Psyllid ID: psy1750


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210----
MDESISNGNNGDLNSFEIVDKADVEENPVIPDKPEEEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRLDFGVKRKHRGNWFYSRGDNSFAVQCYRRSLDFLDSSNMDTNNASRSS
ccccccccccccccccEEccccccccccccccccccccccEEEEEEccccEEEEEEEccccccccccccEEEEEEEEEEccccEEEccccEEEEccccccccHHHHHHcccccccEEEEEEccccccccccccccccccccEEEEEEEEEEEEcccccccccHHHHHHHHHHHHHHcHHHHccccHHHHHHHHHHHHHHHcccccccccccccc
ccccccccccccccccccccHccccccccccccccEEEEEEEEEEcccccEEEEEEEccccccccccccEEEEEEEEEEccccEEcccccEEEEEccccHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccEEEEEEEEEEccccccHHcccHHHHHHHHHHHHHcccHEEcccHHHHHHHHHHHHHHHHHccccccHHHHHcc
mdesisngnngdlnsfeivdkadveenpvipdkpeeevEDEWVDILgsghikkkitkhgepdtrpqrgdlcvisgfgkleddtlvetfdnleicvgdlelvhgmdyVLPLMEMGEECQIEITArfgygdkgepsksippgakLYYSLTLhsvlpdfdlaelpvekrldfgvkrkhrgnwfysrgdnsfAVQCYRRSLdfldssnmdtnnasrss
mdesisngnngdlnsfeivdkadveenpvipdkpeeeveDEWVDILGSGHIKKKitkhgepdtrpqrgDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRldfgvkrkhrgnwfysrgdnsfAVQCYRRSLdfldssnmdtnnasrss
MDESISNGNNGDLNSFEIVDKADVEENPVIPDKPEEEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRLDFGVKRKHRGNWFYSRGDNSFAVQCYRRSLDFLDSSNMDTNNASRSS
****************************************EWVDILGSGHI****************GDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGD**********GAKLYYSLTLHSVLPDFDLAELPVEKRLDFGVKRKHRGNWFYSRGDNSFAVQCYRRSLDFL**************
**ES*******************************EEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRLDFGVKRKHRGNWFYSRGDNSFAVQCYRRSLDFLD*************
********NNGDLNSFEIVDKADVEENPVIPDKPEEEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRLDFGVKRKHRGNWFYSRGDNSFAVQCYRRSLDFLDSSN**********
***************FEIVD*A***ENPVIPDKPEEEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRLDFGVKRKHRGNWFYSRGDNSFAVQCYRRSLDFLDSSN**********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDESISNGNNGDLNSFEIVDKADVEENPVIPDKPEEEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRLDFGVKRKHRGNWFYSRGDNSFAVQCYRRSLDFLDSSNMDTNNASRSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query214 2.2.26 [Sep-21-2011]
Q14318 412 Peptidyl-prolyl cis-trans yes N/A 0.752 0.390 0.306 2e-17
Q3B7U9 403 Peptidyl-prolyl cis-trans yes N/A 0.752 0.399 0.296 3e-16
O35465 402 Peptidyl-prolyl cis-trans yes N/A 0.757 0.402 0.286 7e-15
Q9FJL3 578 Peptidyl-prolyl cis-trans yes N/A 0.799 0.295 0.243 9e-11
P26884224 Peptidyl-prolyl cis-trans no N/A 0.546 0.522 0.317 2e-09
Q9TRY0 459 Peptidyl-prolyl cis-trans no N/A 0.714 0.333 0.259 2e-09
Q00688224 Peptidyl-prolyl cis-trans no N/A 0.546 0.522 0.317 2e-09
Q02790 459 Peptidyl-prolyl cis-trans no N/A 0.775 0.361 0.245 4e-09
O46638224 Peptidyl-prolyl cis-trans yes N/A 0.546 0.522 0.317 4e-09
Q9XT11 457 Peptidyl-prolyl cis-trans N/A N/A 0.780 0.365 0.261 2e-08
>sp|Q14318|FKBP8_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Homo sapiens GN=FKBP8 PE=1 SV=2 Back     alignment and function desciption
 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/163 (30%), Positives = 85/163 (52%), Gaps = 2/163 (1%)

Query: 42  WVDILGSGHIKKKITKHGEP-DTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLEL 100
           W+DILG+G ++KK    G P  +RP +G +  +     LE+ T V+    L   +GD ++
Sbjct: 93  WLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDV 152

Query: 101 VHGMDYVLPLMEMGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAE 160
           +  +D  +PLM++GE   +   +++ YG +G  S  IPP A L   +TL + +   DL  
Sbjct: 153 IQALDLSVPLMDVGETAMVTADSKYCYGPQGR-SPYIPPHAALCLEVTLKTAVDGPDLEM 211

Query: 161 LPVEKRLDFGVKRKHRGNWFYSRGDNSFAVQCYRRSLDFLDSS 203
           L  ++R+    +++  GN  Y R D   A   Y  ++  + SS
Sbjct: 212 LTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSS 254




Constitutively inactive PPiase, which becomes active when bound to calmodulin and calcium. Seems to act as a chaperone for BCL2, targets it to the mitochondria and modulates its phosphorylation state. The BCL2/FKBP8/calmodulin/calcium complex probably interferes with the binding of BCL2 to its targets. The active form of FKBP8 may therefore play a role in the regulation of apoptosis.
Homo sapiens (taxid: 9606)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q3B7U9|FKBP8_RAT Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Rattus norvegicus GN=Fkbp8 PE=2 SV=1 Back     alignment and function description
>sp|O35465|FKBP8_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Mus musculus GN=Fkbp8 PE=1 SV=2 Back     alignment and function description
>sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 Back     alignment and function description
>sp|P26884|FKBP3_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Bos taurus GN=FKBP3 PE=1 SV=2 Back     alignment and function description
>sp|Q9TRY0|FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus GN=FKBP4 PE=1 SV=4 Back     alignment and function description
>sp|Q00688|FKBP3_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens GN=FKBP3 PE=1 SV=1 Back     alignment and function description
>sp|Q02790|FKBP4_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens GN=FKBP4 PE=1 SV=3 Back     alignment and function description
>sp|O46638|FKBP3_RABIT Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Oryctolagus cuniculus GN=FKBP3 PE=2 SV=2 Back     alignment and function description
>sp|Q9XT11|FKBP5_AOTNA Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Aotus nancymaae GN=FKBP5 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
242009345 385 fk506 binding protein, putative [Pedicul 0.780 0.433 0.470 1e-39
322790610 355 hypothetical protein SINV_13234 [Solenop 0.803 0.484 0.434 7e-39
66547995 382 PREDICTED: peptidyl-prolyl cis-trans iso 0.836 0.468 0.406 2e-37
332374152 428 unknown [Dendroctonus ponderosae] 0.766 0.383 0.464 2e-37
345494458 383 PREDICTED: peptidyl-prolyl cis-trans iso 0.878 0.490 0.366 3e-37
91085557 367 PREDICTED: similar to AGAP006615-PA [Tri 0.836 0.487 0.450 1e-36
350404336 382 PREDICTED: peptidyl-prolyl cis-trans iso 0.859 0.481 0.421 1e-36
340716647 383 PREDICTED: LOW QUALITY PROTEIN: peptidyl 0.859 0.480 0.416 3e-36
380016753 382 PREDICTED: peptidyl-prolyl cis-trans iso 0.836 0.468 0.401 3e-36
332025730 416 FK506-binding protein 8 [Acromyrmex echi 0.831 0.427 0.4 3e-36
>gi|242009345|ref|XP_002425448.1| fk506 binding protein, putative [Pediculus humanus corporis] gi|212509284|gb|EEB12710.1| fk506 binding protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 112/168 (66%), Gaps = 1/168 (0%)

Query: 36  EEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICV 95
           +E +DEW+DILG+G +K K  K GEPD+RPQ  D+C I   GKL D  +VE FD+L+I +
Sbjct: 54  DEPKDEWIDILGNGQLKLKTIKQGEPDSRPQANDICEIRLLGKLNDGKIVENFDSLKIEL 113

Query: 96  GDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPD 155
           G  E+V G++  +PLM +GEE  + ++ RFGYG  G   K IPP A + Y +TL +VLP+
Sbjct: 114 GSHEVVQGVELAVPLMNVGEEAIVVVSPRFGYGSVGNLPK-IPPNATITYEVTLVNVLPE 172

Query: 156 FDLAELPVEKRLDFGVKRKHRGNWFYSRGDNSFAVQCYRRSLDFLDSS 203
            +L ++   KR      +K RGNW+YSR D + A QCYR++L+ LD +
Sbjct: 173 PNLEKISFTKRKILANNKKERGNWWYSRQDATKATQCYRKALNMLDET 220




