--VEKVVEFEPGEKNVTSLLQEAKELTSRVI 217

Query: 182 LMYASKQDAEIIFKDAQYLNMTETGYVWIVTEQALTAKNVPVGIIGLKLVNATNEDAHIR 241
           L+ AS+ DA +I+++A  LNMT  GYVWIV+EQA  A+N P G++GL+L+N  NE +HIR
Sbjct: 218 LLSASEDDAAVIYRNAGMLNMTGEGYVWIVSEQAGAARNAPDGVLGLQLINGKNESSHIR 277

Query: 242 DSIYVLTSALKEMNQSAVITEAPQDCDNSGSIWETGK 278
           D++ VL SA++E+ +   ITE P++C  +  IWETG 
Sbjct: 278 DAVAVLASAIQELFEKENITEPPRECVGNTVIWETGP 314

N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor. The ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptor serves critical functions in neuronal development, functioning, and degeneration in the mammalian central nervous system. The functional NMDA receptor is a heterotetramer ccomposed of two NR1 and two NR2 (A, B, C, and D) or of NR3 (A and B) subunits. The receptor controls a cation channel that is highly permeable to monovalent ions and calcium and exhibits voltage-dependent inhibition by magnesium. Dual agonists, glutamate and glycine, are required for efficient activation of the NMDA receptor. When co-expressed with NR1, the NR3 subunits form receptors that are activated by glycine alone and therefore can be classified as excitatory glycine receptors. NR1/NR3 receptors are calcium-impermeable and unaffected by ligands acting at the NR2 glutamate-binding site. Length = 377

>gnl\|CDD\|107362 cd06367, PBP1_iGluR_NMDA, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors	Back alignment and domain information

>gnl\|CDD\|215685 pfam00060, Lig_chan, Ligand-gated ion channel	Back alignment and domain information

>gnl\|CDD\|153137 cd06269, PBP1_glutamate_receptors_like, Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors	Back alignment and domain information

>gnl\|CDD\|107346 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs)	Back alignment and domain information

>gnl\|CDD\|216296 pfam01094, ANF_receptor, Receptor family ligand binding region	Back alignment and domain information

>gnl\|CDD\|107261 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems	Back alignment and domain information

>gnl\|CDD\|153138 cd06350, PBP1_GPCR_family_C_like, Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs)	Back alignment and domain information

>gnl\|CDD\|107361 cd06366, PBP1_GABAb_receptor, Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA)	Back alignment and domain information

>gnl\|CDD\|107358 cd06363, PBP1_Taste_receptor, Ligand-binding domain of the T1R taste receptor	Back alignment and domain information

>gnl\|CDD\|107373 cd06378, PBP1_iGluR_NMDA_NR2, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family	Back alignment and domain information

>gnl\|CDD\|107359 cd06364, PBP1_CaSR, Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily	Back alignment and domain information

>gnl\|CDD\|107347 cd06352, PBP1_NPR_GC_like, Ligand-binding domain of membrane guanylyl-cyclase receptors	Back alignment and domain information

>gnl\|CDD\|107248 cd01391, Periplasmic_Binding_Protein_Type_1, Type 1 periplasmic binding fold superfamily	Back alignment and domain information

>gnl\|CDD\|107357 cd06362, PBP1_mGluR, Ligand binding domain of the metabotropic glutamate receptors (mGluR)	Back alignment and domain information

>gnl\|CDD\|107263 cd06268, PBP1_ABC_transporter_LIVBP_like, Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily	Back alignment and domain information

>gnl\|CDD\|107370 cd06375, PBP1_mGluR_groupII, Ligand binding domain of the group II metabotropic glutamate receptor	Back alignment and domain information

>gnl\|CDD\|107356 cd06361, PBP1_GPC6A_like, Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor	Back alignment and domain information

>gnl\|CDD\|107369 cd06374, PBP1_mGluR_groupI, Ligand binding domain of the group I metabotropic glutamate receptor	Back alignment and domain information

>gnl\|CDD\|107365 cd06370, PBP1_Speract_GC_like, Ligand-binding domain of membrane bound guanylyl cyclases	Back alignment and domain information

>gnl\|CDD\|107363 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors	Back alignment and domain information

>gnl\|CDD\|197504 smart00079, PBPe, Eukaryotic homologues of bacterial periplasmic substrate binding proteins	Back alignment and domain information

>gnl\|CDD\|223755 COG0683, LivK, ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|107381 cd06386, PBP1_NPR_C_like, Ligand-binding domain of type C natriuretic peptide receptor	Back alignment and domain information

