Psyllid ID: psy17663
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| 242014619 | 863 | conserved hypothetical protein [Pediculu | 0.630 | 0.108 | 0.893 | 4e-47 | |
| 357622827 | 1022 | hypothetical protein KGM_19915 [Danaus p | 0.630 | 0.091 | 0.872 | 2e-46 | |
| 307207432 | 1139 | Cytosolic carboxypeptidase 3 [Harpegnath | 0.644 | 0.084 | 0.770 | 5e-43 | |
| 383859802 | 1047 | PREDICTED: cytosolic carboxypeptidase 2- | 0.630 | 0.089 | 0.808 | 3e-42 | |
| 380014498 | 1079 | PREDICTED: LOW QUALITY PROTEIN: cytosoli | 0.637 | 0.088 | 0.789 | 4e-42 | |
| 350416584 | 1094 | PREDICTED: cytosolic carboxypeptidase 2- | 0.630 | 0.085 | 0.808 | 4e-42 | |
| 340722431 | 1092 | PREDICTED: cytosolic carboxypeptidase 2- | 0.630 | 0.086 | 0.808 | 4e-42 | |
| 340722429 | 1110 | PREDICTED: cytosolic carboxypeptidase 2- | 0.630 | 0.084 | 0.808 | 4e-42 | |
| 307166046 | 1089 | Cytosolic carboxypeptidase 2 [Camponotus | 0.630 | 0.086 | 0.776 | 1e-41 | |
| 322783678 | 1051 | hypothetical protein SINV_12466 [Solenop | 0.630 | 0.089 | 0.787 | 6e-41 |
| >gi|242014619|ref|XP_002427984.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212512483|gb|EEB15246.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 192 bits (488), Expect = 4e-47, Method: Compositional matrix adjust.
Identities = 84/94 (89%), Positives = 92/94 (97%)
Query: 4 RKKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGN 63
+KKA+V+T+RVHPGETPSSWMMKGF+DFLT DS QAKELREKFIFKL+PMLNPDGVIVGN
Sbjct: 304 KKKAVVVTARVHPGETPSSWMMKGFIDFLTSDSEQAKELREKFIFKLVPMLNPDGVIVGN 363
Query: 64 NRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIRR 97
NRCSLTGRDLNRQYRTVIRETYPPVWHTKL+I+R
Sbjct: 364 NRCSLTGRDLNRQYRTVIRETYPPVWHTKLMIKR 397
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357622827|gb|EHJ74206.1| hypothetical protein KGM_19915 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|307207432|gb|EFN85147.1| Cytosolic carboxypeptidase 3 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383859802|ref|XP_003705381.1| PREDICTED: cytosolic carboxypeptidase 2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380014498|ref|XP_003691267.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 2-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|350416584|ref|XP_003491003.1| PREDICTED: cytosolic carboxypeptidase 2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340722431|ref|XP_003399609.1| PREDICTED: cytosolic carboxypeptidase 2-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340722429|ref|XP_003399608.1| PREDICTED: cytosolic carboxypeptidase 2-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307166046|gb|EFN60323.1| Cytosolic carboxypeptidase 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322783678|gb|EFZ11016.1| hypothetical protein SINV_12466 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| FB|FBgn0052627 | 1201 | NnaD "Drosophila Nna1 ortholog | 0.583 | 0.072 | 0.770 | 2.2e-33 | |
| UNIPROTKB|Q0P4M4 | 967 | agbl2 "Cytosolic carboxypeptid | 0.583 | 0.089 | 0.655 | 3.6e-30 | |
| UNIPROTKB|F1SNI4 | 708 | AGBL3 "Uncharacterized protein | 0.597 | 0.125 | 0.629 | 8.4e-30 | |
| RGD|1561995 | 871 | Agbl3 "ATP/GTP binding protein | 0.583 | 0.099 | 0.643 | 1.1e-29 | |
| UNIPROTKB|F6XBC1 | 910 | AGBL3 "Uncharacterized protein | 0.597 | 0.097 | 0.629 | 1.5e-29 | |
| UNIPROTKB|E2QYU4 | 1016 | AGBL3 "Uncharacterized protein | 0.597 | 0.087 | 0.629 | 1.9e-29 | |
| UNIPROTKB|G3N121 | 919 | AGBL3 "Cytosolic carboxypeptid | 0.597 | 0.096 | 0.617 | 2.5e-29 | |
| UNIPROTKB|F1NDJ1 | 488 | AGBL3 "Uncharacterized protein | 0.583 | 0.178 | 0.586 | 2.9e-29 | |
| UNIPROTKB|E1B9D8 | 1003 | AGBL3 "Cytosolic carboxypeptid | 0.597 | 0.088 | 0.617 | 3e-29 | |
| UNIPROTKB|G5E5V2 | 1008 | AGBL3 "Cytosolic carboxypeptid | 0.597 | 0.088 | 0.617 | 3e-29 |
| FB|FBgn0052627 NnaD "Drosophila Nna1 ortholog" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 376 (137.4 bits), Expect = 2.2e-33, P = 2.2e-33
Identities = 67/87 (77%), Positives = 78/87 (89%)
Query: 4 RKKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGN 63
RKK+IV+++RVHP ETP+SWMMKG MDF+TGD+ AK LR KFIFKL+PMLNPDGVIVGN
Sbjct: 927 RKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGN 986
Query: 64 NRCSLTGRDLNRQYRTVIRETYPPVWH 90
R SLTG+DLNRQYRTVIRETYP +W+
Sbjct: 987 TRNSLTGKDLNRQYRTVIRETYPSIWY 1013
|
|
| UNIPROTKB|Q0P4M4 agbl2 "Cytosolic carboxypeptidase 2" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SNI4 AGBL3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1561995 Agbl3 "ATP/GTP binding protein-like 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XBC1 AGBL3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QYU4 AGBL3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N121 AGBL3 "Cytosolic carboxypeptidase 3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NDJ1 AGBL3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B9D8 AGBL3 "Cytosolic carboxypeptidase 3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E5V2 AGBL3 "Cytosolic carboxypeptidase 3" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| cd06907 | 261 | cd06907, M14_AGBL2-3_like, Peptidase M14-like doma | 1e-61 | |
| cd06235 | 258 | cd06235, M14_Nna1_like_2, Peptidase M14-like domai | 1e-56 | |
| cd06906 | 278 | cd06906, M14_Nna1, Peptidase M14-like domain of AT | 3e-40 | |
| cd06908 | 261 | cd06908, M14_AGBL4_like, Peptidase M14-like domain | 5e-36 | |
| cd06236 | 308 | cd06236, M14_AGBL5_like, Peptidase M14-like domain | 3e-34 | |
| cd03856 | 258 | cd03856, M14_Nna1_like, Peptidase M14-like domain | 6e-32 | |
| pfam00246 | 277 | pfam00246, Peptidase_M14, Zinc carboxypeptidase | 3e-23 | |