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322790610|gb|EFZ15418.1| hypothetical protein SINV_13234 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|66547995|ref|XP_623097.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP8-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|332374152|gb|AEE62217.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|345494458|ref|XP_003427294.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP8-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|91085557|ref|XP_966821.1| PREDICTED: similar to AGAP006615-PA [Tribolium castaneum] gi|270010048|gb|EFA06496.1| hypothetical protein TcasGA2_TC009394 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350404336|ref|XP_003487073.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP8-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340716647|ref|XP_003396807.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase FKBP8-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380016753|ref|XP_003692338.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP8-like [Apis florea] Back     alignment and taxonomy information
>gi|332025730|gb|EGI65888.1| FK506-binding protein 8 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query214
FB|FBgn0034368 397 CG5482 [Drosophila melanogaste 0.817 0.440 0.370 5e-28
ZFIN|ZDB-GENE-040426-1849 406 fkbp8 "FK506 binding protein 8 0.859 0.453 0.329 3.6e-25
UNIPROTKB|F1S912 414 FKBP8 "Uncharacterized protein 0.799 0.413 0.314 1e-21
UNIPROTKB|J9NV07 450 FKBP8 "Uncharacterized protein 0.799 0.38 0.314 1.6e-21
UNIPROTKB|J9P6P2 473 FKBP8 "Uncharacterized protein 0.799 0.361 0.314 2.2e-21
UNIPROTKB|E2RNZ0 441 FKBP8 "Uncharacterized protein 0.794 0.385 0.314 8.4e-21
UNIPROTKB|Q14318 412 FKBP8 "Peptidyl-prolyl cis-tra 0.803 0.417 0.298 1.2e-20
UNIPROTKB|E1C6R4335 E1C6R4 "Uncharacterized protei 0.794 0.507 0.333 1.7e-20
UNIPROTKB|J3KQ73 441 FKBP8 "Peptidyl-prolyl cis-tra 0.803 0.390 0.298 2e-20
UNIPROTKB|F1N2P6 411 FKBP8 "Uncharacterized protein 0.799 0.416 0.314 1.2e-19
FB|FBgn0034368 CG5482 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 313 (115.2 bits), Expect = 5.0e-28, P = 5.0e-28
 Identities = 69/186 (37%), Positives = 111/186 (59%)

Query:    33 KPEEEVEDEWVDILGSGHIKKKITKHGEPDT--RPQRGDLCVISGFGKLEDDTLVETFDN 90
             K EEE  +E  DILG+  + K+  K    D+  RP RG+L  ++  GKL++ T+VE   N
Sbjct:    48 KAEEEDAEEECDILGNKQLIKRTIKKAPQDSFRRPIRGELVTVNFTGKLDNGTVVENELN 107

Query:    91 LEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGD-----KGEPSKSIPPGAKLYY 145
              +  VGD E++ G+D VLP++++GE  Q+ + +RFGYG      +GE    +PP A L Y
Sbjct:   108 FQCHVGDYEVIQGLDMVLPMLQVGEVSQVSVDSRFGYGSLGLKKEGESEYLVPPDAHLTY 167

Query:   146 SLTLHSV-LPDF-DLAELPVEKRLDFGVKRKHRGNWFYSRGDNSFAVQCYRRSLDFLDSS 203
              + L  +   +F DL    + ++  +G ++K R N+FY R + + A+  YRR+LDFLD+ 
Sbjct:   168 EIELLDIKYEEFADLKSFEILRK--YGTRKKERANFFYKRSEFTTAIHLYRRALDFLDNR 225

Query:   204 NMDTNN 209
             + D ++
Sbjct:   226 DGDPDS 231




GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0006457 "protein folding" evidence=IEA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0016020 "membrane" evidence=IBA
ZFIN|ZDB-GENE-040426-1849 fkbp8 "FK506 binding protein 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S912 FKBP8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NV07 FKBP8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6P2 FKBP8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNZ0 FKBP8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q14318 FKBP8 "Peptidyl-prolyl cis-trans isomerase FKBP8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6R4 E1C6R4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J3KQ73 FKBP8 "Peptidyl-prolyl cis-trans isomerase FKBP8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N2P6 FKBP8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.1LOW CONFIDENCE prediction!
4th Layer5.2.1.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 2e-10
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
 Score = 55.3 bits (134), Expect = 2e-10
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 4/93 (4%)