>gnl\|CDD\|107367 cd06372, PBP1_GC_G_like, Ligand-binding domain of membrane guanylyl cyclase G	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		458
KOG4440\|consensus		993		100.0
KOG1054\|consensus		897		100.0
KOG1053\|consensus		1258		100.0
cd06379		377	PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/	100.0
cd06361		403	PBP1_GPC6A_like Ligand-binding domain of the promi	100.0
cd06367		362	PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali	100.0
cd06375		458	PBP1_mGluR_groupII Ligand binding domain of the gr	100.0
cd06365		469	PBP1_Pheromone_receptor Ligand-binding domain of t	100.0
cd06374		472	PBP1_mGluR_groupI Ligand binding domain of the gro	100.0
cd06376		463	PBP1_mGluR_groupIII Ligand-binding domain of the g	100.0
cd06364		510	PBP1_CaSR Ligand-binding domain of the CaSR calciu	100.0
cd06362		452	PBP1_mGluR Ligand binding domain of the metabotrop	100.0
cd06386		387	PBP1_NPR_C_like Ligand-binding domain of type C na	100.0
cd06392		400	PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v	100.0
cd06363		410	PBP1_Taste_receptor Ligand-binding domain of the T	100.0
cd06378		362	PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/	100.0
cd06371		382	PBP1_sensory_GC_DEF_like Ligand-binding domain of	100.0
cd06372		391	PBP1_GC_G_like Ligand-binding domain of membrane g	100.0
cd06393		384	PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol	100.0
cd06390		364	PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin	100.0
cd06373		396	PBP1_NPR_like Ligand binding domain of natriuretic	99.98
cd06370		404	PBP1_Speract_GC_like Ligand-binding domain of memb	99.97
PF01094		348	ANF_receptor: Receptor family ligand binding regio	99.97
cd06352		389	PBP1_NPR_GC_like Ligand-binding domain of membrane	99.97
KOG1056\|consensus		878		99.97
cd06380		382	PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali	99.97
cd06385		405	PBP1_NPR_A Ligand-binding domain of type A natriur	99.97
cd06350		348	PBP1_GPCR_family_C_like Ligand-binding domain of m	99.97
cd06387		372	PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin	99.97
cd06391		400	PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v	99.97
cd06384		399	PBP1_NPR_B Ligand-binding domain of type B natriur	99.97
cd06388		371	PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin	99.97
cd06366		350	PBP1_GABAb_receptor Ligand-binding domain of GABAb	99.97
cd06389		370	PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin	99.97
cd06383		368	PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine	99.96
cd06394		333	PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu	99.96
cd06382		327	PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v	99.96
KOG1052\|consensus		656		99.96
cd06346		312	PBP1_ABC_ligand_binding_like_11 Type I periplasmic	99.95
cd06368		324	PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu	99.94
cd06351		328	PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc	99.94
cd06377		382	PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/	99.94
cd06381		363	PBP1_iGluR_delta_like N-terminal leucine/isoleucin	99.94
cd06269		298	PBP1_glutamate_receptors_like Family C G-protein c	99.94
cd06340		347	PBP1_ABC_ligand_binding_like_6 Type I periplasmic	99.93
cd06342		334	PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind	99.93
cd06345		344	PBP1_ABC_ligand_binding_like_10 Type I periplasmic	99.93
cd06338		345	PBP1_ABC_ligand_binding_like_5 Type I periplasmic	99.93
cd06348		344	PBP1_ABC_ligand_binding_like_13 Type I periplasmic	99.93
cd06344		332	PBP1_ABC_ligand_binding_like_9 Type I periplasmic	99.92
PRK15404		369	leucine ABC transporter subunit substrate-binding	99.92
cd06347		334	PBP1_ABC_ligand_binding_like_12 Type I periplasmic	99.92
cd06327		334	PBP1_SBP_like_1 Periplasmic solute-binding domain	99.92
cd06343		362	PBP1_ABC_ligand_binding_like_8 Type I periplasmic	99.92
cd06349		340	PBP1_ABC_ligand_binding_like_14 Type I periplasmic	99.91
cd06329		342	PBP1_SBP_like_3 Periplasmic solute-binding domain	99.91
cd06334		351	PBP1_ABC_ligand_binding_like_1 Type I periplasmic	99.91
cd06335		347	PBP1_ABC_ligand_binding_like_2 Type I periplasmic	99.91
cd06330		346	PBP1_Arsenic_SBP_like Periplasmic solute-binding d	99.91
cd06336		347	PBP1_ABC_ligand_binding_like_3 Type I periplasmic	99.91
cd06331		333	PBP1_AmiC_like Type I periplasmic components of am	99.9
COG0683		366	LivK ABC-type branched-chain amino acid transport	99.9
cd06359		333	PBP1_Nba_like Type I periplasmic binding component	99.89
cd06355		348	PBP1_FmdD_like Periplasmic component (FmdD) of an	99.89
cd06328		333	PBP1_SBP_like_2 Periplasmic solute-binding domain	99.89
cd04509		299	PBP1_ABC_transporter_GCPR_C_like Family C of G-pro	99.88