| cd06234 | 263 | cd06234, M14_Nna1_like_1, Peptidase M14-like domai | 5e-18 | |
| cd06237 | 245 | cd06237, M14_Nna1_like_3, Peptidase M14-like domai | 7e-14 | |
| smart00631 | 277 | smart00631, Zn_pept, Zn_pept domain | 1e-13 | |
| COG2866 | 374 | COG2866, COG2866, Predicted carboxypeptidase [Amin | 3e-06 | |
| cd00596 | 211 | cd00596, Peptidase_M14_like, M14 family of metallo | 3e-06 | |
| cd06239 | 231 | cd06239, M14-like_1_2, Peptidase M14-like domain; | 7e-06 | |
| cd06248 | 303 | cd06248, M14_CP_A-B_like_1, Peptidase M14 carboxyp | 1e-05 | |
| cd06231 | 234 | cd06231, M14-like_4, Peptidase M14-like domain; un | 7e-05 | |
| cd03857 | 226 | cd03857, M14-like_1, Peptidase M14-like domain; un | 2e-04 | |
| cd06904 | 178 | cd06904, M14_MpaA_like, Peptidase M14-like domain | 9e-04 | |
| cd06227 | 269 | cd06227, M14-like_2, Peptidase M14-like domain; un | 0.002 |
| >gnl|CDD|133117 cd06907, M14_AGBL2-3_like, Peptidase M14-like domain of ATP/GTP binding protein AGBL-2 and AGBL-3, and related proteins | Back alignment and domain information |
|---|
Score = 189 bits (483), Expect = 1e-61
Identities = 61/101 (60%), Positives = 85/101 (84%)
Query: 4 RKKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGN 63
KKA+V+T+RVHPGET +SWMMKGF+DFLT +S A+ LR+ FIFK++PMLNPDGVIVGN
Sbjct: 45 AKKAVVLTARVHPGETNASWMMKGFLDFLTSNSPDAQLLRDTFIFKIVPMLNPDGVIVGN 104
Query: 64 NRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIRRKTKKKPV 104
RCSL GRDLNR Y+T +++++P +W+TK +++R +++ V
Sbjct: 105 YRCSLAGRDLNRNYKTPLKDSFPTIWYTKNMVKRLLEEREV 145
|
Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-2, and related proteins. The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. This subgroup includes the human AGBL-2, and -3, and the mouse cytosolic carboxypeptidase (CCPs)-2, and -3. ATP/GTP binding protein (AGTPBP-1/Nna1)-like proteins are active metallopeptidases that are thought to act on cytosolic proteins such as alpha-tubulin, to remove a C-terminal tyrosine. Mutations in AGTPBP-1/Nna1 cause Purkinje cell degeneration (pcd). AGTPBP-1/Nna1 however does not belong to this subgroup. AGTPBP-1/Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal domain might act as a folding domain. Length = 261 |
| >gnl|CDD|199859 cd06235, M14_Nna1_like_2, Peptidase M14-like domain of human Nna1/AGTPBP-1, AGBL2 -5, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133116 cd06906, M14_Nna1, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases | Back alignment and domain information |
|---|
| >gnl|CDD|133118 cd06908, M14_AGBL4_like, Peptidase M14-like domain of ATP/GTP binding protein AGBL-4 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199860 cd06236, M14_AGBL5_like, Peptidase M14-like domain of ATP/GTP binding protein (AGBL)-5 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199841 cd03856, M14_Nna1_like, Peptidase M14-like domain of ATP/GTP binding proteins, cytosolic carboxypeptidases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215816 pfam00246, Peptidase_M14, Zinc carboxypeptidase | Back alignment and domain information |
|---|
| >gnl|CDD|199858 cd06234, M14_Nna1_like_1, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases; uncharacterized bacterial subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199861 cd06237, M14_Nna1_like_3, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases; uncharacterized bacterial subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|214748 smart00631, Zn_pept, Zn_pept domain | Back alignment and domain information |
|---|
| >gnl|CDD|225421 COG2866, COG2866, Predicted carboxypeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|199839 cd00596, Peptidase_M14_like, M14 family of metallocarboxypeptidases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199863 cd06239, M14-like_1_2, Peptidase M14-like domain; uncharacterized subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199869 cd06248, M14_CP_A-B_like_1, Peptidase M14 carboxypeptidase subfamily A/B-like; uncharacterized subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|199857 cd06231, M14-like_4, Peptidase M14-like domain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|133069 cd03857, M14-like_1, Peptidase M14-like domain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|133114 cd06904, M14_MpaA_like, Peptidase M14-like domain of Escherichia coli Murein Peptide Amidase A and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199854 cd06227, M14-like_2, Peptidase M14-like domain; uncharacterized subfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| cd06908 | 261 | M14_AGBL4_like Peptidase M14-like domain of ATP/GT | 100.0 | |
| cd06907 | 261 | M14_AGBL2-3_like Peptidase M14-like domain of ATP/ | 100.0 | |
| cd06236 | 304 | M14_AGBL5_like Peptidase M14-like domain of ATP/GT | 100.0 | |
| cd03856 | 269 | M14_Nna1_like Peptidase M14-like domain of Nna-1 ( | 100.0 | |
| cd06235 | 258 | M14_Nna1_like_2 Subgroup of the Peptidase M14-like | 100.0 | |
| cd06906 | 278 | M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervo | 100.0 | |
| cd06234 | 263 | M14_Nna1_like_1 A bacterial subgroup of the Peptid | 100.0 | |
| cd06237 | 244 | M14_Nna1_like_3 A bacterial subgroup of the Peptid | 99.98 | |
| KOG2650|consensus | 418 | 99.97 | ||
| cd03872 | 300 | M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also know | 99.97 | |
| cd06227 | 272 | Peptidase_M14-like_2 A functionally uncharacterize | 99.97 | |
| cd06247 | 298 | M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO | 99.96 | |
| cd06248 | 304 | M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/ | 99.96 | |
| cd03870 | 301 | M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA | 99.96 | |