Query: 62  DTRPQRGDLCVISGFGKLEDDTLVET----FDNLEICVGDLELVHGMDYVLPLMEMGEEC 117
             + ++GD   +   GKLED T+ ++        E  +G  +++ G D  L  M++GE+ 
Sbjct: 2   PEKAKKGDTVTVHYTGKLEDGTVFDSSKDRGKPFEFTLGSGQVIPGWDEGLLGMKVGEKR 61

Query: 118 QIEITARFGYGDKGEPSKSIPPGAKLYYSLTLH 150
           ++ I     YG++G     IPP A L + + L 
Sbjct: 62  KLTIPPELAYGEEGLAGGVIPPNATLVFEVELL 94


Length = 94

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 214
KOG0543|consensus 397 100.0
KOG0544|consensus108 99.97
KOG0549|consensus188 99.97
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.94
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.9
KOG0552|consensus226 99.89
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.89
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.87
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.84
KOG0545|consensus 329 99.83
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.57
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.46
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.44
KOG0543|consensus 397 99.23
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 99.05
PRK01490 435 tig trigger factor; Provisional 98.99
KOG0544|consensus108 98.94
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.92
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 97.73
KOG0549|consensus188 97.71
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 97.29
KOG0547|consensus 606 97.24
KOG4648|consensus 536 97.13
KOG4234|consensus 271 97.07
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 97.04
KOG0553|consensus 304 95.67
KOG0551|consensus 390 95.44
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 94.92
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 93.96
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.9
KOG0546|consensus 372 93.69
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 93.54
KOG0548|consensus 539 93.47
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.4
KOG0550|consensus 486 92.85
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 91.45
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 89.28
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 86.82
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 83.85
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 82.45
PF0421269 MIT: MIT (microtubule interacting and transport) d 81.96
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 80.19
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 80.04
>KOG0543|consensus Back     alignment and domain information
Probab=100.00  E-value=1.8e-39  Score=278.19  Aligned_cols=192  Identities=28%  Similarity=0.519  Sum_probs=174.5

Q ss_pred             ChhhhhccCCCceEEEEecCCCCCCCCCCCCCCCcccccceeEEeecCCcEEEEEEeCCCC-CCCCCCCCEEEEEEEEEE
Q psy1750           1 MDESISNGNNGDLNSFEIVDKADVEENPVIPDKPEEEVEDEWVDILGSGHIKKKITKHGEP-DTRPQRGDLCVISGFGKL   79 (214)
Q Consensus         1 ~~~~v~~m~~Ge~a~~~i~~~~~~~~~~~~p~~~~~~~~~~~~d~~~d~~v~k~il~~G~g-~~~p~~g~~V~v~y~~~~   79 (214)
                      ||.|+++|++|+           .++||.||+++++.|++++.    ||+|+|+|+++|.+ ...|..|..|++||.+++
T Consensus        51 ~~~gv~tm~~g~-----------~~~pp~ip~~a~l~fe~el~----Dg~iiKriir~G~gd~~~P~~g~~V~v~~~G~~  115 (397)
T KOG0543|consen   51 WDLGVATMKKGE-----------AGSPPKIPSNATLLFEVELL----DGGIIKRIIREGEGDYSRPNKGAVVKVHLEGEL  115 (397)
T ss_pred             cccccccccccc-----------cCCCCCCCCCcceeeeeccc----CCceEEeeeecCCCCCCCCCCCcEEEEEEEEEE
Confidence            678888888843           57799999999999998776    89999999999997 689999999999999999


Q ss_pred             cCCcEEEec-cceEEEeCC-CccchhHHHHhcCcCCCcEEEEEEecCccccCC-CCCCCCCCCCCeEEEEEEecccc-CC
Q psy1750          80 EDDTLVETF-DNLEICVGD-LELVHGMDYVLPLMEMGEECQIEITARFGYGDK-GEPSKSIPPGAKLYYSLTLHSVL-PD  155 (214)
Q Consensus        80 ~dg~~~~~~-~~~~~~lG~-~~~~~gle~~l~~M~~GE~~~~~i~~~~ayG~~-g~~~~~ip~~~~l~f~IeL~~v~-~~  155 (214)
                      .|+ +|+++ ..|.|.+|+ ..++.||+.||..|++||.+.|+|+|.|+||.. ++++ .||||++|.|+|+|++|. ..
T Consensus       116 ~~~-~f~~~~~~fe~~~Ge~~~vi~Gle~al~~M~~GE~a~v~i~~~YayG~~~~~~p-~IPPnA~l~yEVeL~~f~~~~  193 (397)
T KOG0543|consen  116 EDG-VFDQRELRFEFGEGEDIDVIEGLEIALRMMKVGEVALVTIDPKYAYGEEGGEPP-LIPPNATLLYEVELLDFELKE  193 (397)
T ss_pred             CCc-ceeccccceEEecCCccchhHHHHHHHHhcCccceEEEEeCcccccCCCCCCCC-CCCCCceEEEEEEEEeeecCc
Confidence            877 66654 467888888 689999999999999999999999999999944 4555 899999999999999999 78