cd06360		336	PBP1_alkylbenzenes_like Type I periplasmic binding	99.88
TIGR03669		374	urea_ABC_arch urea ABC transporter, substrate-bind	99.87
TIGR03407		359	urea_ABC_UrtA urea ABC transporter, urea binding p	99.86
cd06358		333	PBP1_NHase Type I periplasmic-binding protein of t	99.86
cd06356		334	PBP1_Amide_Urea_BP_like Periplasmic component (Fmd	99.86
cd06332		333	PBP1_aromatic_compounds_like Type I periplasmic bi	99.86
PF13458		343	Peripla_BP_6: Periplasmic binding protein; PDB: 4E	99.85
cd06337		357	PBP1_ABC_ligand_binding_like_4 Type I periplasmic	99.84
cd06357		360	PBP1_AmiC Periplasmic binding domain of amidase (A	99.84
KOG1055\|consensus		865		99.84
cd06326		336	PBP1_STKc_like Type I periplasmic binding domain o	99.83
cd06339		336	PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin	99.83
cd06268		298	PBP1_ABC_transporter_LIVBP_like Periplasmic bindin	99.82
cd06333		312	PBP1_ABC-type_HAAT_like Type I periplasmic binding	99.82
cd06341		341	PBP1_ABC_ligand_binding_like_7 Type I periplasmic	99.81
TIGR03863		347	PQQ_ABC_bind ABC transporter, substrate binding pr	99.8
PF00060		148	Lig_chan: Ligand-gated ion channel; InterPro: IPR0	99.77
PF13433		363	Peripla_BP_5: Periplasmic binding protein domain;	99.65
cd06369		380	PBP1_GC_C_enterotoxin_receptor Ligand-binding doma	99.6
cd01391		269	Periplasmic_Binding_Protein_Type_1 Type 1 periplas	99.47
cd01537		264	PBP1_Repressors_Sugar_Binding_like Ligand-binding	98.41
cd06267		264	PBP1_LacI_sugar_binding_like Ligand binding domain	98.27
cd01536		267	PBP1_ABC_sugar_binding_like Periplasmic sugar-bind	98.23
cd06300		272	PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi	98.2
cd06282		266	PBP1_GntR_like_2 Ligand-binding domain of putative	98.04
cd06325		281	PBP1_ABC_uncharacterized_transporter Type I peripl	97.94
PF07885		79	Ion_trans_2: Ion channel; InterPro: IPR013099 This	97.9
PF04348		536	LppC: LppC putative lipoprotein; InterPro: IPR0074	97.75
cd06320		275	PBP1_allose_binding Periplasmic allose-binding dom	97.67
cd06309		273	PBP1_YtfQ_like Periplasmic binding domain of ABC-t	97.51
cd06273		268	PBP1_GntR_like_1 This group includes the ligand-bi	97.51
KOG1419\|consensus		654		97.48
cd06323		268	PBP1_ribose_binding Periplasmic sugar-binding doma	97.38
cd06319		277	PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-b	97.35
KOG3713\|consensus		477		97.33
cd01545		270	PBP1_SalR Ligand-binding domain of DNA transcripti	97.28
cd06298		268	PBP1_CcpA_like Ligand-binding domain of the catabo	97.27
cd06312		271	PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-bi	97.17
cd06317		275	PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-bi	97.15
TIGR01481		329	ccpA catabolite control protein A. Catabolite cont	97.12
PF13407		257	Peripla_BP_4: Periplasmic binding protein domain;	97.08
cd06289		268	PBP1_MalI_like Ligand-binding domain of MalI, a tr	96.98
cd06310		273	PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi	96.97
cd06271		268	PBP1_AglR_RafR_like Ligand-binding domain of DNA t	96.97
cd06305		273	PBP1_methylthioribose_binding_like Methylthioribos	96.95
cd06301		272	PBP1_rhizopine_binding_like Periplasmic binding pr	96.94
cd01542		259	PBP1_TreR_like Ligand-binding domain of DNA transc	96.91
cd06284		267	PBP1_LacI_like_6 Ligand-binding domain of an uncha	96.91
cd06303		280	PBP1_LuxPQ_Quorum_Sensing Periplasmic binding prot	96.88
cd06311		274	PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi	96.79
PRK10653		295	D-ribose transporter subunit RbsB; Provisional	96.76
cd01575		268	PBP1_GntR Ligand-binding domain of DNA transcripti	96.74
cd06294		270	PBP1_ycjW_transcription_regulator_like Ligand-bind	96.73
cd06288		269	PBP1_sucrose_transcription_regulator Ligand-bindin	96.69
cd01574		264	PBP1_LacI Ligand-binding domain of DNA transcripti	96.69
cd06297		269	PBP1_LacI_like_12 Ligand-binding domain of unchara	96.64
cd06278		266	PBP1_LacI_like_2 Ligand-binding domain of uncharac	96.64
cd06296		270	PBP1_CatR_like Ligand-binding domain of a LacI-lik	96.64
cd06324		305	PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-b	96.62
cd06308		270	PBP1_sensor_kinase_like Periplasmic binding domain	96.61
PRK11303		328	DNA-binding transcriptional regulator FruR; Provis	96.59
PF00532		279	Peripla_BP_1: Periplasmic binding proteins and sug	96.47
cd06322		267	PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b	96.45
COG1609		333	PurR Transcriptional regulators [Transcription]	96.44
cd06295		275	PBP1_CelR Ligand binding domain of a transcription	96.43
cd06279		283	PBP1_LacI_like_3 Ligand-binding domain of uncharac	96.39
cd06277		268	PBP1_LacI_like_1 Ligand-binding domain of uncharac	96.32
cd01540		289	PBP1_arabinose_binding Periplasmic L-arabinose-bin	96.31
cd06293		269	PBP1_LacI_like_11 Ligand-binding domain of unchara	96.3