| cd06246 | 300 | M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (C | 99.96 | |
| cd06229 | 255 | M14_Endopeptidase_I Peptidase M14-like domain of G | 99.96 | |
| cd06226 | 293 | M14_CPT_like Peptidase M14-like domain of an uncha | 99.96 | |
| cd03871 | 300 | M14_CPB Peptidase M14 Carboxypeptidase B (CPB) bel | 99.96 | |
| cd06245 | 363 | M14_CPD_III The third carboxypeptidase (CP)-like d | 99.96 | |
| PF00246 | 279 | Peptidase_M14: Zinc carboxypeptidase This is famil | 99.96 | |
| cd03868 | 372 | M14_CPD_I The first carboxypeptidase (CP)-like dom | 99.96 | |
| cd03859 | 295 | M14_CPT Peptidase M14-like domain of carboxypeptid | 99.96 | |
| cd03858 | 374 | M14_CP_N-E_like Carboxypeptidase (CP) N/E-like sub | 99.96 | |
| smart00631 | 277 | Zn_pept Zn_pept. | 99.96 | |
| cd06228 | 332 | Peptidase_M14-like_3 A functionally uncharacterize | 99.96 | |
| cd03866 | 376 | M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM | 99.95 | |
| cd03863 | 375 | M14_CPD_II The second carboxypeptidase (CP)-like d | 99.95 | |
| KOG3641|consensus | 650 | 99.95 | ||
| cd06239 | 231 | Peptidase_M14-like_1_2 Peptidase M14-like domain o | 99.95 | |
| cd03860 | 294 | M14_CP_A-B_like The Peptidase M14 Carboxypeptidase | 99.95 | |
| cd06242 | 268 | Peptidase_M14-like_1_5 Peptidase M14-like domain o | 99.95 | |
| cd06238 | 271 | Peptidase_M14-like_1_1 Peptidase M14-like domain o | 99.95 | |
| cd03864 | 392 | M14_CPN Peptidase M14 Carboxypeptidase N (CPN, als | 99.95 | |
| cd03867 | 395 | M14_CPZ Peptidase M14-like domain of carboxypeptid | 99.95 | |
| cd06905 | 360 | Peptidase_M14-like_8 A functionally uncharacterize | 99.95 | |
| cd03862 | 273 | Peptidase_M14-like_7 A functionally uncharacterize | 99.95 | |
| cd06243 | 236 | Peptidase_M14-like_1_6 Peptidase M14-like domain o | 99.95 | |
| cd03857 | 226 | Peptidase_M14-like_1 Peptidase M14-like domain of | 99.94 | |
| cd06244 | 268 | Peptidase_M14-like_1_7 Peptidase M14-like domain o | 99.94 | |
| cd06241 | 266 | Peptidase_M14-like_1_4 Peptidase M14-like domain o | 99.94 | |
| cd03869 | 405 | M14_CPX_like Peptidase M14-like domain of carboxyp | 99.94 | |
| cd00596 | 196 | Peptidase_M14_like The M14 family of metallocarbox | 99.94 | |
| cd03865 | 402 | M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (C | 99.93 | |
| cd06904 | 178 | M14_MpaA_like Peptidase M14-like domain of Escheri | 99.92 | |
| cd06231 | 236 | Peptidase_M14-like_4 A functionally uncharacterize | 99.9 | |
| cd06240 | 273 | Peptidase_M14-like_1_3 Peptidase M14-like domain o | 99.9 | |
| PRK10602 | 237 | murein peptide amidase A; Provisional | 99.89 | |
| cd06232 | 240 | Peptidase_M14-like_5 Peptidase M14-like domain of | 99.85 | |
| KOG2649|consensus | 500 | 99.73 | ||
| cd06230 | 252 | M14_ASTE_ASPA_like The Peptidase M14 Succinylgluta | 99.64 | |
| cd06251 | 287 | M14_ASTE_ASPA_like_1 A functionally uncharacterize | 99.62 | |
| cd06255 | 293 | M14_ASTE_ASPA_like_5 A functionally uncharacterize | 99.6 | |
| cd06250 | 359 | M14_PaAOTO_like An uncharacterized subgroup of the | 99.58 | |
| cd06233 | 283 | Peptidase_M14-like_6 Peptidase M14-like domain of | 99.57 | |
| cd06254 | 288 | M14_ASTE_ASPA_like_4 A functionally uncharacterize | 99.54 | |
| cd06253 | 298 | M14_ASTE_ASPA_like_3 A functionally uncharacterize | 99.53 | |
| cd06252 | 316 | M14_ASTE_ASPA_like_2 A functionally uncharacterize | 99.52 | |
| PF04952 | 292 | AstE_AspA: Succinylglutamate desuccinylase / Aspar | 99.49 | |
| COG2866 | 374 | Predicted carboxypeptidase [Amino acid transport a | 99.47 | |
| TIGR02994 | 325 | ectoine_eutE ectoine utilization protein EutE. Mem | 99.45 | |
| cd06256 | 327 | M14_ASTE_ASPA_like_6 A functionally uncharacterize | 99.41 | |
| PRK02259 | 288 | aspartoacylase; Provisional | 99.35 | |
| cd06909 | 282 | M14_ASPA Aspartoacylase (ASPA) belongs to the Succ | 99.32 | |
| COG3608 | 331 | Predicted deacylase [General function prediction o | 99.27 | |
| cd06910 | 272 | M14_ASTE_ASPA_like_7 A functionally uncharacterize | 99.26 | |
| PRK05324 | 329 | succinylglutamate desuccinylase; Provisional | 99.24 | |
| cd03855 | 322 | M14_ASTE Peptidase M14 Succinylglutamate desucciny | 99.17 | |
| TIGR03242 | 319 | arg_catab_astE succinylglutamate desuccinylase. Me | 99.16 | |
| PF10994 | 341 | DUF2817: Protein of unknown function (DUF2817); In | 98.95 | |
| COG2988 | 324 | Succinylglutamate desuccinylase [Amino acid transp | 97.84 | |
| PF09892 | 193 | DUF2119: Uncharacterized protein conserved in arch | 97.5 | |
| KOG3641|consensus | 650 | 96.56 | ||
| COG4073 | 198 | Uncharacterized protein conserved in archaea [Func | 96.25 |
| >cd06908 M14_AGBL4_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-4, and related proteins | Back alignment and domain information |
|---|
Probab=100.00 E-value=4e-38 Score=258.43 Aligned_cols=117 Identities=41% Similarity=0.717 Sum_probs=110.0
Q ss_pred CCCcEEEEEcCcCCCCchHHHHHHHHHHHHhcCCHHHHHhhhCcEEEEEeeeCCCccccccccCCCCCCCCCCCCCCCCC
Q psy17663 3 HRKKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGNNRCSLTGRDLNRQYRTVIR 82 (149)
Q Consensus 3 ~~k~~V~i~~~iHg~E~~~~~~~~~~i~~L~~~~~~~~~ll~~~~~~ivP~~NPDG~~~g~~R~n~~GvDLNRnw~~~~~ 82 (149)
++||.|||.|||||+||+|++++++++++|+++++.++.|+++++|+||||+||||+++|++|+||.|+||||||.+|++
T Consensus 41 ~~k~~I~i~ariHp~E~~~s~~~~~li~~L~~~~~~~~~L~~~~~~~IvP~~NPDGv~~gn~R~~~~G~DLNR~w~~p~~ 120 (261)
T cd06908 41 SEKKVIFITARVHPGESPSSYVCQGLIDFLVSNHPIAKVLREHLVFKIVPMLNPDGVFLGNYRCSLMGHDLNRHWHDPSP 120 (261)
T ss_pred CCCcEEEEECCcCCCChHHHHHHHHHHHHHhhCCHHHHHHHHhCcEEEEeeecCcceeecCCcCcCcCcCCCCCCCCCCc
Confidence 46899999999999999999999999999998899999999999999999999999999999999999999999999999
