Psyllid ID: psy17477
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 108 | ||||||
| 380028436 | 722 | PREDICTED: tyrosine-protein kinase Btk29 | 0.5 | 0.074 | 0.610 | 7e-13 | |
| 328780764 | 694 | PREDICTED: tyrosine-protein kinase Btk29 | 0.5 | 0.077 | 0.610 | 7e-13 | |
| 350423617 | 248 | PREDICTED: tyrosine-protein kinase Btk29 | 0.5 | 0.217 | 0.610 | 1e-12 | |
| 340727645 | 691 | PREDICTED: tyrosine-protein kinase Btk29 | 0.5 | 0.078 | 0.610 | 2e-12 | |
| 383849754 | 711 | PREDICTED: tyrosine-protein kinase Btk29 | 0.490 | 0.074 | 0.603 | 4e-12 | |
| 328721408 | 678 | PREDICTED: tyrosine-protein kinase Btk29 | 0.620 | 0.098 | 0.554 | 4e-12 | |
| 345487249 | 711 | PREDICTED: tyrosine-protein kinase Btk29 | 0.490 | 0.074 | 0.603 | 4e-12 | |
| 328721410 | 658 | PREDICTED: tyrosine-protein kinase Btk29 | 0.490 | 0.080 | 0.636 | 8e-12 | |
| 307183121 | 424 | Tyrosine-protein kinase Btk29A [Camponot | 0.490 | 0.125 | 0.620 | 9e-12 | |
| 307206151 | 454 | Tyrosine-protein kinase Btk29A [Harpegna | 0.490 | 0.116 | 0.603 | 1e-11 |
| >gi|380028436|ref|XP_003697908.1| PREDICTED: tyrosine-protein kinase Btk29A-like [Apis florea] | Back alignment and taxonomy information |
|---|
Score = 77.8 bits (190), Expect = 7e-13, Method: Composition-based stats.
Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 5/59 (8%)
Query: 30 GMANKDDLI---SDDILRQGFLIKRSQNKKRFSTSNNNYKQRWFVLTTKHLIYYDTDSE 85
GMA KD + S D++RQGF++KRSQNKKRF+ NYKQRWFVLT ++L+YYD D E
Sbjct: 7 GMAGKDGKVEPKSGDVVRQGFMVKRSQNKKRFTPV--NYKQRWFVLTRRYLVYYDGDGE 63
|
Source: Apis florea Species: Apis florea Genus: Apis Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328780764|ref|XP_394126.4| PREDICTED: tyrosine-protein kinase Btk29A-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350423617|ref|XP_003493537.1| PREDICTED: tyrosine-protein kinase Btk29A-like, partial [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340727645|ref|XP_003402150.1| PREDICTED: tyrosine-protein kinase Btk29A-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383849754|ref|XP_003700502.1| PREDICTED: tyrosine-protein kinase Btk29A-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|328721408|ref|XP_003247295.1| PREDICTED: tyrosine-protein kinase Btk29A-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|345487249|ref|XP_003425657.1| PREDICTED: tyrosine-protein kinase Btk29A-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|328721410|ref|XP_001945897.2| PREDICTED: tyrosine-protein kinase Btk29A-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307183121|gb|EFN70038.1| Tyrosine-protein kinase Btk29A [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|307206151|gb|EFN84231.1| Tyrosine-protein kinase Btk29A [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 108 | ||||||
| FB|FBgn0003502 | 786 | Btk29A "Btk family kinase at 2 | 0.537 | 0.073 | 0.408 | 1.6e-06 | |
| UNIPROTKB|F8W6X8 | 802 | RASA3 "cDNA FLJ58396" [Homo sa | 0.712 | 0.096 | 0.341 | 4.4e-06 | |
| UNIPROTKB|Q14644 | 834 | RASA3 "Ras GTPase-activating p | 0.712 | 0.092 | 0.341 | 4.7e-06 | |
| UNIPROTKB|E2QUY1 | 834 | RASA3 "Uncharacterized protein | 0.712 | 0.092 | 0.341 | 7.6e-06 | |
| ZFIN|ZDB-GENE-090313-21 | 833 | rasa3 "RAS p21 protein activat | 0.712 | 0.092 | 0.341 | 9.8e-06 | |
| MGI|MGI:1197013 | 834 | Rasa3 "RAS p21 protein activat | 0.712 | 0.092 | 0.341 | 1.2e-05 | |
| RGD|69365 | 834 | Rasa3 "RAS p21 protein activat | 0.712 | 0.092 | 0.341 | 1.2e-05 | |
| UNIPROTKB|F1LSI5 | 834 | Rasa3 "Ras GTPase-activating p | 0.712 | 0.092 | 0.341 | 1.2e-05 | |
| UNIPROTKB|F1P4A4 | 835 | RASA3 "Uncharacterized protein | 0.712 | 0.092 | 0.341 | 1.3e-05 | |
| UNIPROTKB|A5D7I7 | 834 | RASA3 "Ras GTPase-activating p | 0.712 | 0.092 | 0.341 | 2e-05 |
| FB|FBgn0003502 Btk29A "Btk family kinase at 29A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 122 (48.0 bits), Expect = 1.6e-06, P = 1.6e-06
Identities = 29/71 (40%), Positives = 43/71 (60%)
Query: 34 KDDLISD---DILRQGFLIKRSQNKKRFSTSNNNYKQRWFVLTTKHLIYYDTDS------ 84
K DL+S+ D+++ G ++KR+QNKKRF+ N YK RWF LT + Y+D ++
Sbjct: 31 KMDLMSERLYDVVKSGSMVKRAQNKKRFTPVN--YKHRWFELTKRTFSYFDVENVERRRE 88
Query: 85 --EIFLSGIRL 93
I L G+RL
Sbjct: 89 RGRIHLKGVRL 99
|
|