Q ss_pred             CCCCCCChhHHhHhhhhhhhccccccccCCHHHHHHHHHHHhhhccCCCCCCCC
Q psy1750         156 FDLAELPVEKRLDFGVKRKHRGNWFYSRGDNSFAVQCYRRSLDFLDSSNMDTNN  209 (214)
Q Consensus       156 ~~~~~l~~~ekl~~a~~~k~~Gn~~fk~~~~~~A~~~Y~~al~~l~~~~~~~~~  209 (214)
                      ++.|.|..+|+++.|.++|++||.+||+++|..|+.+|+||+++|+++...+..
T Consensus       194 ~~s~~~~~~e~l~~A~~~ke~Gn~~fK~gk~~~A~~~Yerav~~l~~~~~~~~e  247 (397)
T KOG0543|consen  194 DESWKMFAEERLEAADRKKERGNVLFKEGKFKLAKKRYERAVSFLEYRRSFDEE  247 (397)
T ss_pred             ccccccchHHHHHHHHHHHHhhhHHHhhchHHHHHHHHHHHHHHhhccccCCHH
Confidence            899999999999999999999999999999999999999999999999988753



>KOG0544|consensus Back     alignment and domain information
>KOG0549|consensus Back     alignment and domain information
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>KOG0552|consensus Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>KOG0544|consensus Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>KOG0549|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
2d9f_A135 Solution Structure Of Ruh-047, An Fkbp Domain From 1e-14
2jwx_A157 Solution Structure Of The N-Terminal Domain Of Huma 2e-13
2f2d_A121 Solution Structure Of The Fk506-Binding Domain Of H 3e-13
2awg_A118 Structure Of The Ppiase Domain Of The Human Fk506-B 4e-13
1qz2_A 336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 5e-10
1kt1_A 457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 2e-09
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 5e-09
1kt0_A 457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 7e-09
1p5q_A 336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 8e-09
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 3e-08
3jym_A377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 5e-08
3jxv_A356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 5e-08
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 1e-06
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 3e-06
3o5d_A264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 5e-06
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 7e-06
1q1c_A280 Crystal Structure Of N(1-260) Of Human Fkbp52 Lengt 8e-06
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 1e-05
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 1e-05
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 1e-05
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 1e-05
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 2e-05
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 2e-05
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 2e-05
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 2e-05
1rot_A149 Structure Of Fkbp59-I, The N-Terminal Domain Of A 5 2e-05
1n1a_A140 Crystal Structure Of The N-Terminal Domain Of Human 2e-05
4drj_A144 O-crystal Structure Of The Ppiase Domain Of Fkbp52, 2e-05
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 2e-05
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 3e-05
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 3e-05
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 3e-05
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 3e-05
2ki3_A126 Structural And Biochemical Characterization Of Fk50 4e-05
1tco_C107 Ternary Complex Of A Calcineurin A Fragment, Calcin 1e-04
3uqi_A108 Crystallographic Structure Of Fkbp12 From Aedes Aeg 3e-04
1c9h_A107 Crystal Structure Of Fkbp12.6 In Complex With Rapam 9e-04
>pdb|2D9F|A Chain A, Solution Structure Of Ruh-047, An Fkbp Domain From Human Cdna Length = 135 Back     alignment and structure