Q ss_pred CCCccHHHHHHHHHHHHhcCCCcccccccccccceeEEEEeecCCCccC
Q psy17663 83 ETYPPVWHTKLLIRRKTKKKPVQSSTGKMRFRKSGIVTTATMHSKQEPA 131 (149)
Q Consensus 83 ~~~PE~~a~~~li~~l~~~~p~~~~~~~~~~~~~~~~~~iDlHs~s~~~ 131 (149)
+++||+++++++++++.++. +.++++|||+|+|+++.
T Consensus 121 ~~~PEv~av~~~i~~~~~~~------------~~~i~~~lD~H~hs~~~ 157 (261)
T cd06908 121 WAHPTLHAVKNLLKELDNDS------------TTQLDFYIDLHAHSSLM 157 (261)
T ss_pred ccChHHHHHHHHHHHhhhcc------------ccCeeEEEEeecccccc
Confidence 99999999999999876531 26899999999999987
|
The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. This eukaryotic subgroup includes the human AGBL4 and the mouse cytosolic carboxypeptidase (CCP)-6. ATP/GTP binding protein (AGTPBP-1/Nna1)-like proteins are active metallopeptidases that are thought to act on cytosolic proteins such as alpha-tubulin, to remove a C-terminal tyrosine. Mutations in AGTPBP-1/Nna1 cause Purkinje cell degeneration (pcd). AGTPBP-1/Nna1 however does not belong to this subgroup. AGTPBP-1/Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal |
| >cd06907 M14_AGBL2-3_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-2, and related proteins | Back alignment and domain information |
|---|
| >cd06236 M14_AGBL5_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-5, and related proteins | Back alignment and domain information |
|---|
| >cd03856 M14_Nna1_like Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06235 M14_Nna1_like_2 Subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06906 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins | Back alignment and domain information |
|---|
| >cd06234 M14_Nna1_like_1 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins | Back alignment and domain information |
|---|
| >cd06237 M14_Nna1_like_3 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP),-like proteins | Back alignment and domain information |
|---|
| >KOG2650|consensus | Back alignment and domain information |
|---|
| >cd03872 M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also known as CPAH; EC 3 | Back alignment and domain information |
|---|
| >cd06227 Peptidase_M14-like_2 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06247 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO, also known as metallocarboxypeptidase C; EC 3 | Back alignment and domain information |
|---|
| >cd06248 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/B-like subfamily: This is one of two main M14 carboxypeptidase subfamilies, defined by sequence and structural homology, the other being N/E | Back alignment and domain information |
|---|
| >cd03870 M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA) belongs to the A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06246 M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (CPB2, also known as plasma carboxypeptidase B, carboxypeptidase U, and CPU), belongs to the carboxpeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06229 M14_Endopeptidase_I Peptidase M14-like domain of Gamma-D-glutamyl-L-diamino acid endopeptidase 1 (also known as Gamma-D-glutamyl-meso-diaminopimelate peptidase I, and Endopeptidase I (ENP1); EC 3 | Back alignment and domain information |
|---|
| >cd06226 M14_CPT_like Peptidase M14-like domain of an uncharacterized group of Peptidase M14 Carboxypeptidase (CP) T (CPT)-like proteins | Back alignment and domain information |
|---|
| >cd03871 M14_CPB Peptidase M14 Carboxypeptidase B (CPB) belongs to the carboxypeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06245 M14_CPD_III The third carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 | Back alignment and domain information |
|---|
| >PF00246 Peptidase_M14: Zinc carboxypeptidase This is family M14 in the peptidase classification | Back alignment and domain information |
|---|
| >cd03868 M14_CPD_I The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 | Back alignment and domain information |
|---|
| >cd03859 M14_CPT Peptidase M14-like domain of carboxypeptidase (CP) T (CPT), CPT belongs to the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >smart00631 Zn_pept Zn_pept | Back alignment and domain information |
|---|
| >cd06228 Peptidase_M14-like_3 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03866 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM) belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03863 M14_CPD_II The second carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 | Back alignment and domain information |
|---|
| >KOG3641|consensus | Back alignment and domain information |
|---|
| >cd06239 Peptidase_M14-like_1_2 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03860 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase (CP) A/B subfamily is one of two main M14 CP subfamilies defined by sequence and structural homology, the other being the N/E subfamily | Back alignment and domain information |
|---|
| >cd06242 Peptidase_M14-like_1_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06238 Peptidase_M14-like_1_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03864 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, also known as kininase I, creatine kinase conversion factor, plasma carboxypeptidase B, arginine carboxypeptidase, and protaminase; EC 3 | Back alignment and domain information |
|---|