PRK09526		342	lacI lac repressor; Reviewed	96.28
cd06321		271	PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-b	96.26
PLN03192		823	Voltage-dependent potassium channel; Provisional	96.26
TIGR02417		327	fruct_sucro_rep D-fructose-responsive transcriptio	96.25
cd06313		272	PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-bi	96.22
PRK10014		342	DNA-binding transcriptional repressor MalI; Provis	96.16
cd06275		269	PBP1_PurR Ligand-binding domain of purine represso	96.15
cd06291		265	PBP1_Qymf_like Ligand binding domain of the lacI-l	96.14
cd06299		265	PBP1_LacI_like_13 Ligand-binding domain of DNA-bin	96.13
COG2984		322	ABC-type uncharacterized transport system, peripla	96.1
cd06270		268	PBP1_GalS_like Ligand binding domain of DNA transc	96.07
cd06283		267	PBP1_RegR_EndR_KdgR_like Ligand-binding domain of	96.06
cd06306		268	PBP1_TorT-like TorT-like proteins, a periplasmic b	96.0
PRK10703		341	DNA-binding transcriptional repressor PurR; Provis	95.86
PRK09492		315	treR trehalose repressor; Provisional	95.8
cd06274		264	PBP1_FruR Ligand binding domain of DNA transcripti	95.78
cd06316		294	PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-bi	95.76
cd06285		265	PBP1_LacI_like_7 Ligand-binding domain of uncharac	95.69
PRK09701		311	D-allose transporter subunit; Provisional	95.63
cd06281		269	PBP1_LacI_like_5 Ligand-binding domain of uncharac	95.57
PRK10936		343	TMAO reductase system periplasmic protein TorT; Pr	95.49
KOG1545\|consensus		507		95.35
cd06272		261	PBP1_hexuronate_repressor_like Ligand-binding doma	95.32
PRK10537		393	voltage-gated potassium channel; Provisional	95.16
PRK14987		331	gluconate operon transcriptional regulator; Provis	95.15
cd06290		265	PBP1_LacI_like_9 Ligand-binding domain of uncharac	95.14
PRK10423		327	transcriptional repressor RbsR; Provisional	95.04
cd06280		263	PBP1_LacI_like_4 Ligand-binding domain of uncharac	94.97
cd06286		260	PBP1_CcpB_like Ligand-binding domain of a novel tr	94.87
cd06302		298	PBP1_LsrB_Quorum_Sensing Periplasmic binding domai	94.86
cd01541		273	PBP1_AraR Ligand-binding domain of DNA transcripti	94.74
cd01539		303	PBP1_GGBP Periplasmic glucose/galactose-binding pr	94.71
smart00079		134	PBPe Eukaryotic homologues of bacterial periplasmi	94.69
TIGR02405		311	trehalos_R_Ecol trehalose operon repressor, proteo	94.68
cd06318		282	PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-bi	94.6
cd06354		265	PBP1_BmpA_PnrA_like Periplasmic binding domain of	94.59
TIGR02955		295	TMAO_TorT TMAO reductase system periplasmic protei	94.47
cd06292		273	PBP1_LacI_like_10 Ligand-binding domain of unchara	94.41
PF04392		294	ABC_sub_bind: ABC transporter substrate binding pr	94.36
PRK10727		343	DNA-binding transcriptional regulator GalR; Provis	94.26
KOG4390\|consensus		632		94.26
cd06304		260	PBP1_BmpA_like Periplasmic binding component of a	94.11
cd01538		288	PBP1_ABC_xylose_binding Periplasmic xylose-binding	94.06
cd06307		275	PBP1_uncharacterized_sugar_binding Periplasmic sug	93.9
cd06314		271	PBP1_tmGBP Periplasmic sugar-binding domain of The	93.88
cd01543		265	PBP1_XylR Ligand-binding domain of DNA transcripti	93.75
PRK15408		336	autoinducer 2-binding protein lsrB; Provisional	93.71
cd06287		269	PBP1_LacI_like_8 Ligand-binding domain of uncharac	93.64
TIGR02990		239	ectoine_eutA ectoine utilization protein EutA. Mem	93.63
PRK10401		346	DNA-binding transcriptional regulator GalS; Provis	93.39
COG1879		322	RbsB ABC-type sugar transport system, periplasmic	93.3
cd01544		270	PBP1_GalR Ligand-binding domain of DNA transcripti	92.89
PRK11041		309	DNA-binding transcriptional regulator CytR; Provis	92.04
KOG3684\|consensus		489		91.68
PF13377		160	Peripla_BP_3: Periplasmic binding protein-like dom	91.52
COG3473		238	Maleate cis-trans isomerase [Secondary metabolites	89.98
PF03808		172	Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp	89.61
PRK10339		327	DNA-binding transcriptional repressor EbgR; Provis	88.94
KOG1418\|consensus		433		88.81
PRK10355		330	xylF D-xylose transporter subunit XylF; Provisiona	87.69
KOG0498\|consensus		727		87.42
cd06533		171	Glyco_transf_WecG_TagA The glycosyltransferase Wec	85.82
cd06353		258	PBP1_BmpA_Med_like Periplasmic binding domain of t	85.39
cd06315		280	PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-bi	84.48
TIGR02634		302	xylF D-xylose ABC transporter, substrate-binding p	84.13
TIGR00035		229	asp_race aspartate racemase.	83.6
TIGR02637		302	RhaS rhamnose ABC transporter, rhamnose-binding pr	81.63
COG3107		604	LppC Putative lipoprotein [General function predic	81.41
PRK10200		230	putative racemase; Provisional	81.34
PF06506		176	PrpR_N: Propionate catabolism activator; InterPro:	80.31