Iteration: 1

Score = 76.6 bits (187), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 40/123 (32%), Positives = 70/123 (56%), Gaps = 3/123 (2%) Query: 40 DEWVDILGSGHIKKKITKHGEP-DTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDL 98 +EW+DILG+G ++KK G P +RP +G + + LE+ T V+ L +GD Sbjct: 8 EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDC 67 Query: 99 ELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVL--PDF 156 +++ +D +PLM++GE + +++ YG +G S IPP A L +TL + + PD Sbjct: 68 DVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAVDRPDL 127 Query: 157 DLA 159 +++ Sbjct: 128 EMS 130
>pdb|2JWX|A Chain A, Solution Structure Of The N-Terminal Domain Of Human Fkbp38 (Fkbp38ntd) Length = 157 Back     alignment and structure
>pdb|2F2D|A Chain A, Solution Structure Of The Fk506-Binding Domain Of Human Fkbp38 Length = 121 Back     alignment and structure
>pdb|2AWG|A Chain A, Structure Of The Ppiase Domain Of The Human Fk506-Binding Protein 8 Length = 118 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|1Q1C|A Chain A, Crystal Structure Of N(1-260) Of Human Fkbp52 Length = 280 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|1ROT|A Chain A, Structure Of Fkbp59-I, The N-Terminal Domain Of A 59 Kda Fk506-Binding Protein, Nmr, Minimized Average Structure Length = 149 Back     alignment and structure
>pdb|1N1A|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Fkbp52 Length = 140 Back     alignment and structure
>pdb|4DRJ|A Chain A, O-crystal Structure Of The Ppiase Domain Of Fkbp52, Rapamycin And The Frb Fragment Of Mtor Length = 144 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|1TCO|C Chain C, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 107 Back     alignment and structure
>pdb|3UQI|A Chain A, Crystallographic Structure Of Fkbp12 From Aedes Aegypti Length = 108 Back     alignment and structure
>pdb|1C9H|A Chain A, Crystal Structure Of Fkbp12.6 In Complex With Rapamycin Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query214
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 4e-38
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 2e-29
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 4e-28
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-27
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 6e-27
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-24
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-22
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 8e-14
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 2e-13
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 4e-12
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 2e-12
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 5e-12
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 8e-12
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 8e-12
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 4e-11
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 6e-11
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 3e-10
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 4e-10
2ppn_A107 FK506-binding protein 1A; high resolution protein 5e-10
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 7e-10
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 7e-10
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 1e-09
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 2e-07
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 2e-06
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 3e-06
1jvw_A167 Macrophage infectivity potentiator; chagas disease 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 5e-05
2fbn_A 198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-04
1fd9_A213 Protein (macrophage infectivity potentiator prote; 2e-04
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 5e-04
3rkv_A 162 Putative peptidylprolyl isomerase; structural geno 6e-04
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
 Score =  133 bits (337), Expect = 4e-38
 Identities = 41/176 (23%), Positives = 78/176 (44%), Gaps = 1/176 (0%)

Query: 34  PEEEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEI 93
               +      +   G I ++I   GE   +P  G +  ++  G  +D    +     EI
Sbjct: 10  HSSGLVPRGSHMEEDGGIIRRIQTRGEGYAKPNEGAIVEVALEGYYKDKLFDQRELRFEI 69

Query: 94  CVG-DLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSV 152
             G +L+L +G++  +  ME GE   + +   + +G  G+    IPP A+L Y L L S 
Sbjct: 70  GEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYELHLKSF 129

Query: 153 LPDFDLAELPVEKRLDFGVKRKHRGNWFYSRGDNSFAVQCYRRSLDFLDSSNMDTN 208
               +  E+  E++L+     K RG  ++  G    A+  Y++ + +L+  +  +N
Sbjct: 130 EKAKESWEMNSEEKLEQSTIVKERGTVYFKEGKYKQALLQYKKIVSWLEYESSFSN 185


>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Length = 167 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Length = 213 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 100.0
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 100.0
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.97
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.97
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.96
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.96
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.95
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.95
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.95
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.95
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.95
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.95
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.95
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.94
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.94
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.94
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.94
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.93
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.93
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.93
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.93
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.92
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.92
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.91
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.91
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.91
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.9
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.9
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.9
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.89
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.88
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.7
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.66
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.65
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.62
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.6
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.57
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.55
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.52
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.47
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.44
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.32
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 98.38
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 98.3
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 98.27
2ppn_A107 FK506-binding protein 1A; high resolution protein 98.22
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 98.21
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 98.2
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 98.18
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 98.17
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 98.16
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 98.16
1jvw_A167 Macrophage infectivity potentiator; chagas disease 98.15
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 98.15
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 98.14
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 98.13
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 98.1
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 98.07
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 97.99
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 97.79
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 97.54
2fbn_A 198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.15
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 96.92
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 96.67
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 96.4
3rkv_A 162 Putative peptidylprolyl isomerase; structural geno 96.3
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 96.15
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 95.86
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 95.62
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 95.35
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 95.14
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 94.77
2hr2_A 159 Hypothetical protein; alpha-alpha superhelix fold, 94.71
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 93.72
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 93.35
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 93.28
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 93.09
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 92.74
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 92.39
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 91.27
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 91.21
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 91.17
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 88.73
2cpt_A117 SKD1 protein, vacuolar sorting protein 4B; MIT, he 87.41
1w26_A432 Trigger factor, TF; chaperone, protein folding, ri 86.47
2l6j_A111 TPR repeat-containing protein associated with HSP; 86.16
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-b 85.34
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 85.02
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 81.16
3sz7_A 164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 80.31
1a17_A 166 Serine/threonine protein phosphatase 5; hydrolase, 80.19
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
Probab=100.00  E-value=9.1e-33  Score=232.35  Aligned_cols=158  Identities=25%  Similarity=0.388  Sum_probs=143.0