| >cd03867 M14_CPZ Peptidase M14-like domain of carboxypeptidase (CP) Z (CPZ), CPZ belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06905 Peptidase_M14-like_8 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03862 Peptidase_M14-like_7 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06243 Peptidase_M14-like_1_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03857 Peptidase_M14-like_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06244 Peptidase_M14-like_1_7 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06241 Peptidase_M14-like_1_4 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd03869 M14_CPX_like Peptidase M14-like domain of carboxypeptidase (CP)-like protein X (CPX), CPX forms a distinct subgroup of the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd00596 Peptidase_M14_like The M14 family of metallocarboxypeptidases (MCPs) are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity | Back alignment and domain information |
|---|
| >cd03865 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (CPE, also known as carboxypeptidase H, and enkephalin convertase; EC 3 | Back alignment and domain information |
|---|
| >cd06904 M14_MpaA_like Peptidase M14-like domain of Escherichia coli Murein Peptide Amidase A (MpaA) and related proteins | Back alignment and domain information |
|---|
| >cd06231 Peptidase_M14-like_4 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06240 Peptidase_M14-like_1_3 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >PRK10602 murein peptide amidase A; Provisional | Back alignment and domain information |
|---|
| >cd06232 Peptidase_M14-like_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >KOG2649|consensus | Back alignment and domain information |
|---|
| >cd06230 M14_ASTE_ASPA_like The Peptidase M14 Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily belongs to the M14 family of metallocarboxypeptidases (MCPs), and includes ASTE, which catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3 | Back alignment and domain information |
|---|
| >cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06233 Peptidase_M14-like_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) | Back alignment and domain information |
|---|
| >cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 | Back alignment and domain information |
|---|
| >COG2866 Predicted carboxypeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02994 ectoine_eutE ectoine utilization protein EutE | Back alignment and domain information |
|---|
| >cd06256 M14_ASTE_ASPA_like_6 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK02259 aspartoacylase; Provisional | Back alignment and domain information |
|---|
| >cd06909 M14_ASPA Aspartoacylase (ASPA) belongs to the Succinylglutamate desuccinylase/aspartoacylase subfamily of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >COG3608 Predicted deacylase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06910 M14_ASTE_ASPA_like_7 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases | Back alignment and domain information |
|---|
| >PRK05324 succinylglutamate desuccinylase; Provisional | Back alignment and domain information |
|---|
| >cd03855 M14_ASTE Peptidase M14 Succinylglutamate desuccinylase (ASTE, also known as N-succinyl-L-glutamate amidohydrolase, N2-succinylglutamate desuccinylase, and SGDS; EC 3 | Back alignment and domain information |
|---|
| >TIGR03242 arg_catab_astE succinylglutamate desuccinylase | Back alignment and domain information |
|---|
| >PF10994 DUF2817: Protein of unknown function (DUF2817); InterPro: IPR021259 This family of proteins has no known function | Back alignment and domain information |
|---|
| >COG2988 Succinylglutamate desuccinylase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF09892 DUF2119: Uncharacterized protein conserved in archaea (DUF2119); InterPro: IPR019218 This entry represents a family of hypothetical archaeal proteins of unknown function | Back alignment and domain information |
|---|
| >KOG3641|consensus | Back alignment and domain information |
|---|
| >COG4073 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 149 | ||||
| 3l2n_A | 395 | Crystal Structure Of Putative Carboxypeptidase A (y | 3e-13 | ||
| 4a37_A | 388 | Metallo-Carboxypeptidase From Pseudomonas Aeruginos | 1e-10 | ||
| 3k2k_A | 403 | Crystal Structure Of Putative Carboxypeptidase (Yp_ | 1e-09 |
| >pdb|3L2N|A Chain A, Crystal Structure Of Putative Carboxypeptidase A (yp_562911.1) From Shewanella Denitrificans Os-217 At 2.39 A Resolution Length = 395 | Back alignment and structure |
|
| >pdb|4A37|A Chain A, Metallo-Carboxypeptidase From Pseudomonas Aeruginosa Length = 388 | Back alignment and structure |
| >pdb|3K2K|A Chain A, Crystal Structure Of Putative Carboxypeptidase (Yp_103406.1) From Burkholderia Mallei Atcc 23344 At 2.49 A Resolution Length = 403 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| 4a37_A | 388 | Metallo-carboxypeptidase; metallo-protease, hydrol | 5e-31 | |
| 3k2k_A | 403 | Putative carboxypeptidase; structural genomics, jo | 1e-29 | |
| 3l2n_A | 395 | Peptidase M14, carboxypeptidase A; putative carbox | 2e-29 | |
| 2qvp_A | 275 | Uncharacterized protein; putative metallopeptidase | 4e-17 | |
| 3b2y_A | 275 | Metallopeptidase containing CO-catalytic metalloa | 1e-12 | |
| 1aye_A | 401 | PCPA2, procarboxypeptidase A2; serine protease, zy | 7e-05 | |
| 1jqg_A | 433 | Carboxypeptidase A; Pro-protein, hydrolase; 2.50A | 2e-04 | |
| 2bo9_A | 308 | Carboxypeptidase A4; metallocarboxypeptidase, X-RA | 3e-04 | |
| 3prt_A | 323 | Carboxypeptidase T; hydrolase; 1.66A {Thermoactino | 3e-04 | |
| 1dtd_A | 303 | Carboxypeptidase A2; carboxypeptidase A2, leech ca | 3e-04 | |
| 1m4l_A | 307 | Carboxypeptidase A; metalloproteinase, metalloexop | 7e-04 |
| >4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* Length = 388 | Back alignment and structure |
|---|
Score = 113 bits (284), Expect = 5e-31