>KOG4440\|consensus	Back alignment and domain information

Probab=100.00  E-value=2.1e-62  Score=472.46  Aligned_cols=431  Identities=62%  Similarity=1.016  Sum_probs=392.9

Q ss_pred             eeeeCCCHHHHHHHHHHHhhcCCeEEEEEeCCCCCC--CchHHHHHhhcccCCcEEeeecCCCCCCCCccccceeecCCC
Q psy17441         22 GIQMDPNPILTALSVCKFLISERVYAVIVSHPLTGD--LSPAAVSYTSGFYHIPVIGISSRDSAFSDKNIHVSFLRTVPP   99 (458)
Q Consensus        22 ~~~~~~~~~~~~~~~~~~l~~~~V~aiIG~~~~~s~--~~~~~~~~i~~~~~iP~Is~~a~~~~ls~~~~~p~~~r~~p~   99 (458)
                      +...+.++.+.+..+|++|++..|.||+-+++.+|+  ....+++..++.++||++.....+..+++|+-++.|+|++|+
T Consensus        73 sv~~d~n~i~t~~~VC~~li~~~vyav~vSh~~Ts~d~f~p~~vSYT~gFY~iPV~G~~~Rda~fSdKnIh~sFlRtvpP  152 (993)
T KOG4440|consen   73 SVTHDPNAIQTALSVCEDLISSQVYAVLVSHPPTSNDHFTPTPVSYTAGFYRIPVLGLTTRDAIFSDKNIHLSFLRTVPP  152 (993)
T ss_pred             cccCCCcHHHHHHHHHHHHHhhheeEEEecCCCCCCcccccccceeeccceeeeeeeeeehhhhhccCceeeeEeecCCC
Confidence            545678899999999999999999999988787764  235678889999999999999999999999999999999999


Q ss_pred             chhHHHHHHHHHHhcCCeEEEEEEecCcchhHHHHHHHHhhhccCCcceeeEEEEEEEEeCCCcccHHHHHHHHHhccCe
Q psy17441        100 YSHQADVWVELLKHFNYMKVIFIHSSDTDGRALLGRFQTTSQNQEDDVEIKVQVEAVIEFEPGLTTFKDQLYEMKNAQAR  179 (458)
Q Consensus       100 ~~~~~~ai~~ll~~~~w~~v~ii~~~d~~g~~~~~~l~~~l~~~gi~v~~~~~v~~~~~~~~~~~d~~~~l~~ik~~~~~  179 (458)
                      ..+|+.+..+.+.+|.|++|.++.++|..|+....+++..+++..      .+...+..++++..++...|-++|...+|
T Consensus       153 yshqa~VwleMl~~~~y~~vi~l~s~d~~gra~~~r~qt~~e~~~------~~~e~v~~f~p~~~~~t~~l~~~k~~~~r  226 (993)
T KOG4440|consen  153 YSHQASVWLEMLRVYSYNHVILLVSDDHEGRAAQKRLQTLLEERE------SKAEKVLQFDPGTKNVTALLMEAKELEAR  226 (993)
T ss_pred             ccchhHHHHHHHHHhhcceEEEEEcccccchhHHhHHHHHHHHHh------hhhhhheecCcccchHHHHHhhhhhhhhe
Confidence            999999999999999999999999999889888778887777532      34555677888889999999999999999


Q ss_pred             EEEEEeChhhHHHHHHHHHhcCCcccceEEEeeccccccCCCCCeeEEEEecCCCchhHHHHHHHHHHHHHHHHHhhcCc
Q psy17441        180 VYLMYASKQDAEIIFKDAQYLNMTETGYVWIVTEQALTAKNVPVGIIGLKLVNATNEDAHIRDSIYVLTSALKEMNQSAV  259 (458)
Q Consensus       180 viil~~~~~~~~~il~~a~~~g~~~~~~~wi~t~~~~~~~~~~~g~~g~~~~~~~~~~~~~yDAv~~la~Al~~~~~~~~  259 (458)
                      |+++....++|..+++.|.+++|+|++|+||+++.-......+.|++|.++-+.....+...|+|.++|.|+++++++.+
T Consensus       227 v~~~~as~dDA~~ifr~Ag~lnmTG~G~VWiV~E~a~~~nn~PdG~LGlqL~~~~~~~~hirDsv~vlasAv~e~~~~e~  306 (993)
T KOG4440|consen  227 VIILSASEDDAATIFRAAGMLNMTGSGYVWIVGERAISGNNLPDGILGLQLINGKNESAHIRDSVGVLASAVHELLEKEN  306 (993)
T ss_pred             eEEeecccchHHHHHHhhhhhcccCceEEEEEeccccccCCCCCceeeeEeecCccccceehhhHHHHHHHHHHHHhhcc
Confidence            99999999999999999999999999999999999888888899999999999888999999999999999999999888


Q ss_pred             ccCCCcccCCCC-------------------------------------------------------------------c
Q psy17441        260 ITEAPQDCDNSG-------------------------------------------------------------------S  272 (458)
Q Consensus       260 ~~~~~~~c~~~~-------------------------------------------------------------------~  272 (458)
                      |+.+|..|.|++                                                                   .
T Consensus       307 I~~~P~~c~d~~~~w~~g~~l~~~l~s~~~~~g~TgrV~Fnd~gdRi~a~YdiiN~hq~rk~Vg~~~yd~~r~~~nd~~I  386 (993)
T KOG4440|consen  307 ITDPPRGCVDNTNIWKTGPLLKRVLMSSKYADGVTGRVEFNDDGDRIFANYDIINLHQNRKLVGVGIYDGTRVIPNDRKI  386 (993)
T ss_pred             CCCCCCcccCccchhcccHHHHHHHhhhcccCCcceeEEEcCCCceeeccceeEehhhhhhhhhhccccceeeccCCcee
Confidence            887776555432                                                                   3


Q ss_pred             ccccC---------------------------------------------------------------------------
Q psy17441        273 IWETG---------------------------------------------------------------------------  277 (458)
Q Consensus       273 ~W~~g---------------------------------------------------------------------------  277 (458)
                      .|+||                                                                           
T Consensus       387 iWpGg~~~KP~gi~~pthLrivTi~~~PFVYv~p~~sd~~c~eef~~~~d~~~k~~c~gpn~s~p~s~~~t~~fCC~G~c  466 (993)
T KOG4440|consen  387 IWPGGETEKPRGIQMPTHLRIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDSSPGSPRHTVPFCCYGFC  466 (993)
T ss_pred             ecCCCCcCCCccccccceeEEEEeccCCeEEEecCCCCcchhhhccccCCcccceeecCCCCCCCCCcccCcchhhhHHH
Confidence            46555                                                                           


Q ss_pred             --------------------------------------------------------------------------------
Q psy17441        278 --------------------------------------------------------------------------------  277 (458)
Q Consensus       278 --------------------------------------------------------------------------------  277 (458)
                                                                                                      
T Consensus       467 IDLLi~Ls~~~Nftyd~~l~~dg~fg~~~~vnnsseT~~kew~G~iGEL~~~~ADMivaplTINpERa~yieFskPfkYq  546 (993)
T KOG4440|consen  467 IDLLIKLSRTMNFTYDVHLVADGKFGTQERVNNSSETNKKEWNGMIGELLSGQADMIVAPLTINPERAQYIEFSKPFKYQ  546 (993)
T ss_pred             HHHHHHHHHhhcceEEEEEeecccccceeeeecccccccceehhhhhhhhCCccceEeeceeeChhhhhheeccCccccc
Confidence                                                                                            


Q ss_pred             -------CccCCCCcceeeecCChhHHHHHHHHHHHHHHHHHHHhhcCCCCCCCCCCCCCccccccccchhHHHHHHHhh
Q psy17441        278 -------KPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPFGRFRLSNSDNTEEDALNLSSAIWFAWGVLL  350 (458)
Q Consensus       278 -------~~~~~~~~~~fl~pf~~~vW~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~~l~  350 (458)
                             |+.+.+.+-+||+||+..+|+++++++.++++++++++|+|||++......++++....+++.++||+|+.|+
T Consensus       547 GitILeKk~~r~Stl~SFlQPfqstLW~lv~~SVhvVal~lYlLDrfSPFgRFk~~ds~~~ee~alnlssAmWF~WGVLL  626 (993)
T KOG4440|consen  547 GITILEKKEIRRSTLDSFLQPFQSTLWLLVGLSVHVVALMLYLLDRFSPFGRFKVNDSEEEEEDALNLSSAMWFSWGVLL  626 (993)
T ss_pred             ceEEEeeCCCCCchHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhcCcccceeeccCccchhhhcchhhhHHHHhHhhh
Confidence                   5567778899999999999999999999999999999999999988774455667778899999999999999


Q ss_pred             ccCCCCCCCCchhhHHHHHHHHHHHHHHHhhcccceeEEeeeccCCCCCCChhhhhhcCCCCceEEEEeCCChHHHHHhh
Q psy17441        351 NSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLERPKTKLTGINDARLRNTMENLTCATVKGSAVDMYFRR  430 (458)
Q Consensus       351 ~~g~~~~~p~s~~~Ri~~~~w~~~~~i~~~~yta~l~s~lt~~~~~~~i~~~~dL~~~~~~~~~~~g~~~~s~~~~~~~~  430 (458)
                      +.|.++..|||.|.|++.++|+-|++|++++|||||||||.+++.+..+++++|.++.++..++.++++++|++..||++
T Consensus       627 NSGigEgtPRSfSARvLGmVWaGFaMIiVASYTANLAAFLVLdrPe~~ltGinDpRLRNps~nf~~aTVk~SsVd~YFrR  706 (993)
T KOG4440|consen  627 NSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPEERLTGINDPRLRNPSDNFIYATVKQSSVDIYFRR  706 (993)
T ss_pred             ccccCCCCCcchhHHHHHHHHhhhheeeehhhhhhhhhheeecCccccccCCCCccccCcccceeEEEecCccHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chhhHHHHHHHHHcCCCCHHHHHHHhhC
Q psy17441        431 QVELSNMYRTMEANNYDTAEDAIADVKI  458 (458)
Q Consensus       431 ~~~~~~~~~~~~~~~~~~~~~gi~~v~~  458 (458)
                      +-++..||++|+.|++.+.+|+|+.|++
T Consensus       707 qVELS~MyR~ME~hNy~~A~eAiq~v~~  734 (993)
T KOG4440|consen  707 QVELSTMYRHMEKHNYESAAEAIQAVRD  734 (993)
T ss_pred             HhHHHHHHHhhhhcchhhHHHHHHHHHc
Confidence            9889999999999999999999999985