| UNIPROTKB|F8W6X8 RASA3 "cDNA FLJ58396" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14644 RASA3 "Ras GTPase-activating protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QUY1 RASA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-090313-21 rasa3 "RAS p21 protein activator 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1197013 Rasa3 "RAS p21 protein activator 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|69365 Rasa3 "RAS p21 protein activator 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LSI5 Rasa3 "Ras GTPase-activating protein 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P4A4 RASA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5D7I7 RASA3 "Ras GTPase-activating protein 3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 108 | |||
| cd01238 | 140 | cd01238, PH_Btk, Bruton's tyrosine kinase pleckstr | 3e-17 | |
| cd13255 | 110 | cd13255, PH_TAAP2-like, Tandem PH-domain-containin | 1e-08 | |
| cd13371 | 125 | cd13371, PH_GAP1_mammal-like, GAP1(IP4BP) pleckstr | 7e-08 | |
| cd01244 | 107 | cd01244, PH_GAP1-like, RAS p21 protein activator ( | 1e-07 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 2e-07 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 4e-07 | |
| cd13277 | 111 | cd13277, PH_Bem3, Bud emergence protein 3 (Bem3) P | 2e-06 | |
| cd13296 | 111 | cd13296, PH2_MyoX, Myosin X Pleckstrin homology (P | 3e-06 | |
| cd13273 | 110 | cd13273, PH_SWAP-70, Switch-associated protein-70 | 1e-05 | |
| cd01235 | 106 | cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (als | 4e-05 | |
| cd13288 | 120 | cd13288, PH_Ses, Sesquipedalian family Pleckstrin | 7e-05 | |
| cd13370 | 133 | cd13370, PH_GAP1m_mammal-like, GTPase activating p | 1e-04 | |
| cd13298 | 106 | cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin | 1e-04 | |
| cd13301 | 108 | cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin | 2e-04 | |
| cd00821 | 92 | cd00821, PH, Pleckstrin homology (PH) domain | 2e-04 | |
| cd10573 | 96 | cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosin | 2e-04 | |
| cd01252 | 118 | cd01252, PH_GRP1-like, General Receptor for Phosph | 3e-04 | |
| cd13250 | 98 | cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin | 4e-04 | |
| cd13378 | 116 | cd13378, PH_RhoGAP2, Rho GTPase activating protein | 4e-04 | |
| cd13248 | 104 | cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate | 0.001 | |
| cd13263 | 114 | cd13263, PH_RhoGap25-like, Rho GTPase activating p | 0.001 | |
| cd13261 | 136 | cd13261, PH_RasGRF1_2, Ras-specific guanine nucleo | 0.002 | |
| cd13380 | 106 | cd13380, PH_Skap1, Src kinase-associated phosphopr | 0.002 | |
| cd13276 | 117 | cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin | 0.003 | |
| cd13266 | 106 | cd13266, PH_Skap_family, Src kinase-associated pho | 0.003 |
| >gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
Score = 71.5 bits (176), Expect = 3e-17
Identities = 27/57 (47%), Positives = 33/57 (57%), Gaps = 10/57 (17%)
Query: 44 RQGFLIKRSQNKKRFSTSNNNYKQRWFVLTTKHLIYYDTDSE--------IFLSGIR 92
++G L+KRSQ KKRF N YK+RWFVLT L YY+ D I LS I+
Sbjct: 1 KEGLLVKRSQGKKRFGPVN--YKERWFVLTKSSLSYYEGDGGKRGKEKGSIDLSKIK 55
|
Btk is a member of the Tec family of cytoplasmic protein tyrosine kinases that includes BMX, IL2-inducible T-cell kinase (Itk) and Tec. Btk plays a role in the maturation of B cells. Tec proteins general have an N-terminal PH domain, followed by a Tek homology (TH) domain, a SH3 domain, a SH2 domain and a kinase domain. The Btk PH domain binds phosphatidylinositol 3,4,5-trisphosphate and responds to signalling via phosphatidylinositol 3-kinase. The PH domain is also involved in membrane anchoring which is confirmed by the discovery of a mutation of a critical arginine residue in the BTK PH domain. This results in severe human immunodeficiency known as X-linked agammaglobulinemia (XLA) in humans and a related disorder is mice.PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 140 |
| >gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241522 cd13371, PH_GAP1_mammal-like, GAP1(IP4BP) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241277 cd01244, PH_GAP1-like, RAS p21 protein activator (GTPase activating protein) family pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|241431 cd13277, PH_Bem3, Bud emergence protein 3 (Bem3) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human MTMR5) Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241521 cd13370, PH_GAP1m_mammal-like, GTPase activating protein 1 m pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH) domain, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and 3-Phosphoinositides Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for Phosphoinositides-1-like Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH domains Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins 1, 2, and 3 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and related proteins Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241415 cd13261, PH_RasGRF1_2, Ras-specific guanine nucleotide-releasing factors 1 and 2 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241531 cd13380, PH_Skap1, Src kinase-associated phosphoprotein 1 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1 (AtPH1) PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|241420 cd13266, PH_Skap_family, Src kinase-associated phosphoprotein family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 108 | |||
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 99.65 | |
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 99.35 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 99.34 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 99.28 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 99.22 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 99.21 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 99.11 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 99.05 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 99.05 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 99.02 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 99.0 | |
| KOG2059|consensus | 800 | 99.0 | ||
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 98.99 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 98.98 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 98.95 | |
| cd05134 | 310 | RasGAP_RASA3 RASA3 (or GAP1_IP4BP) is a member of | 98.93 | |
| cd05394 | 313 | RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the | 98.92 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 98.88 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 98.79 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 98.78 | |
| KOG0930|consensus | 395 | 98.72 | ||
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 98.69 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 98.67 | |
| cd05128 | 315 | RasGAP_GAP1_like The GAP1 family of Ras GTPase-act | 98.63 | |
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 98.45 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 98.44 | |
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 98.44 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 98.27 | |
| cd05135 | 333 | RasGAP_RASAL Ras GTPase activating-like protein (R | 98.18 | |
| KOG1090|consensus | 1732 | 98.13 | ||
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 97.96 | |
| cd05395 | 337 | RasGAP_RASA4 Ras GTPase activating-like 4 protein | 97.89 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 97.88 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 97.88 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 97.84 | |
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 97.63 | |
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 97.18 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 97.06 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 97.04 | |
| cd01259 | 114 | PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor pr | 96.73 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 96.03 | |
| KOG0690|consensus | 516 | 95.87 | ||
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 95.52 | |
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 95.13 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 94.53 | |
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 93.84 | |
| PLN00188 | 719 | enhanced disease resistance protein (EDR2); Provis | 93.61 | |
| KOG3751|consensus | 622 | 93.53 | ||
| KOG0248|consensus | 936 | 92.37 | ||
| KOG1739|consensus | 611 | 92.2 | ||
| KOG1737|consensus | 799 | 91.97 | ||
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 91.41 | |
| cd01240 | 116 | PH_beta-ARK Beta adrenergic receptor kinase 1(beta | 91.12 | |
| PLN02866 | 1068 | phospholipase D | 90.87 | |
| KOG3640|consensus | 1116 | 89.51 | ||
| cd01262 | 89 | PH_PDK1 3-Phosphoinositide dependent protein kinas | 86.47 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 80.82 | |
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 80.36 |
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
Probab=99.65 E-value=1.6e-16 Score=109.27 Aligned_cols=53 Identities=40% Similarity=0.473 Sum_probs=46.8
Q ss_pred eeeeeeEeecCCccccccCCCCceeEEEEeCCCceeeeecCCcc-cccceEEecCC
Q psy17477 43 LRQGFLIKRSQNKKRFSTSNNNYKQRWFVLTTKHLIYYDTDSEI-FLSGIRLSDLP 97 (108)
Q Consensus 43 lkeG~L~Krg~~~k~~~~~~~nwK~RwFVLt~~~LsYYk~~~ek-~~~kG~I~~l~ 97 (108)
||+|+|+||+++++++++ +|||+|||||++..|+||+++.+. ..++|+|++-.
T Consensus 1 ~k~g~l~Kr~~~~~~~~~--~nwKkRwFvL~~~~L~Yyk~~~~~~~~~kG~I~L~~ 54 (106)
T cd01238 1 ILESILVKRSQQKKKTSP--LNYKERLFVLTKSKLSYYEGDFEKRGSKKGSIDLSK 54 (106)
T ss_pred CcceeeeeeccCCCCCCC--CCceeEEEEEcCCEEEEECCCcccccCcceeEECCc
Confidence 689999999999999999 999999999999999999988763 34589987654
|
Tec pleckstrin homology (PH) domain. Proteins in the Tec family of cytoplasmic protein tyrosine kinases that includes Bruton's tyrosine kinase (BTK), BMX, IL2-inducible T-cell kinase (Itk) and Tec. These proteins generally have an N-terminal PH domain, followed by a Tek homology (TH) domain, a SH3 domain, a SH2 domain and a kinase domain. Tec PH domains tether these proteins to membranes following the activation of PI3K and its subsequent phosphorylation of phosphoinositides. The importance of PH domain membrane anchoring is confirmed by the discovery of a mutation of a critical arginine residue in the BTK PH domain, which causes X-linked agammaglobulinemia (XLA) in humans and a related disorder is mice. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few dis |
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd05134 RasGAP_RASA3 RASA3 (or GAP1_IP4BP) is a member of the GAP1 family and has been shown to specifically bind 1,3,4,5-tetrakisphosphate (IP4) | Back alignment and domain information |
|---|
| >cd05394 RasGAP_RASA2 RASA2 (or GAP1(m)) is a member of the GAP1 family of Ras GTPase-activating proteins that includes GAP1_IP4BP (or RASA3), CAPRI, and RASAL | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >KOG0930|consensus | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd05128 RasGAP_GAP1_like The GAP1 family of Ras GTPase-activating proteins includes GAP1(m) (or RASA2), GAP1_IP4BP (or RASA3), Ca2+ -promoted Ras inactivator (CAPRI, or RASAL4), and Ras GTPase activating-like proteins (RASAL) or RASAL1 | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd05135 RasGAP_RASAL Ras GTPase activating-like protein (RASAL) or RASAL1 is a member of the GAP1 family, and a Ca2+ sensor responding in-phase to repetitive Ca2+ signals by associating with the plasma membrane and deactivating Ras | Back alignment and domain information |
|---|
| >KOG1090|consensus | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd05395 RasGAP_RASA4 Ras GTPase activating-like 4 protein (RASAL4), also known as Ca2+ -promoted Ras inactivator (CAPRI), is a member of the GAP1 family | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01259 PH_Apbb1ip Apbb1ip (Amyloid beta (A4) Precursor protein-Binding, family B, member 1 Interacting Protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >PLN00188 enhanced disease resistance protein (EDR2); Provisional | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >KOG0248|consensus | Back alignment and domain information |
|---|
| >KOG1739|consensus | Back alignment and domain information |
|---|
| >KOG1737|consensus | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PLN02866 phospholipase D | Back alignment and domain information |
|---|
| >KOG3640|consensus | Back alignment and domain information |
|---|
| >cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 108 | ||||
| 2lul_A | 164 | Solution Nmr Structure Of Ph Domain Of Tyrosine-Pro | 7e-04 |
| >pdb|2LUL|A Chain A, Solution Nmr Structure Of Ph Domain Of Tyrosine-Protein Kinase Tec From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr3504c Length = 164 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 108 | |||
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 5e-14 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 5e-14 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 1e-10 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 1e-09 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 1e-09 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 1e-09 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 1e-09 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 2e-09 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 2e-09 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 4e-09 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 4e-09 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 6e-09 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 1e-08 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 1e-08 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 2e-08 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 3e-08 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 5e-08 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 6e-08 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 7e-08 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 8e-08 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 9e-08 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 2e-07 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 4e-07 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 6e-07 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 1e-06 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 2e-06 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 2e-06 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 2e-06 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 2e-06 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 3e-06 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 3e-06 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 8e-06 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 9e-06 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 1e-05 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 1e-05 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 1e-05 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 8e-05 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 9e-05 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 2e-04 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 3e-04 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 3e-04 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 3e-04 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 3e-04 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 4e-04 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 5e-04 |
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Length = 169 | Back alignment and structure |
|---|
Score = 63.4 bits (153), Expect = 5e-14
Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 2/45 (4%)
Query: 41 DILRQGFLIKRSQNKKRFSTSNNNYKQRWFVLTTKHLIYYDTDSE 85
++ + +KRSQ KK+ S N +K+ F+LT L YY+ D E
Sbjct: 2 AVILESIFLKRSQQKKKTSPLN--FKKCLFLLTVHKLSYYEYDFE 44
|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 118 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Length = 125 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Length = 228 | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 113 | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Length = 108 | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 115 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Length = 129 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 109 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Length = 109 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Length = 126 | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 129 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Length = 148 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Length = 117 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Length = 127 | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Length = 120 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Length = 211 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Length = 123 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 130 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 149 | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 150 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Length = 125 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Length = 125 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Length = 168 | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 107 | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Length = 126 | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Length = 279 | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Length = 126 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Length = 129 | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Length = 263 | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 108 | |||
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 99.67 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 99.54 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 99.38 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 99.34 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 99.34 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 99.33 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 99.33 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 99.32 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 99.31 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 99.31 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 99.3 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 99.3 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 99.29 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 99.28 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 99.28 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 99.28 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 99.28 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 99.27 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 99.26 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 99.25 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 99.23 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 99.23 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 99.23 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 99.23 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 99.23 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 99.23 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 99.22 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 99.22 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 99.22 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 99.22 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 99.22 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 99.21 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.2 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 99.2 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.2 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 99.17 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 99.13 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 99.09 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 99.09 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 99.08 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 99.07 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 99.05 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.02 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 99.0 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 98.98 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 98.96 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 98.95 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 98.89 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 98.87 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 98.86 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 98.86 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 98.82 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 98.82 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 98.8 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 98.77 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 98.75 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 98.69 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 98.6 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 98.5 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 98.45 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 98.42 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 98.34 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 98.16 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 98.05 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 97.92 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 97.82 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 97.78 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 97.76 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 97.72 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 97.65 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 97.63 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 97.2 | |
| 3zvr_A | 772 | Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito | 95.2 | |
| 3ml4_A | 224 | Protein DOK-7; tyrosine phosphorylation, adapter p | 92.64 |
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.67 E-value=1e-16 Score=115.28 Aligned_cols=59 Identities=36% Similarity=0.422 Sum_probs=51.7
Q ss_pred CCcccceeeeeeeEeecCCccccccCCCCceeEEEEeCCCceeeeecCCcccccceEEecC
Q psy17477 36 DLISDDILRQGFLIKRSQNKKRFSTSNNNYKQRWFVLTTKHLIYYDTDSEIFLSGIRLSDL 96 (108)
Q Consensus 36 ~~~~~~vlkeG~L~Krg~~~k~~~~~~~nwK~RwFVLt~~~LsYYk~~~ek~~~kG~I~~l 96 (108)
..|..++|+||+|+|||++++++++ +|||+|||||++..|+||+++.+...++|.|++-
T Consensus 9 ~~m~~~~i~EG~L~Kr~~~kk~~~~--knWKkRwFVL~~~~L~Yyk~~~~~~~~~G~I~L~ 67 (164)
T 2lul_A 9 SHMNFNTILEEILIKRSQQKKKTSP--LNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVS 67 (164)
T ss_dssp CCCCSSEEEEEEEEEECCCCSSSCC--CCEEEEEEEEESSEEEEECCCSSSCCCCCEEEGG
T ss_pred ccCCCCeeEEEEEEEecCCCCCCCC--CCceeEEEEEECCEEEEEeccCcccccccEEEEe
Confidence 3568999999999999999999999 9999999999999999999876554457888763
|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A | Back alignment and structure |
|---|
| >3ml4_A Protein DOK-7; tyrosine phosphorylation, adapter protein, dimerization, SIG protein; HET: PTR; 2.60A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 108 | ||||
| d1btka_ | 169 | b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Hom | 6e-12 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 8e-08 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 8e-07 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 2e-06 | |
| d1v89a_ | 118 | b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KI | 6e-06 | |
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 1e-05 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 1e-05 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 2e-05 | |
| d1u5fa1 | 111 | b.55.1.1 (A:109-219) Src-associated adaptor protei | 2e-05 | |
| d1plsa_ | 113 | b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [Ta | 3e-05 | |
| d2coda1 | 102 | b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo | 3e-05 | |
| d1v88a_ | 130 | b.55.1.1 (A:) Oxysterol binding protein-related pr | 5e-05 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 5e-05 | |
| d1v5ua_ | 117 | b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (M | 6e-05 | |
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 9e-05 | |
| d1wg7a_ | 150 | b.55.1.1 (A:) Dedicator of cytokinesis protein 9, | 2e-04 | |
| d1unqa_ | 118 | b.55.1.1 (A:) Rac-alpha serine/threonine kinase {H | 3e-04 | |
| d2dyna_ | 111 | b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId | 4e-04 | |
| d1omwa2 | 119 | b.55.1.1 (A:550-668) G-protein coupled receptor ki | 5e-04 | |
| d2elba2 | 101 | b.55.1.1 (A:274-374) DCC-interacting protein 13-al | 0.003 | |
| d1wi1a_ | 126 | b.55.1.1 (A:) Calcium-dependent activator protein | 0.003 | |
| d2j59m1 | 133 | b.55.1.1 (M:931-1063) Rho GTPase-activating protei | 0.004 |
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: Bruton's tyrosine kinase species: Human (Homo sapiens) [TaxId: 9606]
Score = 56.4 bits (135), Expect = 6e-12
Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 2/44 (4%)
Query: 42 ILRQGFLIKRSQNKKRFSTSNNNYKQRWFVLTTKHLIYYDTDSE 85
++ + +KRSQ KK+ S N+K+ F+LT L YY+ D E
Sbjct: 3 VILESIFLKRSQQKKKTSPL--NFKKCLFLLTVHKLSYYEYDFE 44
|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 117 | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Length = 119 | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Length = 126 | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 108 | |||
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 99.47 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 99.47 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.29 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 99.29 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 99.28 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.27 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 99.25 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 99.25 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 99.25 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.18 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 99.17 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 99.15 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 99.15 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 99.15 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 99.13 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 99.12 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 99.12 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 99.12 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 99.08 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 99.07 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 99.06 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 99.05 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 99.04 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 98.98 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 98.9 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 98.9 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 98.85 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 98.8 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 98.8 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 98.8 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 98.76 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 98.7 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 98.68 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 98.67 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 98.62 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 96.53 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 96.33 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 95.8 |
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: Protein kinase c, d2 type species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.47 E-value=3e-14 Score=93.98 Aligned_cols=46 Identities=15% Similarity=0.265 Sum_probs=40.5
Q ss_pred eeeeeeEeecCCccccccCCCCceeEEEEeCCCceeeeecCCcccccceEEecC
Q psy17477 43 LRQGFLIKRSQNKKRFSTSNNNYKQRWFVLTTKHLIYYDTDSEIFLSGIRLSDL 96 (108)
Q Consensus 43 lkeG~L~Krg~~~k~~~~~~~nwK~RwFVLt~~~LsYYk~~~ek~~~kG~I~~l 96 (108)
||+|||.|+|... ++||+|||||+++.|+||+++.+.. ++|.|++-
T Consensus 2 lk~GwL~k~~~~~-------~~wkkRwFvL~~~~L~YYk~~~~~~-p~g~I~L~ 47 (112)
T d2coaa1 2 LREGWVVHYSNKD-------TLRKRHYWRLDCKCITLFQNNTTNR-YYKEIPLS 47 (112)
T ss_dssp SEEEEEEECCSSS-------CCCEEEEEEECSSEEEEESSSSCSS-CSEEEETT
T ss_pred ceEEEEEEECCCC-------CCeeEEEEEEEcceEEEEeccCCCc-cceEEeee
Confidence 7999999999876 5999999999999999999987664 48998864
|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|