Identities = 31/98 (31%), Positives = 49/98 (50%), Gaps = 1/98 (1%)
Query: 1 MSHRKKAIVITSRVHPGETPSSWMMKGFMDFLT-GDSAQAKELREKFIFKLIPMLNPDGV 59
+ + ++ HPGE + W M+G ++ L D + + L EK L+P +NPDG
Sbjct: 166 HPDSHLKLWVIAQQHPGEHMAEWFMEGLIERLQRPDDTEMQRLLEKADLYLVPNMNPDGA 225
Query: 60 IVGNNRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIRR 97
GN R + G+DLNR + E P VW + ++R
Sbjct: 226 FHGNLRTNAAGQDLNRAWLEPSAERSPEVWFVQQEMKR 263
|
| >3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Length = 403 | Back alignment and structure |
|---|
| >3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} Length = 395 | Back alignment and structure |
|---|
| >2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} Length = 275 | Back alignment and structure |
|---|
| >3b2y_A Metallopeptidase containing CO-catalytic metalloa site; metallopeptidase containing CO-catalytic metalloactive site; 1.74A {Shewanella denitrificans OS217} PDB: 3ieh_A* Length = 275 | Back alignment and structure |
|---|
| >1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A Length = 401 | Back alignment and structure |
|---|
| >1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 Length = 433 | Back alignment and structure |
|---|
| >2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* Length = 308 | Back alignment and structure |
|---|
| >3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A Length = 323 | Back alignment and structure |
|---|
| >1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 Length = 303 | Back alignment and structure |
|---|
| >1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... Length = 307 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| 3l2n_A | 395 | Peptidase M14, carboxypeptidase A; putative carbox | 99.97 | |
| 3k2k_A | 403 | Putative carboxypeptidase; structural genomics, jo | 99.97 | |
| 3v38_A | 326 | Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Th | 99.97 | |
| 4a37_A | 388 | Metallo-carboxypeptidase; metallo-protease, hydrol | 99.96 | |
| 3prt_A | 323 | Carboxypeptidase T; hydrolase; 1.66A {Thermoactino | 99.96 | |
| 3mn8_A | 435 | LP15968P; catalytic domain of alpha/beta-hydrolase | 99.96 | |
| 1m4l_A | 307 | Carboxypeptidase A; metalloproteinase, metalloexop | 99.95 | |
| 3dgv_A | 401 | TAFI, carboxypeptidase B2; blood coagulation, fibr | 99.95 | |
| 3d4u_A | 309 | Tafia, carboxypeptidase B2; protease-inhibitor com | 99.95 | |
| 1z5r_A | 306 | Procarboxypeptidase B; exopeptidase, hydrolase; 1. | 99.95 | |
| 1dtd_A | 303 | Carboxypeptidase A2; carboxypeptidase A2, leech ca | 99.95 | |
| 1kwm_A | 402 | Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A | 99.95 | |
| 2bo9_A | 308 | Carboxypeptidase A4; metallocarboxypeptidase, X-RA | 99.95 | |
| 2nsm_A | 439 | Carboxypeptidase N catalytic chain; caroxypeptidas | 99.95 | |
| 1aye_A | 401 | PCPA2, procarboxypeptidase A2; serine protease, zy | 99.95 | |
| 1uwy_A | 426 | Carboxypeptidase M; metallopeptidase, GPI-anchor, | 99.95 | |
| 1h8l_A | 380 | Carboxypeptidase GP180 residues 503-882; hydrolase | 99.95 | |
| 2boa_A | 404 | Carboxypeptidase A4; metalloprocarboxypeptidase, X | 99.95 | |
| 2c1c_A | 312 | Carboxypeptidase B; insect, metalloprotease, insen | 99.95 | |
| 1pca_A | 403 | Procarboxypeptidase A PCPA; hydrolase(C-terminal p | 99.94 | |
| 1jqg_A | 433 | Carboxypeptidase A; Pro-protein, hydrolase; 2.50A | 99.93 | |
| 2qvp_A | 275 | Uncharacterized protein; putative metallopeptidase | 99.93 | |
| 3b2y_A | 275 | Metallopeptidase containing CO-catalytic metalloa | 99.92 | |
| 4axv_A | 243 | MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} | 99.89 | |
| 2qj8_A | 332 | MLR6093 protein; structural genomics, joint center | 99.79 | |
| 3cdx_A | 354 | Succinylglutamatedesuccinylase/aspartoacylase; str | 99.77 | |
| 3fmc_A | 368 | Putative succinylglutamate desuccinylase / aspart; | 99.72 | |
| 3na6_A | 331 | Succinylglutamate desuccinylase/aspartoacylase; st | 99.67 | |
| 1yw6_A | 335 | Succinylglutamate desuccinylase; alpha-beta protei | 99.55 | |
| 2gu2_A | 312 | ASPA protein; aspartoacylase family, aminoacylase- | 99.51 | |
| 1yw4_A | 341 | Succinylglutamate desuccinylase; alpha-beta protei | 99.48 | |
| 2bco_A | 350 | Succinylglutamate desuccinylase; NESG, VPR14, stru | 99.48 | |
| 3nh4_A | 327 | Aspartoacylase-2; mercapturates, hydrolase; 2.00A | 99.38 |
| >3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} | Back alignment and structure |
|---|
Probab=99.97 E-value=1.2e-31 Score=229.53 Aligned_cols=111 Identities=32% Similarity=0.556 Sum_probs=103.2
Q ss_pred CCCcEEEEEcCcCCCCchHHHHHHHHHHHHhc-CCHHHHHhhhCcEEEEEeeeCCCccccccccCCCCCCCCCCCCCCCC
Q psy17663 3 HRKKAIVITSRVHPGETPSSWMMKGFMDFLTG-DSAQAKELREKFIFKLIPMLNPDGVIVGNNRCSLTGRDLNRQYRTVI 81 (149)
Q Consensus 3 ~~k~~V~i~~~iHg~E~~~~~~~~~~i~~L~~-~~~~~~~ll~~~~~~ivP~~NPDG~~~g~~R~n~~GvDLNRnw~~~~ 81 (149)
++||.|||.|+|||+|++|++++++++++|++ .++.++.||++++|+||||+||||++++++|+||.|+||||||.+++
T Consensus 173 ~~kp~V~i~agiHg~E~~g~~~~~~ll~~L~~~~d~~~~~ll~~~~~~ivP~~NPDG~~~~~~R~n~~GvDLNRnf~g~~ 252 (395)
T 3l2n_A 173 PSKKSIWITARQHPGETMAEWLVEGLLNQLLDNDCPTSKALLDKANFYIVPNMNPDGSVRGHLRTNAVGANLNREWQTPS 252 (395)
T ss_dssp TTSEEEEEEECSSTTCTHHHHHHHHHHHHHTCTTSHHHHHHHHHEEEEEESCSCHHHHHTTCSSCCTTSCCGGGCSSSCC
T ss_pred CCCcEEEEEcccCCCCchHHHHHHHHHHHHhhcCCHHHHHHhhCcEEEEEeccCCchhhhcccccccCCCCcccccCCCC
Confidence 36999999999999999999999999999997 68899999999999999999999999999999999999999999999
Q ss_pred CCCCccHHHHHHHHHHHHhcCCCcccccccccccceeEEEEeecCCCccC
Q psy17663 82 RETYPPVWHTKLLIRRKTKKKPVQSSTGKMRFRKSGIVTTATMHSKQEPA 131 (149)
Q Consensus 82 ~~~~PE~~a~~~li~~l~~~~p~~~~~~~~~~~~~~~~~~iDlHs~s~~~ 131 (149)
+.++||++++++++.+ .++++|||+|++++..