>KOG1054\|consensus	Back alignment and domain information

>KOG1053\|consensus	Back alignment and domain information

>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor	Back alignment and domain information

>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor	Back alignment and domain information

>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors	Back alignment and domain information

>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor	Back alignment and domain information

>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily	Back alignment and domain information

>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor	Back alignment and domain information

>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor	Back alignment and domain information

>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily	Back alignment and domain information

>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR)	Back alignment and domain information

>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor	Back alignment and domain information

>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family	Back alignment and domain information

>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor	Back alignment and domain information

>cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family	Back alignment and domain information

>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues	Back alignment and domain information

>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G	Back alignment and domain information

>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor	Back alignment and domain information

>cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor	Back alignment and domain information

>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family	Back alignment and domain information

>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases	Back alignment and domain information

>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure []	Back alignment and domain information

>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors	Back alignment and domain information

>KOG1056\|consensus	Back alignment and domain information

>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor	Back alignment and domain information

>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor	Back alignment and domain information

>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs)	Back alignment and domain information

>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor	Back alignment and domain information

>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family	Back alignment and domain information

>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor	Back alignment and domain information

>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor	Back alignment and domain information

>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA)	Back alignment and domain information

>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor	Back alignment and domain information

>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors	Back alignment and domain information

>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor	Back alignment and domain information

>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors	Back alignment and domain information

>KOG1052\|consensus	Back alignment and domain information

>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors	Back alignment and domain information

>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs)	Back alignment and domain information

>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family	Back alignment and domain information

>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2	Back alignment and domain information

>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors	Back alignment and domain information

>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine)	Back alignment and domain information

>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06344 PBP1_ABC_ligand_binding_like_9 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional	Back alignment and domain information

>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family	Back alignment and domain information

>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems	Back alignment and domain information

>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins	Back alignment and domain information

>cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins	Back alignment and domain information

>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF)	Back alignment and domain information

>COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism]	Back alignment and domain information

>cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway	Back alignment and domain information

>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF)	Back alignment and domain information

>cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria	Back alignment and domain information

>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems	Back alignment and domain information

>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene	Back alignment and domain information

>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type	Back alignment and domain information

>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein	Back alignment and domain information

>cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides	Back alignment and domain information

>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF)	Back alignment and domain information

>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes	Back alignment and domain information

>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A	Back alignment and domain information

>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family	Back alignment and domain information

>KOG1055\|consensus	Back alignment and domain information

>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins	Back alignment and domain information

>cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen	Back alignment and domain information

>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily	Back alignment and domain information

>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids	Back alignment and domain information

>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions	Back alignment and domain information

>TIGR03863 PQQ_ABC_bind ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory	Back alignment and domain information

>PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A	Back alignment and domain information

>cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C	Back alignment and domain information

>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily	Back alignment and domain information

>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems	Back alignment and domain information

>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily	Back alignment and domain information

>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily	Back alignment and domain information

>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily	Back alignment and domain information

>cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions	Back alignment and domain information

>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria []	Back alignment and domain information

>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown	Back alignment and domain information

>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis	Back alignment and domain information

>cd06309 PBP1_YtfQ_like Periplasmic binding domain of ABC-type YtfQ-like transport systems	Back alignment and domain information

>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>KOG1419\|consensus	Back alignment and domain information

>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs	Back alignment and domain information

>cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>KOG3713\|consensus	Back alignment and domain information

>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation	Back alignment and domain information

>cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>TIGR01481 ccpA catabolite control protein A	Back alignment and domain information

>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A	Back alignment and domain information

>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria	Back alignment and domain information

>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily	Back alignment and domain information

>cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines	Back alignment and domain information

>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria	Back alignment and domain information

>cd06303 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs	Back alignment and domain information

>cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>PRK10653 D-ribose transporter subunit RbsB; Provisional	Back alignment and domain information

>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors	Back alignment and domain information

>cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd06297 PBP1_LacI_like_12 Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs	Back alignment and domain information

>cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation	Back alignment and domain information

>cd06324 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems	Back alignment and domain information

>PRK11303 DNA-binding transcriptional regulator FruR; Provisional	Back alignment and domain information

>PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators	Back alignment and domain information

>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>COG1609 PurR Transcriptional regulators [Transcription]	Back alignment and domain information

>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd06279 PBP1_LacI_like_3 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily	Back alignment and domain information

>cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>PRK09526 lacI lac repressor; Reviewed	Back alignment and domain information

>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>PLN03192 Voltage-dependent potassium channel; Provisional	Back alignment and domain information

>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor	Back alignment and domain information

>cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>PRK10014 DNA-binding transcriptional repressor MalI; Provisional	Back alignment and domain information

>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli	Back alignment and domain information

>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs	Back alignment and domain information

>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia	Back alignment and domain information

>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only]	Back alignment and domain information

>cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism	Back alignment and domain information

>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR	Back alignment and domain information

>cd06306 PBP1_TorT-like TorT-like proteins, a periplasmic binding protein family that activates induction of the Tor respiratory system upon trimethylamine N-oxide (TMAO) electron-acceptor binding in bacteria	Back alignment and domain information

>PRK10703 DNA-binding transcriptional repressor PurR; Provisional	Back alignment and domain information

>PRK09492 treR trehalose repressor; Provisional	Back alignment and domain information

>cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs	Back alignment and domain information

>cd06316 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>PRK09701 D-allose transporter subunit; Provisional	Back alignment and domain information

>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>PRK10936 TMAO reductase system periplasmic protein TorT; Provisional	Back alignment and domain information

>KOG1545\|consensus	Back alignment and domain information

>cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>PRK10537 voltage-gated potassium channel; Provisional	Back alignment and domain information

>PRK14987 gluconate operon transcriptional regulator; Provisional	Back alignment and domain information

>cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>PRK10423 transcriptional repressor RbsR; Provisional	Back alignment and domain information

>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species	Back alignment and domain information

>cd06302 PBP1_LsrB_Quorum_Sensing Periplasmic binding domain of autoinducer-2 (AI-2) receptor LsrB from Salmonella typhimurium and its close homologs	Back alignment and domain information

>cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators	Back alignment and domain information

>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species	Back alignment and domain information

>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins	Back alignment and domain information

>TIGR02405 trehalos_R_Ecol trehalose operon repressor, proteobacterial	Back alignment and domain information

>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>cd06354 PBP1_BmpA_PnrA_like Periplasmic binding domain of basic membrane lipoprotein, PnrA, in Treponema pallidum and its homologs from other bacteria and Archaea	Back alignment and domain information

>TIGR02955 TMAO_TorT TMAO reductase system periplasmic protein TorT	Back alignment and domain information

>cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems	Back alignment and domain information

>PRK10727 DNA-binding transcriptional regulator GalR; Provisional	Back alignment and domain information

>KOG4390\|consensus	Back alignment and domain information

>cd06304 PBP1_BmpA_like Periplasmic binding component of a family of basic membrane lipoproteins from Borrelia and various putative lipoproteins from other bacteria	Back alignment and domain information

>cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily	Back alignment and domain information

>cd06307 PBP1_uncharacterized_sugar_binding Periplasmic sugar-binding domain of uncharacterized transport systems	Back alignment and domain information

>cd06314 PBP1_tmGBP Periplasmic sugar-binding domain of Thermotoga maritima glucose-binding protein (tmGBP) and its close homologs	Back alignment and domain information

>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR)	Back alignment and domain information

>PRK15408 autoinducer 2-binding protein lsrB; Provisional	Back alignment and domain information

>cd06287 PBP1_LacI_like_8 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors	Back alignment and domain information

>TIGR02990 ectoine_eutA ectoine utilization protein EutA	Back alignment and domain information

>PRK10401 DNA-binding transcriptional regulator GalS; Provisional	Back alignment and domain information

>COG1879 RbsB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd01544 PBP1_GalR Ligand-binding domain of DNA transcription repressor GalR which is one of two regulatory proteins involved in galactose transport and metabolism	Back alignment and domain information

>PRK11041 DNA-binding transcriptional regulator CytR; Provisional	Back alignment and domain information

>KOG3684\|consensus	Back alignment and domain information

>PF13377 Peripla_BP_3: Periplasmic binding protein-like domain; PDB: 3K9C_B 3BIL_B 3JVD_B 1ZAY_A 1VPW_A 1DBQ_A 2PUA_A 1QQA_A 1PNR_A 1JHZ_A	Back alignment and domain information

>COG3473 Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli	Back alignment and domain information

>PRK10339 DNA-binding transcriptional repressor EbgR; Provisional	Back alignment and domain information

>KOG1418\|consensus	Back alignment and domain information

>PRK10355 xylF D-xylose transporter subunit XylF; Provisional	Back alignment and domain information

>KOG0498\|consensus	Back alignment and domain information

>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins	Back alignment and domain information

>cd06353 PBP1_BmpA_Med_like Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea	Back alignment and domain information

>cd06315 PBP1_ABC_sugar_binding_like_6 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems	Back alignment and domain information

>TIGR02634 xylF D-xylose ABC transporter, substrate-binding protein	Back alignment and domain information

>TIGR00035 asp_race aspartate racemase	Back alignment and domain information

>TIGR02637 RhaS rhamnose ABC transporter, rhamnose-binding protein	Back alignment and domain information

>COG3107 LppC Putative lipoprotein [General function prediction only]	Back alignment and domain information

>PRK10200 putative racemase; Provisional	Back alignment and domain information

>PF06506 PrpR_N: Propionate catabolism activator; InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []	Back alignment and domain information

Homologous Structure Templates