Q ss_pred             ChhhhhccCCCceEEEEecCC-CC--CCCCCCCCCCCcccccceeEEee-------cCCcEEEEEEeCCCCCCCCCCCCE
Q psy1750           1 MDESISNGNNGDLNSFEIVDK-AD--VEENPVIPDKPEEEVEDEWVDIL-------GSGHIKKKITKHGEPDTRPQRGDL   70 (214)
Q Consensus         1 ~~~~v~~m~~Ge~a~~~i~~~-~~--~~~~~~~p~~~~~~~~~~~~d~~-------~d~~v~k~il~~G~g~~~p~~g~~   70 (214)
                      |++||.+|++||++.|.|+|. +|  .+.++.||+++++.|++++.++.       .|++++++++++|+|...|+.||.
T Consensus       110 ~e~aL~gm~~Ge~~~v~ipp~~aYG~~g~~~~Ip~~~~lvf~Vel~~i~~~~~~~~~d~gl~~~il~~G~G~~~~~~gd~  189 (280)
T 1q1c_A          110 WDIAIATMKVGEVCHITCKPEYAYGSAGSPPKIPPNATLVFEVELFEFKGEDLTEEEDGGIIRRIQTRGEGYAKPNEGAI  189 (280)
T ss_dssp             HHHHHTTCCTTCEEEEEECGGGTTTTTCBTTTBCTTCCEEEEEEEEEEECEECCTTCSSSEEEEEEECCSCSCCCCTTCE
T ss_pred             HHHHHhcCCCCCEEEEEECcHHhCCCcCccCCCCCCCcEEEEEEeeeecccccccccccceeEEeeecccccccccCCce
Confidence            689999999999999999998 55  46678999999999999987554       689999999999997778999999


Q ss_pred             EEEEEEEEEcCCcEEEeccceEEEeCCCc---cchhHHHHhcCcCCCcEEEEEEecCccccCCCCCCCCCCCCCeEEEEE
Q psy1750          71 CVISGFGKLEDDTLVETFDNLEICVGDLE---LVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSL  147 (214)
Q Consensus        71 V~v~y~~~~~dg~~~~~~~~~~~~lG~~~---~~~gle~~l~~M~~GE~~~~~i~~~~ayG~~g~~~~~ip~~~~l~f~I  147 (214)
                      |+|||++++ ||++|++ .|+.|.+|.+.   +++||+++|.+|++||+++|.|||+++||..+.+.+.||++++|+|+|
T Consensus       190 V~i~y~g~~-dG~~fd~-~~~~f~lG~g~~~~~i~G~e~~l~gmk~Ge~~~v~ip~~~~yG~~~~~~~~IP~~~~l~f~V  267 (280)
T 1q1c_A          190 VEVALEGYY-KDKLFDQ-RELRFEIGEGENLDLPYGLERAIQRMEKGEHSIVYLKPSYAFGSVGKEKFQIPPNAELKYEL  267 (280)
T ss_dssp             EEEEEEEEE-TTEEEEE-EEEEEETTCGGGGTCCHHHHHHHTTCCTTCEEEEEECGGGTTTTTCBGGGTBCTTCCEEEEE
T ss_pred             EEEEEEEEe-CCEEEec-CCeEEEecCCcccccchhHHHHHhCCCCCcEEEEEEChhHcCCcCCCccCccCCCCeEEEEE
Confidence            999999998 8999998 58999999987   599999999999999999999999999999988765699999999999


Q ss_pred             EeccccCCCCCCC
Q psy1750         148 TLHSVLPDFDLAE  160 (214)
Q Consensus       148 eL~~v~~~~~~~~  160 (214)
                      +|++|++.++.|+
T Consensus       268 ~L~~i~~~~~~W~  280 (280)
T 1q1c_A          268 HLKSFEKAKESWE  280 (280)
T ss_dssp             EEEEEECCCC---
T ss_pred             EEEEEeCCCCCCC
Confidence            9999999999985