T Consensus 253 ~~sepEt~a~~~~l~~------------------~~~~~~iDlHs~~~~p 284 (395)
T 3l2n_A 253 LERSPEVYYVVNKMHE------------------TGVDLFYDVHGDEGLP 284 (395)
T ss_dssp TTTCHHHHHHHHHHHH------------------HCCSEEEEEEEESSCS
T ss_pred cCCCHHHHHHHHHHHh------------------CCCcEEEEeccCCCCC
Confidence 9999999998877664 3579999999999854
|
| >3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} | Back alignment and structure |
|---|
| >3v38_A Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A 3prt_A | Back alignment and structure |
|---|
| >4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* | Back alignment and structure |
|---|
| >3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A | Back alignment and structure |
|---|
| >3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... | Back alignment and structure |
|---|
| >3dgv_A TAFI, carboxypeptidase B2; blood coagulation, fibrinolysis, protein S glycoprotein, hydrolase, metal-binding, metalloprotease, PR secreted, zymogen; HET: NAG NDG FUL BMA; 2.50A {Bos taurus} PDB: 3osl_A 3d68_A* 3d66_A* 3d67_A* | Back alignment and structure |
|---|
| >3d4u_A Tafia, carboxypeptidase B2; protease-inhibitor complex, glycoprotein, hydrolase, metal-binding, metalloprotease, protease, secret zymogen; 1.70A {Bos taurus} PDB: 3lms_A | Back alignment and structure |
|---|
| >1z5r_A Procarboxypeptidase B; exopeptidase, hydrolase; 1.40A {Sus scrofa} SCOP: c.56.5.1 PDB: 1zg7_A* 1zg8_A* 1zg9_A* 2jew_A* 2piy_A* 2piz_A* 2pj0_A* 2pj1_A* 2pj2_A* 2pj3_A* 2pj4_A* 2pj5_A* 2pj6_A* 2pj7_A* 2pj8_A* 2pj9_A* 2pja_A* 2pjb_A* 2pjc_A* 1zli_A ... | Back alignment and structure |
|---|
| >1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 | Back alignment and structure |
|---|
| >1kwm_A Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 3glj_A 1nsa_A 1pba_A | Back alignment and structure |
|---|
| >2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* | Back alignment and structure |
|---|
| >2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A | Back alignment and structure |
|---|
| >1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 | Back alignment and structure |
|---|
| >1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* | Back alignment and structure |
|---|
| >2boa_A Carboxypeptidase A4; metalloprocarboxypeptidase, X-RAY zymogen, metalloprotease, exopropeptidase, hydrolase; HET: NAG; 2.20A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 | Back alignment and structure |
|---|
| >2c1c_A Carboxypeptidase B; insect, metalloprotease, insensitive, plant inhibitors, hydrolase; 2.3A {Helicoverpa zea} SCOP: c.56.5.1 | Back alignment and structure |
|---|
| >1pca_A Procarboxypeptidase A PCPA; hydrolase(C-terminal peptidase); HET: CIT; 2.00A {Sus scrofa} SCOP: d.58.3.1 PDB: 1pyt_A | Back alignment and structure |
|---|
| >1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 | Back alignment and structure |
|---|
| >2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} | Back alignment and structure |
|---|
| >3b2y_A Metallopeptidase containing CO-catalytic metalloa site; metallopeptidase containing CO-catalytic metalloactive site; 1.74A {Shewanella denitrificans OS217} PDB: 3ieh_A* | Back alignment and structure |
|---|
| >4axv_A MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} | Back alignment and structure |
|---|
| >2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} | Back alignment and structure |
|---|
| >3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* | Back alignment and structure |
|---|
| >3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} | Back alignment and structure |
|---|
| >1yw6_A Succinylglutamate desuccinylase; alpha-beta protein., structural genomics, PSI, protein structure initiative; 3.10A {Escherichia coli} SCOP: c.56.5.7 | Back alignment and structure |
|---|
| >2gu2_A ASPA protein; aspartoacylase family, aminoacylase-2, ACY-2, ACY2_RAT, STRU genomics, PSI, protein structure initiative; HET: MSE; 1.80A {Rattus norvegicus} SCOP: c.56.5.7 PDB: 2q4z_A 2i3c_A 2q51_A 2o4h_A* 2o53_A | Back alignment and structure |
|---|
| >1yw4_A Succinylglutamate desuccinylase; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.00A {Chromobacterium violaceum} SCOP: c.56.5.7 | Back alignment and structure |
|---|
| >2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A | Back alignment and structure |
|---|
| >3nh4_A Aspartoacylase-2; mercapturates, hydrolase; 2.00A {Mus musculus} SCOP: c.56.5.0 PDB: 3nh5_A 3nfz_A 3nh8_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 149 | ||||
| d1uwya2 | 296 | c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic d | 2e-09 | |
| d1h8la2 | 301 | c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic d | 2e-09 | |
| d1jqga1 | 317 | c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton boll | 2e-05 | |
| d2c1ca1 | 312 | c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earwor | 4e-05 | |
| d1obra_ | 323 | c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyce | 2e-04 | |
| d1ayea1 | 307 | c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo | 2e-04 | |
| d2bo9a1 | 305 | c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo | 7e-04 |
| >d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 296 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Phosphorylase/hydrolase-like superfamily: Zn-dependent exopeptidases family: Pancreatic carboxypeptidases domain: Carboxypeptidase M, catalytic domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 52.1 bits (124), Expect = 2e-09
Identities = 19/114 (16%), Positives = 35/114 (30%), Gaps = 11/114 (9%)
Query: 5 KKAIVITSRVHPGETPSSWMMKGFMDFLT---GDSAQAKELREKFIFKLIPMLNPDGV-- 59
+ +H ET ++ +D+L G + L ++P +NPDG
Sbjct: 56 IPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEA 115
Query: 60 ------IVGNNRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIRRKTKKKPVQSS 107
R + DLNR + + + + K + S
Sbjct: 116 VKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVSRQPETVAVMKWLKTETFVLS 169
|
| >d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Length = 301 | Back information, alignment and structure |
|---|
| >d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} Length = 317 | Back information, alignment and structure |
|---|
| >d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} Length = 312 | Back information, alignment and structure |
|---|
| >d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} Length = 323 | Back information, alignment and structure |
|---|
| >d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 307 | Back information, alignment and structure |
|---|
| >d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| d1uwya2 | 296 | Carboxypeptidase M, catalytic domain {Human (Homo | 99.96 | |
| d1h8la2 | 301 | Carboxypeptidase D, catalytic domain {Crested duck | 99.95 | |
| d1m4la_ | 307 | Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913] | 99.95 | |
| d1jqga1 | 317 | Carboxypeptidase A {Cotton bollworm (Helicoverpa a | 99.95 | |
| d2c1ca1 | 312 | Carboxypeptidase B {Corn earworm (Helicoverpa zea) | 99.95 | |
| d1ayea1 | 307 | Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 | 99.95 | |
| d2bo9a1 | 305 | Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 | 99.94 | |
| d1z5ra1 | 304 | Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823] | 99.94 | |
| d1obra_ | 323 | Carboxypeptidase T {Thermoactinomyces vulgaris [Ta | 99.94 | |
| d2gu2a1 | 307 | Aspartoacylase AspA {Rat (Rattus norvegicus) [TaxI | 99.35 | |
| d1yw6a1 | 322 | Succinylglutamate desuccinylase AstE {Escherichia | 99.32 | |
| d2bcoa1 | 339 | Succinylglutamate desuccinylase AstE {Vibrio parah | 99.22 | |
| d1yw4a1 | 331 | Succinylglutamate desuccinylase AstE {Chromobacter | 99.21 | |
| d2g9da1 | 340 | Succinylglutamate desuccinylase AstE {Vibrio chole | 99.05 |
| >d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Phosphorylase/hydrolase-like superfamily: Zn-dependent exopeptidases family: Pancreatic carboxypeptidases domain: Carboxypeptidase M, catalytic domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96 E-value=1.6e-29 Score=206.37 Aligned_cols=110 Identities=19% Similarity=0.251 Sum_probs=98.6
Q ss_pred CCcEEEEEcCcCCCCchHHHHHHHHHHHHhc---CCHHHHHhhhCcEEEEEeeeCCCccccc--------cccCCCCCCC
Q psy17663 4 RKKAIVITSRVHPGETPSSWMMKGFMDFLTG---DSAQAKELREKFIFKLIPMLNPDGVIVG--------NNRCSLTGRD 72 (149)
Q Consensus 4 ~k~~V~i~~~iHg~E~~~~~~~~~~i~~L~~---~~~~~~~ll~~~~~~ivP~~NPDG~~~g--------~~R~n~~GvD 72 (149)
+||.|+|+|++||+||+|+++++++++.|++ .++.++.+|++++|+||||+||||+++. .+|.||.|||
T Consensus 55 ~kp~v~~~~giHa~E~~g~~~~~~~~~~L~~~~~~d~~~~~ll~~~~i~ivP~~NPDG~~~~~~~~~~~~~~r~n~~GvD 134 (296)
T d1uwya2 55 GIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYYSIGRENYNQYD 134 (296)
T ss_dssp TBCEEEEEECCSTTCCHHHHHHHHHHHHHHHHTTTSHHHHHHHHHCEEEEESCSCHHHHHHCSSCCSSCCSCSSCTTSCC
T ss_pred CCceEEEEeccCCCCccHHHHHHHHHHHHhhccccCHHHHHhhhcceEEEEeeecCchHhhcccccccccCccCCCcccc
Confidence 5899999999999999999999999999985 5789999999999999999999998753 3578999999
Q ss_pred CCCCCC----CCCCCCCccHHHHHHHHHHHHhcCCCcccccccccccceeEEEEeecCCCccC
Q psy17663 73 LNRQYR----TVIRETYPPVWHTKLLIRRKTKKKPVQSSTGKMRFRKSGIVTTATMHSKQEPA 131 (149)
Q Consensus 73 LNRnw~----~~~~~~~PE~~a~~~li~~l~~~~p~~~~~~~~~~~~~~~~~~iDlHs~s~~~ 131 (149)
|||||. ++.++++||++|+++++++ .++.+++|+||+++.+
T Consensus 135 lNRNf~~~~~g~~~~sepEt~av~~~~~~------------------~~~~~~i~~Hs~~~~i 179 (296)
T d1uwya2 135 LNRNFPDAFEYNNVSRQPETVAVMKWLKT------------------ETFVLSANLHGGALVA 179 (296)
T ss_dssp TTSCSCCSSSCCCCCCCHHHHHHHHHHHH------------------SCEEECCEEECSEEEE
T ss_pred CccccccccCCCccccHHHHHHHHHHHHh------------------CCceEEEEecCCCeeE
Confidence 999986 5778999999998777654 5789999999999887
|
| >d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} | Back information, alignment and structure |
|---|
| >d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} | Back information, alignment and structure |
|---|
| >d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} | Back information, alignment and structure |
|---|
| >d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z5ra1 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d2gu2a1 c.56.5.7 (A:4-310) Aspartoacylase AspA {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yw6a1 c.56.5.7 (A:1-322) Succinylglutamate desuccinylase AstE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bcoa1 c.56.5.7 (A:4-342) Succinylglutamate desuccinylase AstE {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1yw4a1 c.56.5.7 (A:2-332) Succinylglutamate desuccinylase AstE {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d2g9da1 c.56.5.7 (A:3-342) Succinylglutamate desuccinylase AstE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|