>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2cpt_A SKD1 protein, vacuolar sorting protein 4B; MIT, helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.7.14.1 Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 214
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 5e-16
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 1e-13
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 3e-12
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 4e-12
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 5e-12
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 7e-11
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 2e-10
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 9e-08
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-07
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 1e-07
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-06
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycopl 6e-05
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 4e-04
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP51, N-terminal domains
species: Monkey (Saimiri boliviensis) [TaxId: 27679]
 Score = 68.9 bits (168), Expect = 5e-16
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 1/110 (0%)

Query: 44  DILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELV-H 102
           D+L  G I ++  + GE  + P  G    I   G+              +  G+   +  
Sbjct: 3   DLLEDGGIIRRTKRRGEGYSNPNEGARVQIHLEGRCGGRVFDCRDVAFTVGEGEDHDIPI 62

Query: 103 GMDYVLPLMEMGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSV 152
           G+D  L  M+  E+C + +  R+G+G+ G+P   I P A+L Y +TL S 
Sbjct: 63  GIDKALEKMQREEQCILHLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSF 112


>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query214
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.97
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.97
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.96
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.95
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.95
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.95
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.94
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.94
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.93
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.92
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.91
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.63
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.6
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 99.22
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 99.11
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 98.59
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 98.55
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 98.53
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 98.53
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 98.47
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 98.46
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.45
d1kt1a1 168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.44
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 98.3
d1p5qa1 170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.29
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 98.25
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 98.2
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 97.61
d1a17a_ 159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 96.38
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.15
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.02
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.65
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 94.55
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 94.35
d2hr2a1 156 Hypothetical protein CT2138 {Chlorobium tepidum [T 90.98
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 89.23
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 88.8
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 86.87
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 86.38
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 84.09
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP52, N-terminal domains
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=4.4e-30  Score=188.48  Aligned_cols=113  Identities=29%  Similarity=0.486  Sum_probs=105.8

Q ss_pred             eeEEee--cCCcEEEEEEeCCCCCCCCCCCCEEEEEEEEEEcCCcEEEec----cceEEEeCCCccchhHHHHhcCcCCC
Q psy1750          41 EWVDIL--GSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETF----DNLEICVGDLELVHGMDYVLPLMEMG  114 (214)
Q Consensus        41 ~~~d~~--~d~~v~k~il~~G~g~~~p~~g~~V~v~y~~~~~dg~~~~~~----~~~~~~lG~~~~~~gle~~l~~M~~G  114 (214)
                      +++|++  +|++|.|+|+++|+|...|..||.|+|||++++.||++|+++    .|+.|.+|.+.+++||+++|.+|++|
T Consensus         1 ~~~d~t~~~d~gv~~~i~~~G~G~~~P~~gd~V~v~y~~~l~dG~~fdss~~~~~p~~f~~g~~~~i~G~~~~l~~M~~G   80 (120)
T d1q1ca1           1 EGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVG   80 (120)
T ss_dssp             CCEECCSSCSSSEEEEEEECCSSSCCCCTTCEEEEEEEEEETTSCEEEESTTSSSCEEEETTTTSSCHHHHHHHTTCCTT
T ss_pred             CceeccCCCCCCEEEEEEEcccCCcCCCCCCEEEEEEEEEEcCCCEEEeccccccceeeecCCCceeeeeeeeeccccCC
Confidence            467888  489999999999997788999999999999999999999863    58999999999999999999999999


Q ss_pred             cEEEEEEecCccccCCCCCCCCCCCCCeEEEEEEeccccC
Q psy1750         115 EECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLP  154 (214)
Q Consensus       115 E~~~~~i~~~~ayG~~g~~~~~ip~~~~l~f~IeL~~v~~  154 (214)
                      |+++|.|||++|||..|.++ .||||++|+|+|||++|+.
T Consensus        81 e~~~~~ip~~laYG~~g~~~-~IPp~s~LifeIeLl~v~~  119 (120)
T d1q1ca1          81 EVCHITCKPEYAYGSAGSPP-KIPPNATLVFEVELFEFKG  119 (120)
T ss_dssp             CEEEEEECGGGTTTTTCBTT-TBCTTCCEEEEEEEEEEEC
T ss_pred             cEEEEEECHHHhCCCcCCCC-CCCcCCcEEEEEEEEEEeC
Confidence            99999999999999999987 8999999999999999974



>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure