Psyllid ID: psy17663


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MSHRKKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGNNRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIRRKTKKKPVQSSTGKMRFRKSGIVTTATMHSKQEPARISKERVAMQYFFITSSS
ccccccEEEEEEccccccccHHHHHHHHHHHHHcccHHHHHHHHccEEEEEEEcccccEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEccccccccccEEEEcccccccccccHHHHHHHHHHHHcccc
ccccccEEEEEEEEccccccHHHHHHHHHHHHHcccHHHHHHHHHHEEEEEcccccccEEEcccEcccccccHHHHcccccHccccHHHHHHHHHHHHHccccEEEEccccccccccEEEEEEccccccHHHHHHHHHHHHHHEEcccc
MSHRKKAIVITsrvhpgetpsswmmKGFMDFLTGDSAQAKELREKFIFKLipmlnpdgvivgnnrcsltgrdlNRQYRTVIretyppvwhtKLLIrrktkkkpvqsstgkmrfrksgivttatmhskqeparISKERVAMQYFFITSSS
mshrkkaivitsrvhpgetpsswMMKGFMDFLTGDSAQAKELREKFIFKLipmlnpdgvivgnnrcsltgrdlnrqyrtviretyppvwhtkllirrktkkkpvqsstgkmrfrksgivttatmhskqepariskerVAMQYFFITSSS
MSHRKKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGNNRCSLTGRDLNRQYRTVIRETYPPVWHtkllirrktkkkPVQSSTGKMRFRKSGIVTTATMHSKQEPARISKERVAMQYFFITSSS
**********************WMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGNNRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIR*****************************************VAMQYFFI****
***RKKA*VITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGNNRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIRRKTKKKPVQSSTGKMRFRKSGIVTTATMHSKQEPARISKERVAMQYFFIT***
MSHRKKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGNNRCSLTGRDLNRQYRTVIRETYPPVWHTKLLI**************KMRFRKSGIVTTA**********ISKERVAMQYFFITSSS
****KKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGNNRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIRRKTKKKPVQSSTGKMRFRKSGIVTTATMHSKQEPARISKERVAMQYFFITS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHRKKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGNNRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIRRKTKKKPVQSSTGKMRFRKSGIVTTATMHSKQEPARISKERVAMQYFFITSSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query149 2.2.26 [Sep-21-2011]
Q9VY99 1201 Cytosolic carboxypeptidas no N/A 0.630 0.078 0.765 7e-41
E1B9D8 1003 Cytosolic carboxypeptidas no N/A 0.691 0.102 0.592 7e-36
Q8CDP0 1006 Cytosolic carboxypeptidas yes N/A 0.677 0.100 0.594 2e-35
Q0P4M4 967 Cytosolic carboxypeptidas yes N/A 0.630 0.097 0.627 3e-35
Q8NEM8 1001 Cytosolic carboxypeptidas no N/A 0.691 0.102 0.563 1e-34
A6H8T7 721 Cytosolic carboxypeptidas yes N/A 0.899 0.185 0.462 1e-33
Q8CDK2 862 Cytosolic carboxypeptidas no N/A 0.671 0.116 0.58 2e-33
Q4R632 840 Cytosolic carboxypeptidas N/A N/A 0.671 0.119 0.56 6e-32
Q5U5Z8 902 Cytosolic carboxypeptidas no N/A 0.671 0.110 0.56 7e-32
Q6DD21 1225 Cytosolic carboxypeptidas N/A N/A 0.597 0.072 0.595 2e-28
>sp|Q9VY99|NNAD_DROME Cytosolic carboxypeptidase NnaD OS=Drosophila melanogaster GN=NnaD PE=2 SV=2 Back     alignment and function desciption
 Score =  165 bits (418), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 72/94 (76%), Positives = 84/94 (89%)

Query: 4    RKKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGN 63
            RKK+IV+++RVHP ETP+SWMMKG MDF+TGD+  AK LR KFIFKL+PMLNPDGVIVGN
Sbjct: 927  RKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGN 986

Query: 64   NRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIRR 97
             R SLTG+DLNRQYRTVIRETYP +W+TK +IRR
Sbjct: 987  TRNSLTGKDLNRQYRTVIRETYPSIWYTKAMIRR 1020




Metallocarboxypeptidase.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 4EC: .EC: 1EC: 7EC: .EC: -
>sp|E1B9D8|CBPC3_BOVIN Cytosolic carboxypeptidase 3 OS=Bos taurus GN=AGBL3 PE=3 SV=1 Back     alignment and function description
>sp|Q8CDP0|CBPC3_MOUSE Cytosolic carboxypeptidase 3 OS=Mus musculus GN=Agbl3 PE=1 SV=1 Back     alignment and function description
>sp|Q0P4M4|CBPC2_XENTR Cytosolic carboxypeptidase 2 OS=Xenopus tropicalis GN=agbl2 PE=2 SV=1 Back     alignment and function description
>sp|Q8NEM8|CBPC3_HUMAN Cytosolic carboxypeptidase 3 OS=Homo sapiens GN=AGBL3 PE=2 SV=2 Back     alignment and function description
>sp|A6H8T7|CBPC2_DANRE Cytosolic carboxypeptidase 2 OS=Danio rerio GN=zte25 PE=2 SV=1 Back     alignment and function description
>sp|Q8CDK2|CBPC2_MOUSE Cytosolic carboxypeptidase 2 OS=Mus musculus GN=Agbl2 PE=2 SV=1 Back     alignment and function description
>sp|Q4R632|CBPC2_MACFA Cytosolic carboxypeptidase 2 OS=Macaca fascicularis GN=AGBL2 PE=2 SV=1 Back     alignment and function description
>sp|Q5U5Z8|CBPC2_HUMAN Cytosolic carboxypeptidase 2 OS=Homo sapiens GN=AGBL2 PE=2 SV=2 Back     alignment and function description
>sp|Q6DD21|CBPC1_XENLA Cytosolic carboxypeptidase 1 OS=Xenopus laevis GN=agtpbp1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
242014619 863 conserved hypothetical protein [Pediculu 0.630 0.108 0.893 4e-47
357622827 1022 hypothetical protein KGM_19915 [Danaus p 0.630 0.091 0.872 2e-46
307207432 1139 Cytosolic carboxypeptidase 3 [Harpegnath 0.644 0.084 0.770 5e-43
383859802 1047 PREDICTED: cytosolic carboxypeptidase 2- 0.630 0.089 0.808 3e-42
380014498 1079 PREDICTED: LOW QUALITY PROTEIN: cytosoli 0.637 0.088 0.789 4e-42
350416584 1094 PREDICTED: cytosolic carboxypeptidase 2- 0.630 0.085 0.808 4e-42
340722431 1092 PREDICTED: cytosolic carboxypeptidase 2- 0.630 0.086 0.808 4e-42
340722429 1110 PREDICTED: cytosolic carboxypeptidase 2- 0.630 0.084 0.808 4e-42
307166046 1089 Cytosolic carboxypeptidase 2 [Camponotus 0.630 0.086 0.776 1e-41
322783678 1051 hypothetical protein SINV_12466 [Solenop 0.630 0.089 0.787 6e-41
>gi|242014619|ref|XP_002427984.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212512483|gb|EEB15246.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 92/94 (97%)

Query: 4   RKKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGN 63
           +KKA+V+T+RVHPGETPSSWMMKGF+DFLT DS QAKELREKFIFKL+PMLNPDGVIVGN
Sbjct: 304 KKKAVVVTARVHPGETPSSWMMKGFIDFLTSDSEQAKELREKFIFKLVPMLNPDGVIVGN 363

Query: 64  NRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIRR 97
           NRCSLTGRDLNRQYRTVIRETYPPVWHTKL+I+R
Sbjct: 364 NRCSLTGRDLNRQYRTVIRETYPPVWHTKLMIKR 397




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357622827|gb|EHJ74206.1| hypothetical protein KGM_19915 [Danaus plexippus] Back     alignment and taxonomy information
>gi|307207432|gb|EFN85147.1| Cytosolic carboxypeptidase 3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383859802|ref|XP_003705381.1| PREDICTED: cytosolic carboxypeptidase 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380014498|ref|XP_003691267.1| PREDICTED: LOW QUALITY PROTEIN: cytosolic carboxypeptidase 2-like [Apis florea] Back     alignment and taxonomy information
>gi|350416584|ref|XP_003491003.1| PREDICTED: cytosolic carboxypeptidase 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340722431|ref|XP_003399609.1| PREDICTED: cytosolic carboxypeptidase 2-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340722429|ref|XP_003399608.1| PREDICTED: cytosolic carboxypeptidase 2-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307166046|gb|EFN60323.1| Cytosolic carboxypeptidase 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|322783678|gb|EFZ11016.1| hypothetical protein SINV_12466 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
FB|FBgn0052627 1201 NnaD "Drosophila Nna1 ortholog 0.583 0.072 0.770 2.2e-33
UNIPROTKB|Q0P4M4 967 agbl2 "Cytosolic carboxypeptid 0.583 0.089 0.655 3.6e-30
UNIPROTKB|F1SNI4 708 AGBL3 "Uncharacterized protein 0.597 0.125 0.629 8.4e-30
RGD|1561995 871 Agbl3 "ATP/GTP binding protein 0.583 0.099 0.643 1.1e-29
UNIPROTKB|F6XBC1 910 AGBL3 "Uncharacterized protein 0.597 0.097 0.629 1.5e-29
UNIPROTKB|E2QYU4 1016 AGBL3 "Uncharacterized protein 0.597 0.087 0.629 1.9e-29
UNIPROTKB|G3N121 919 AGBL3 "Cytosolic carboxypeptid 0.597 0.096 0.617 2.5e-29
UNIPROTKB|F1NDJ1488 AGBL3 "Uncharacterized protein 0.583 0.178 0.586 2.9e-29
UNIPROTKB|E1B9D8 1003 AGBL3 "Cytosolic carboxypeptid 0.597 0.088 0.617 3e-29
UNIPROTKB|G5E5V2 1008 AGBL3 "Cytosolic carboxypeptid 0.597 0.088 0.617 3e-29
FB|FBgn0052627 NnaD "Drosophila Nna1 ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 376 (137.4 bits), Expect = 2.2e-33, P = 2.2e-33
 Identities = 67/87 (77%), Positives = 78/87 (89%)

Query:     4 RKKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGN 63
             RKK+IV+++RVHP ETP+SWMMKG MDF+TGD+  AK LR KFIFKL+PMLNPDGVIVGN
Sbjct:   927 RKKSIVVSARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGN 986

Query:    64 NRCSLTGRDLNRQYRTVIRETYPPVWH 90
              R SLTG+DLNRQYRTVIRETYP +W+
Sbjct:   987 TRNSLTGKDLNRQYRTVIRETYPSIWY 1013




GO:0017076 "purine nucleotide binding" evidence=ISS
GO:0004181 "metallocarboxypeptidase activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0002164 "larval development" evidence=IMP
GO:0007005 "mitochondrion organization" evidence=IMP
GO:0003407 "neural retina development" evidence=IMP
GO:0005739 "mitochondrion" evidence=IDA
UNIPROTKB|Q0P4M4 agbl2 "Cytosolic carboxypeptidase 2" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|F1SNI4 AGBL3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1561995 Agbl3 "ATP/GTP binding protein-like 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F6XBC1 AGBL3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QYU4 AGBL3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3N121 AGBL3 "Cytosolic carboxypeptidase 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NDJ1 AGBL3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1B9D8 AGBL3 "Cytosolic carboxypeptidase 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G5E5V2 AGBL3 "Cytosolic carboxypeptidase 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8CDP0CBPC3_MOUSE3, ., 4, ., 1, 7, ., -0.59400.67780.1003yesN/A
Q0P4M4CBPC2_XENTR3, ., 4, ., 1, 7, ., -0.62760.63080.0972yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.170.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
cd06907261 cd06907, M14_AGBL2-3_like, Peptidase M14-like doma 1e-61
cd06235258 cd06235, M14_Nna1_like_2, Peptidase M14-like domai 1e-56
cd06906278 cd06906, M14_Nna1, Peptidase M14-like domain of AT 3e-40
cd06908261 cd06908, M14_AGBL4_like, Peptidase M14-like domain 5e-36
cd06236308 cd06236, M14_AGBL5_like, Peptidase M14-like domain 3e-34
cd03856258 cd03856, M14_Nna1_like, Peptidase M14-like domain 6e-32
pfam00246277 pfam00246, Peptidase_M14, Zinc carboxypeptidase 3e-23
cd06234263 cd06234, M14_Nna1_like_1, Peptidase M14-like domai 5e-18
cd06237245 cd06237, M14_Nna1_like_3, Peptidase M14-like domai 7e-14
smart00631277 smart00631, Zn_pept, Zn_pept domain 1e-13
COG2866374 COG2866, COG2866, Predicted carboxypeptidase [Amin 3e-06
cd00596211 cd00596, Peptidase_M14_like, M14 family of metallo 3e-06
cd06239231 cd06239, M14-like_1_2, Peptidase M14-like domain; 7e-06
cd06248303 cd06248, M14_CP_A-B_like_1, Peptidase M14 carboxyp 1e-05
cd06231234 cd06231, M14-like_4, Peptidase M14-like domain; un 7e-05
cd03857226 cd03857, M14-like_1, Peptidase M14-like domain; un 2e-04
cd06904178 cd06904, M14_MpaA_like, Peptidase M14-like domain 9e-04
cd06227269 cd06227, M14-like_2, Peptidase M14-like domain; un 0.002
>gnl|CDD|133117 cd06907, M14_AGBL2-3_like, Peptidase M14-like domain of ATP/GTP binding protein AGBL-2 and AGBL-3, and related proteins Back     alignment and domain information
 Score =  189 bits (483), Expect = 1e-61
 Identities = 61/101 (60%), Positives = 85/101 (84%)

Query: 4   RKKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGN 63
            KKA+V+T+RVHPGET +SWMMKGF+DFLT +S  A+ LR+ FIFK++PMLNPDGVIVGN
Sbjct: 45  AKKAVVLTARVHPGETNASWMMKGFLDFLTSNSPDAQLLRDTFIFKIVPMLNPDGVIVGN 104

Query: 64  NRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIRRKTKKKPV 104
            RCSL GRDLNR Y+T +++++P +W+TK +++R  +++ V
Sbjct: 105 YRCSLAGRDLNRNYKTPLKDSFPTIWYTKNMVKRLLEEREV 145


Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-2, and related proteins. The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. This subgroup includes the human AGBL-2, and -3, and the mouse cytosolic carboxypeptidase (CCPs)-2, and -3. ATP/GTP binding protein (AGTPBP-1/Nna1)-like proteins are active metallopeptidases that are thought to act on cytosolic proteins such as alpha-tubulin, to remove a C-terminal tyrosine. Mutations in AGTPBP-1/Nna1 cause Purkinje cell degeneration (pcd). AGTPBP-1/Nna1 however does not belong to this subgroup. AGTPBP-1/Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal domain might act as a folding domain. Length = 261

>gnl|CDD|199859 cd06235, M14_Nna1_like_2, Peptidase M14-like domain of human Nna1/AGTPBP-1, AGBL2 -5, and related proteins Back     alignment and domain information
>gnl|CDD|133116 cd06906, M14_Nna1, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases Back     alignment and domain information
>gnl|CDD|133118 cd06908, M14_AGBL4_like, Peptidase M14-like domain of ATP/GTP binding protein AGBL-4 and related proteins Back     alignment and domain information
>gnl|CDD|199860 cd06236, M14_AGBL5_like, Peptidase M14-like domain of ATP/GTP binding protein (AGBL)-5 and related proteins Back     alignment and domain information
>gnl|CDD|199841 cd03856, M14_Nna1_like, Peptidase M14-like domain of ATP/GTP binding proteins, cytosolic carboxypeptidases and related proteins Back     alignment and domain information
>gnl|CDD|215816 pfam00246, Peptidase_M14, Zinc carboxypeptidase Back     alignment and domain information
>gnl|CDD|199858 cd06234, M14_Nna1_like_1, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases; uncharacterized bacterial subgroup Back     alignment and domain information
>gnl|CDD|199861 cd06237, M14_Nna1_like_3, Peptidase M14-like domain of ATP/GTP binding proteins and cytosolic carboxypeptidases; uncharacterized bacterial subgroup Back     alignment and domain information
>gnl|CDD|214748 smart00631, Zn_pept, Zn_pept domain Back     alignment and domain information
>gnl|CDD|225421 COG2866, COG2866, Predicted carboxypeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|199839 cd00596, Peptidase_M14_like, M14 family of metallocarboxypeptidases and related proteins Back     alignment and domain information
>gnl|CDD|199863 cd06239, M14-like_1_2, Peptidase M14-like domain; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|199869 cd06248, M14_CP_A-B_like_1, Peptidase M14 carboxypeptidase subfamily A/B-like; uncharacterized subgroup Back     alignment and domain information
>gnl|CDD|199857 cd06231, M14-like_4, Peptidase M14-like domain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|133069 cd03857, M14-like_1, Peptidase M14-like domain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|133114 cd06904, M14_MpaA_like, Peptidase M14-like domain of Escherichia coli Murein Peptide Amidase A and related proteins Back     alignment and domain information
>gnl|CDD|199854 cd06227, M14-like_2, Peptidase M14-like domain; uncharacterized subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 149
cd06908261 M14_AGBL4_like Peptidase M14-like domain of ATP/GT 100.0
cd06907261 M14_AGBL2-3_like Peptidase M14-like domain of ATP/ 100.0
cd06236 304 M14_AGBL5_like Peptidase M14-like domain of ATP/GT 100.0
cd03856269 M14_Nna1_like Peptidase M14-like domain of Nna-1 ( 100.0
cd06235258 M14_Nna1_like_2 Subgroup of the Peptidase M14-like 100.0
cd06906278 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervo 100.0
cd06234263 M14_Nna1_like_1 A bacterial subgroup of the Peptid 100.0
cd06237244 M14_Nna1_like_3 A bacterial subgroup of the Peptid 99.98
KOG2650|consensus418 99.97
cd03872300 M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also know 99.97
cd06227272 Peptidase_M14-like_2 A functionally uncharacterize 99.97
cd06247298 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO 99.96
cd06248304 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/ 99.96
cd03870301 M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA 99.96
cd06246300 M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (C 99.96
cd06229255 M14_Endopeptidase_I Peptidase M14-like domain of G 99.96
cd06226293 M14_CPT_like Peptidase M14-like domain of an uncha 99.96
cd03871300 M14_CPB Peptidase M14 Carboxypeptidase B (CPB) bel 99.96
cd06245 363 M14_CPD_III The third carboxypeptidase (CP)-like d 99.96
PF00246279 Peptidase_M14: Zinc carboxypeptidase This is famil 99.96
cd03868 372 M14_CPD_I The first carboxypeptidase (CP)-like dom 99.96
cd03859295 M14_CPT Peptidase M14-like domain of carboxypeptid 99.96
cd03858 374 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like sub 99.96
smart00631277 Zn_pept Zn_pept. 99.96
cd06228 332 Peptidase_M14-like_3 A functionally uncharacterize 99.96
cd03866 376 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM 99.95
cd03863 375 M14_CPD_II The second carboxypeptidase (CP)-like d 99.95
KOG3641|consensus650 99.95
cd06239231 Peptidase_M14-like_1_2 Peptidase M14-like domain o 99.95
cd03860294 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase 99.95
cd06242268 Peptidase_M14-like_1_5 Peptidase M14-like domain o 99.95
cd06238271 Peptidase_M14-like_1_1 Peptidase M14-like domain o 99.95
cd03864 392 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, als 99.95
cd03867 395 M14_CPZ Peptidase M14-like domain of carboxypeptid 99.95
cd06905360 Peptidase_M14-like_8 A functionally uncharacterize 99.95
cd03862273 Peptidase_M14-like_7 A functionally uncharacterize 99.95
cd06243236 Peptidase_M14-like_1_6 Peptidase M14-like domain o 99.95
cd03857226 Peptidase_M14-like_1 Peptidase M14-like domain of 99.94
cd06244268 Peptidase_M14-like_1_7 Peptidase M14-like domain o 99.94
cd06241266 Peptidase_M14-like_1_4 Peptidase M14-like domain o 99.94
cd03869 405 M14_CPX_like Peptidase M14-like domain of carboxyp 99.94
cd00596196 Peptidase_M14_like The M14 family of metallocarbox 99.94
cd03865 402 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (C 99.93
cd06904178 M14_MpaA_like Peptidase M14-like domain of Escheri 99.92
cd06231236 Peptidase_M14-like_4 A functionally uncharacterize 99.9
cd06240273 Peptidase_M14-like_1_3 Peptidase M14-like domain o 99.9
PRK10602237 murein peptide amidase A; Provisional 99.89
cd06232240 Peptidase_M14-like_5 Peptidase M14-like domain of 99.85
KOG2649|consensus 500 99.73
cd06230 252 M14_ASTE_ASPA_like The Peptidase M14 Succinylgluta 99.64
cd06251 287 M14_ASTE_ASPA_like_1 A functionally uncharacterize 99.62
cd06255 293 M14_ASTE_ASPA_like_5 A functionally uncharacterize 99.6
cd06250 359 M14_PaAOTO_like An uncharacterized subgroup of the 99.58
cd06233283 Peptidase_M14-like_6 Peptidase M14-like domain of 99.57
cd06254 288 M14_ASTE_ASPA_like_4 A functionally uncharacterize 99.54
cd06253 298 M14_ASTE_ASPA_like_3 A functionally uncharacterize 99.53
cd06252 316 M14_ASTE_ASPA_like_2 A functionally uncharacterize 99.52
PF04952 292 AstE_AspA: Succinylglutamate desuccinylase / Aspar 99.49
COG2866374 Predicted carboxypeptidase [Amino acid transport a 99.47
TIGR02994 325 ectoine_eutE ectoine utilization protein EutE. Mem 99.45
cd06256 327 M14_ASTE_ASPA_like_6 A functionally uncharacterize 99.41
PRK02259 288 aspartoacylase; Provisional 99.35
cd06909 282 M14_ASPA Aspartoacylase (ASPA) belongs to the Succ 99.32
COG3608 331 Predicted deacylase [General function prediction o 99.27
cd06910 272 M14_ASTE_ASPA_like_7 A functionally uncharacterize 99.26
PRK05324 329 succinylglutamate desuccinylase; Provisional 99.24
cd03855 322 M14_ASTE Peptidase M14 Succinylglutamate desucciny 99.17
TIGR03242 319 arg_catab_astE succinylglutamate desuccinylase. Me 99.16
PF10994 341 DUF2817: Protein of unknown function (DUF2817); In 98.95
COG2988 324 Succinylglutamate desuccinylase [Amino acid transp 97.84
PF09892193 DUF2119: Uncharacterized protein conserved in arch 97.5
KOG3641|consensus 650 96.56
COG4073198 Uncharacterized protein conserved in archaea [Func 96.25
>cd06908 M14_AGBL4_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-4, and related proteins Back     alignment and domain information
Probab=100.00  E-value=4e-38  Score=258.43  Aligned_cols=117  Identities=41%  Similarity=0.717  Sum_probs=110.0

Q ss_pred             CCCcEEEEEcCcCCCCchHHHHHHHHHHHHhcCCHHHHHhhhCcEEEEEeeeCCCccccccccCCCCCCCCCCCCCCCCC
Q psy17663          3 HRKKAIVITSRVHPGETPSSWMMKGFMDFLTGDSAQAKELREKFIFKLIPMLNPDGVIVGNNRCSLTGRDLNRQYRTVIR   82 (149)
Q Consensus         3 ~~k~~V~i~~~iHg~E~~~~~~~~~~i~~L~~~~~~~~~ll~~~~~~ivP~~NPDG~~~g~~R~n~~GvDLNRnw~~~~~   82 (149)
                      ++||.|||.|||||+||+|++++++++++|+++++.++.|+++++|+||||+||||+++|++|+||.|+||||||.+|++
T Consensus        41 ~~k~~I~i~ariHp~E~~~s~~~~~li~~L~~~~~~~~~L~~~~~~~IvP~~NPDGv~~gn~R~~~~G~DLNR~w~~p~~  120 (261)
T cd06908          41 SEKKVIFITARVHPGESPSSYVCQGLIDFLVSNHPIAKVLREHLVFKIVPMLNPDGVFLGNYRCSLMGHDLNRHWHDPSP  120 (261)
T ss_pred             CCCcEEEEECCcCCCChHHHHHHHHHHHHHhhCCHHHHHHHHhCcEEEEeeecCcceeecCCcCcCcCcCCCCCCCCCCc
Confidence            46899999999999999999999999999998899999999999999999999999999999999999999999999999


Q ss_pred             CCCccHHHHHHHHHHHHhcCCCcccccccccccceeEEEEeecCCCccC
Q psy17663         83 ETYPPVWHTKLLIRRKTKKKPVQSSTGKMRFRKSGIVTTATMHSKQEPA  131 (149)
Q Consensus        83 ~~~PE~~a~~~li~~l~~~~p~~~~~~~~~~~~~~~~~~iDlHs~s~~~  131 (149)
                      +++||+++++++++++.++.            +.++++|||+|+|+++.
T Consensus       121 ~~~PEv~av~~~i~~~~~~~------------~~~i~~~lD~H~hs~~~  157 (261)
T cd06908         121 WAHPTLHAVKNLLKELDNDS------------TTQLDFYIDLHAHSSLM  157 (261)
T ss_pred             ccChHHHHHHHHHHHhhhcc------------ccCeeEEEEeecccccc
Confidence            99999999999999876531            26899999999999987



The Peptidase M14 family of metallocarboxypeptidases are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. This eukaryotic subgroup includes the human AGBL4 and the mouse cytosolic carboxypeptidase (CCP)-6. ATP/GTP binding protein (AGTPBP-1/Nna1)-like proteins are active metallopeptidases that are thought to act on cytosolic proteins such as alpha-tubulin, to remove a C-terminal tyrosine. Mutations in AGTPBP-1/Nna1 cause Purkinje cell degeneration (pcd). AGTPBP-1/Nna1 however does not belong to this subgroup. AGTPBP-1/Nna1-like proteins from the different phyla are highly diverse, but they all contain a unique N-terminal conserved domain right before the CP domain. It has been suggested that this N-terminal

>cd06907 M14_AGBL2-3_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-2, and related proteins Back     alignment and domain information
>cd06236 M14_AGBL5_like Peptidase M14-like domain of ATP/GTP binding protein_like (AGBL)-5, and related proteins Back     alignment and domain information
>cd03856 M14_Nna1_like Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06235 M14_Nna1_like_2 Subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06906 M14_Nna1 Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP), and related proteins Back     alignment and domain information
>cd06234 M14_Nna1_like_1 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP)-like proteins Back     alignment and domain information
>cd06237 M14_Nna1_like_3 A bacterial subgroup of the Peptidase M14-like domain of Nna-1 (Nervous system Nuclear protein induced by Axotomy), also known as ATP/GTP binding protein (AGTPBP-1) and cytosolic carboxypeptidase (CCP),-like proteins Back     alignment and domain information
>KOG2650|consensus Back     alignment and domain information
>cd03872 M14_CPA6 Carboxypeptidase (CP) A6 (CPA6, also known as CPAH; EC 3 Back     alignment and domain information
>cd06227 Peptidase_M14-like_2 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06247 M14_CPO Peptidase M14 carboxypeptidase (CP) O (CPO, also known as metallocarboxypeptidase C; EC 3 Back     alignment and domain information
>cd06248 M14_CPA_CPB_like Peptidase M14 Carboxypeptidase A/B-like subfamily: This is one of two main M14 carboxypeptidase subfamilies, defined by sequence and structural homology, the other being N/E Back     alignment and domain information
>cd03870 M14_CPA Peptidase M14 Carboxypeptidase (CP) A (CPA) belongs to the A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06246 M14_CPB2 Peptidase M14 Carboxypeptidase (CP) B2 (CPB2, also known as plasma carboxypeptidase B, carboxypeptidase U, and CPU), belongs to the carboxpeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06229 M14_Endopeptidase_I Peptidase M14-like domain of Gamma-D-glutamyl-L-diamino acid endopeptidase 1 (also known as Gamma-D-glutamyl-meso-diaminopimelate peptidase I, and Endopeptidase I (ENP1); EC 3 Back     alignment and domain information
>cd06226 M14_CPT_like Peptidase M14-like domain of an uncharacterized group of Peptidase M14 Carboxypeptidase (CP) T (CPT)-like proteins Back     alignment and domain information
>cd03871 M14_CPB Peptidase M14 Carboxypeptidase B (CPB) belongs to the carboxypeptidase A/B subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06245 M14_CPD_III The third carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>PF00246 Peptidase_M14: Zinc carboxypeptidase This is family M14 in the peptidase classification Back     alignment and domain information
>cd03868 M14_CPD_I The first carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>cd03859 M14_CPT Peptidase M14-like domain of carboxypeptidase (CP) T (CPT), CPT belongs to the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03858 M14_CP_N-E_like Carboxypeptidase (CP) N/E-like subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>smart00631 Zn_pept Zn_pept Back     alignment and domain information
>cd06228 Peptidase_M14-like_3 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03866 M14_CPM Peptidase M14 Carboxypeptidase (CP) M (CPM) belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03863 M14_CPD_II The second carboxypeptidase (CP)-like domain of Carboxypeptidase D (CPD; EC 3 Back     alignment and domain information
>KOG3641|consensus Back     alignment and domain information
>cd06239 Peptidase_M14-like_1_2 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03860 M14_CP_A-B_like The Peptidase M14 Carboxypeptidase (CP) A/B subfamily is one of two main M14 CP subfamilies defined by sequence and structural homology, the other being the N/E subfamily Back     alignment and domain information
>cd06242 Peptidase_M14-like_1_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06238 Peptidase_M14-like_1_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03864 M14_CPN Peptidase M14 Carboxypeptidase N (CPN, also known as kininase I, creatine kinase conversion factor, plasma carboxypeptidase B, arginine carboxypeptidase, and protaminase; EC 3 Back     alignment and domain information
>cd03867 M14_CPZ Peptidase M14-like domain of carboxypeptidase (CP) Z (CPZ), CPZ belongs to the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06905 Peptidase_M14-like_8 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03862 Peptidase_M14-like_7 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06243 Peptidase_M14-like_1_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03857 Peptidase_M14-like_1 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06244 Peptidase_M14-like_1_7 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06241 Peptidase_M14-like_1_4 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd03869 M14_CPX_like Peptidase M14-like domain of carboxypeptidase (CP)-like protein X (CPX), CPX forms a distinct subgroup of the N/E subfamily of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd00596 Peptidase_M14_like The M14 family of metallocarboxypeptidases (MCPs) are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity Back     alignment and domain information
>cd03865 M14_CPE_H Peptidase M14 Carboxypeptidase (CP) E (CPE, also known as carboxypeptidase H, and enkephalin convertase; EC 3 Back     alignment and domain information
>cd06904 M14_MpaA_like Peptidase M14-like domain of Escherichia coli Murein Peptide Amidase A (MpaA) and related proteins Back     alignment and domain information
>cd06231 Peptidase_M14-like_4 A functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06240 Peptidase_M14-like_1_3 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>PRK10602 murein peptide amidase A; Provisional Back     alignment and domain information
>cd06232 Peptidase_M14-like_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>KOG2649|consensus Back     alignment and domain information
>cd06230 M14_ASTE_ASPA_like The Peptidase M14 Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily belongs to the M14 family of metallocarboxypeptidases (MCPs), and includes ASTE, which catalyzes the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway, and aspartoacylase (ASPA, also known as aminoacylase 2, and ACY-2; EC:3 Back     alignment and domain information
>cd06251 M14_ASTE_ASPA_like_1 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06233 Peptidase_M14-like_6 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs) Back     alignment and domain information
>cd06254 M14_ASTE_ASPA_like_4 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PF04952 AstE_AspA: Succinylglutamate desuccinylase / Aspartoacylase family; InterPro: IPR007036 This family describes both succinylglutamate desuccinylase that catalyses the fifth and last step in arginine catabolism by the arginine succinyltransferase pathway and also includes aspartoacylase 3 Back     alignment and domain information
>COG2866 Predicted carboxypeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02994 ectoine_eutE ectoine utilization protein EutE Back     alignment and domain information
>cd06256 M14_ASTE_ASPA_like_6 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK02259 aspartoacylase; Provisional Back     alignment and domain information
>cd06909 M14_ASPA Aspartoacylase (ASPA) belongs to the Succinylglutamate desuccinylase/aspartoacylase subfamily of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>COG3608 Predicted deacylase [General function prediction only] Back     alignment and domain information
>cd06910 M14_ASTE_ASPA_like_7 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK05324 succinylglutamate desuccinylase; Provisional Back     alignment and domain information
>cd03855 M14_ASTE Peptidase M14 Succinylglutamate desuccinylase (ASTE, also known as N-succinyl-L-glutamate amidohydrolase, N2-succinylglutamate desuccinylase, and SGDS; EC 3 Back     alignment and domain information
>TIGR03242 arg_catab_astE succinylglutamate desuccinylase Back     alignment and domain information
>PF10994 DUF2817: Protein of unknown function (DUF2817); InterPro: IPR021259 This family of proteins has no known function Back     alignment and domain information
>COG2988 Succinylglutamate desuccinylase [Amino acid transport and metabolism] Back     alignment and domain information
>PF09892 DUF2119: Uncharacterized protein conserved in archaea (DUF2119); InterPro: IPR019218 This entry represents a family of hypothetical archaeal proteins of unknown function Back     alignment and domain information
>KOG3641|consensus Back     alignment and domain information
>COG4073 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
3l2n_A395 Crystal Structure Of Putative Carboxypeptidase A (y 3e-13
4a37_A388 Metallo-Carboxypeptidase From Pseudomonas Aeruginos 1e-10
3k2k_A403 Crystal Structure Of Putative Carboxypeptidase (Yp_ 1e-09
>pdb|3L2N|A Chain A, Crystal Structure Of Putative Carboxypeptidase A (yp_562911.1) From Shewanella Denitrificans Os-217 At 2.39 A Resolution Length = 395 Back     alignment and structure

Iteration: 1

Score = 70.9 bits (172), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 34/87 (39%), Positives = 55/87 (63%), Gaps = 1/87 (1%) Query: 5 KKAIVITSRVHPGETPSSWMMKGFMD-FLTGDSAQAKELREKFIFKLIPMLNPDGVIVGN 63 KK+I IT+R HPGET + W+++G ++ L D +K L +K F ++P NPDG + G+ Sbjct: 175 KKSIWITARQHPGETXAEWLVEGLLNQLLDNDCPTSKALLDKANFYIVPNXNPDGSVRGH 234 Query: 64 NRCSLTGRDLNRQYRTVIRETYPPVWH 90 R + G +LNR+++T E P V++ Sbjct: 235 LRTNAVGANLNREWQTPSLERSPEVYY 261
>pdb|4A37|A Chain A, Metallo-Carboxypeptidase From Pseudomonas Aeruginosa Length = 388 Back     alignment and structure
>pdb|3K2K|A Chain A, Crystal Structure Of Putative Carboxypeptidase (Yp_103406.1) From Burkholderia Mallei Atcc 23344 At 2.49 A Resolution Length = 403 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
4a37_A388 Metallo-carboxypeptidase; metallo-protease, hydrol 5e-31
3k2k_A403 Putative carboxypeptidase; structural genomics, jo 1e-29
3l2n_A395 Peptidase M14, carboxypeptidase A; putative carbox 2e-29
2qvp_A275 Uncharacterized protein; putative metallopeptidase 4e-17
3b2y_A275 Metallopeptidase containing CO-catalytic metalloa 1e-12
1aye_A401 PCPA2, procarboxypeptidase A2; serine protease, zy 7e-05
1jqg_A 433 Carboxypeptidase A; Pro-protein, hydrolase; 2.50A 2e-04
2bo9_A308 Carboxypeptidase A4; metallocarboxypeptidase, X-RA 3e-04
3prt_A 323 Carboxypeptidase T; hydrolase; 1.66A {Thermoactino 3e-04
1dtd_A303 Carboxypeptidase A2; carboxypeptidase A2, leech ca 3e-04
1m4l_A307 Carboxypeptidase A; metalloproteinase, metalloexop 7e-04
>4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* Length = 388 Back     alignment and structure
 Score =  113 bits (284), Expect = 5e-31
 Identities = 31/98 (31%), Positives = 49/98 (50%), Gaps = 1/98 (1%)

Query: 1   MSHRKKAIVITSRVHPGETPSSWMMKGFMDFLT-GDSAQAKELREKFIFKLIPMLNPDGV 59
                  + + ++ HPGE  + W M+G ++ L   D  + + L EK    L+P +NPDG 
Sbjct: 166 HPDSHLKLWVIAQQHPGEHMAEWFMEGLIERLQRPDDTEMQRLLEKADLYLVPNMNPDGA 225

Query: 60  IVGNNRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIRR 97
             GN R +  G+DLNR +     E  P VW  +  ++R
Sbjct: 226 FHGNLRTNAAGQDLNRAWLEPSAERSPEVWFVQQEMKR 263


>3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Length = 403 Back     alignment and structure
>3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} Length = 395 Back     alignment and structure
>2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} Length = 275 Back     alignment and structure
>3b2y_A Metallopeptidase containing CO-catalytic metalloa site; metallopeptidase containing CO-catalytic metalloactive site; 1.74A {Shewanella denitrificans OS217} PDB: 3ieh_A* Length = 275 Back     alignment and structure
>1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A Length = 401 Back     alignment and structure
>1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 Length = 433 Back     alignment and structure
>2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* Length = 308 Back     alignment and structure
>3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A Length = 323 Back     alignment and structure
>1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 Length = 303 Back     alignment and structure
>1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... Length = 307 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
3l2n_A395 Peptidase M14, carboxypeptidase A; putative carbox 99.97
3k2k_A403 Putative carboxypeptidase; structural genomics, jo 99.97
3v38_A326 Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Th 99.97
4a37_A388 Metallo-carboxypeptidase; metallo-protease, hydrol 99.96
3prt_A323 Carboxypeptidase T; hydrolase; 1.66A {Thermoactino 99.96
3mn8_A 435 LP15968P; catalytic domain of alpha/beta-hydrolase 99.96
1m4l_A307 Carboxypeptidase A; metalloproteinase, metalloexop 99.95
3dgv_A401 TAFI, carboxypeptidase B2; blood coagulation, fibr 99.95
3d4u_A309 Tafia, carboxypeptidase B2; protease-inhibitor com 99.95
1z5r_A306 Procarboxypeptidase B; exopeptidase, hydrolase; 1. 99.95
1dtd_A303 Carboxypeptidase A2; carboxypeptidase A2, leech ca 99.95
1kwm_A402 Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A 99.95
2bo9_A308 Carboxypeptidase A4; metallocarboxypeptidase, X-RA 99.95
2nsm_A 439 Carboxypeptidase N catalytic chain; caroxypeptidas 99.95
1aye_A401 PCPA2, procarboxypeptidase A2; serine protease, zy 99.95
1uwy_A 426 Carboxypeptidase M; metallopeptidase, GPI-anchor, 99.95
1h8l_A 380 Carboxypeptidase GP180 residues 503-882; hydrolase 99.95
2boa_A404 Carboxypeptidase A4; metalloprocarboxypeptidase, X 99.95
2c1c_A312 Carboxypeptidase B; insect, metalloprotease, insen 99.95
1pca_A403 Procarboxypeptidase A PCPA; hydrolase(C-terminal p 99.94
1jqg_A 433 Carboxypeptidase A; Pro-protein, hydrolase; 2.50A 99.93
2qvp_A275 Uncharacterized protein; putative metallopeptidase 99.93
3b2y_A275 Metallopeptidase containing CO-catalytic metalloa 99.92
4axv_A243 MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} 99.89
2qj8_A 332 MLR6093 protein; structural genomics, joint center 99.79
3cdx_A 354 Succinylglutamatedesuccinylase/aspartoacylase; str 99.77
3fmc_A 368 Putative succinylglutamate desuccinylase / aspart; 99.72
3na6_A 331 Succinylglutamate desuccinylase/aspartoacylase; st 99.67
1yw6_A 335 Succinylglutamate desuccinylase; alpha-beta protei 99.55
2gu2_A 312 ASPA protein; aspartoacylase family, aminoacylase- 99.51
1yw4_A 341 Succinylglutamate desuccinylase; alpha-beta protei 99.48
2bco_A 350 Succinylglutamate desuccinylase; NESG, VPR14, stru 99.48
3nh4_A 327 Aspartoacylase-2; mercapturates, hydrolase; 2.00A 99.38
>3l2n_A Peptidase M14, carboxypeptidase A; putative carboxypeptidase A, structural genomics, joint CENT structural genomics, JCSG; 2.39A {Shewanella denitrificans} Back     alignment and structure
Probab=99.97  E-value=1.2e-31  Score=229.53  Aligned_cols=111  Identities=32%  Similarity=0.556  Sum_probs=103.2

Q ss_pred             CCCcEEEEEcCcCCCCchHHHHHHHHHHHHhc-CCHHHHHhhhCcEEEEEeeeCCCccccccccCCCCCCCCCCCCCCCC
Q psy17663          3 HRKKAIVITSRVHPGETPSSWMMKGFMDFLTG-DSAQAKELREKFIFKLIPMLNPDGVIVGNNRCSLTGRDLNRQYRTVI   81 (149)
Q Consensus         3 ~~k~~V~i~~~iHg~E~~~~~~~~~~i~~L~~-~~~~~~~ll~~~~~~ivP~~NPDG~~~g~~R~n~~GvDLNRnw~~~~   81 (149)
                      ++||.|||.|+|||+|++|++++++++++|++ .++.++.||++++|+||||+||||++++++|+||.|+||||||.+++
T Consensus       173 ~~kp~V~i~agiHg~E~~g~~~~~~ll~~L~~~~d~~~~~ll~~~~~~ivP~~NPDG~~~~~~R~n~~GvDLNRnf~g~~  252 (395)
T 3l2n_A          173 PSKKSIWITARQHPGETMAEWLVEGLLNQLLDNDCPTSKALLDKANFYIVPNMNPDGSVRGHLRTNAVGANLNREWQTPS  252 (395)
T ss_dssp             TTSEEEEEEECSSTTCTHHHHHHHHHHHHHTCTTSHHHHHHHHHEEEEEESCSCHHHHHTTCSSCCTTSCCGGGCSSSCC
T ss_pred             CCCcEEEEEcccCCCCchHHHHHHHHHHHHhhcCCHHHHHHhhCcEEEEEeccCCchhhhcccccccCCCCcccccCCCC
Confidence            36999999999999999999999999999997 68899999999999999999999999999999999999999999999


Q ss_pred             CCCCccHHHHHHHHHHHHhcCCCcccccccccccceeEEEEeecCCCccC
Q psy17663         82 RETYPPVWHTKLLIRRKTKKKPVQSSTGKMRFRKSGIVTTATMHSKQEPA  131 (149)
Q Consensus        82 ~~~~PE~~a~~~li~~l~~~~p~~~~~~~~~~~~~~~~~~iDlHs~s~~~  131 (149)
                      +.++||++++++++.+                  .++++|||+|++++..
T Consensus       253 ~~sepEt~a~~~~l~~------------------~~~~~~iDlHs~~~~p  284 (395)
T 3l2n_A          253 LERSPEVYYVVNKMHE------------------TGVDLFYDVHGDEGLP  284 (395)
T ss_dssp             TTTCHHHHHHHHHHHH------------------HCCSEEEEEEEESSCS
T ss_pred             cCCCHHHHHHHHHHHh------------------CCCcEEEEeccCCCCC
Confidence            9999999998877664                  3579999999999854



>3k2k_A Putative carboxypeptidase; structural genomics, joint center structural genomics, JCSG, protein structure initiative; 2.49A {Burkholderia mallei atcc 23344} Back     alignment and structure
>3v38_A Carboxypeptidase T; hydrolase; HET: GOL; 1.50A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A 3prt_A Back     alignment and structure
>4a37_A Metallo-carboxypeptidase; metallo-protease, hydrolase; 1.60A {Pseudomonas aeruginosa} PDB: 4a38_A 4a39_A* Back     alignment and structure
>3prt_A Carboxypeptidase T; hydrolase; 1.66A {Thermoactinomyces vulgaris} PDB: 1obr_A 3qnv_A Back     alignment and structure
>3mn8_A LP15968P; catalytic domain of alpha/beta-hydrolase fold, C-terminal, A transthyretin-like domain, hydrolase; HET: NAG GEM; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1m4l_A Carboxypeptidase A; metalloproteinase, metalloexoproteinase, hydrolase; 1.25A {Bos taurus} SCOP: c.56.5.1 PDB: 1cpx_A 1arl_A 1f57_A 2rfh_A* 3i1u_A* 1arm_A 1ell_P 1elm_P 1ee3_P 1zlh_A 2abz_A 3hlp_A 3huv_A 1yme_A* 3fvl_A* 3fx6_A* 2ctc_A* 1hdq_A 2ctb_A* 3kgq_A* ... Back     alignment and structure
>3dgv_A TAFI, carboxypeptidase B2; blood coagulation, fibrinolysis, protein S glycoprotein, hydrolase, metal-binding, metalloprotease, PR secreted, zymogen; HET: NAG NDG FUL BMA; 2.50A {Bos taurus} PDB: 3osl_A 3d68_A* 3d66_A* 3d67_A* Back     alignment and structure
>3d4u_A Tafia, carboxypeptidase B2; protease-inhibitor complex, glycoprotein, hydrolase, metal-binding, metalloprotease, protease, secret zymogen; 1.70A {Bos taurus} PDB: 3lms_A Back     alignment and structure
>1z5r_A Procarboxypeptidase B; exopeptidase, hydrolase; 1.40A {Sus scrofa} SCOP: c.56.5.1 PDB: 1zg7_A* 1zg8_A* 1zg9_A* 2jew_A* 2piy_A* 2piz_A* 2pj0_A* 2pj1_A* 2pj2_A* 2pj3_A* 2pj4_A* 2pj5_A* 2pj6_A* 2pj7_A* 2pj8_A* 2pj9_A* 2pja_A* 2pjb_A* 2pjc_A* 1zli_A ... Back     alignment and structure
>1dtd_A Carboxypeptidase A2; carboxypeptidase A2, leech carboxypeptidase inhibitor, hydrolase/hydrolase inhibitor complex; HET: GLU; 1.65A {Homo sapiens} SCOP: c.56.5.1 Back     alignment and structure
>1kwm_A Procarboxypeptidase B; hydrolase; HET: CIT; 1.60A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 3glj_A 1nsa_A 1pba_A Back     alignment and structure
>2bo9_A Carboxypeptidase A4; metallocarboxypeptidase, X-RAY endogenous protein inhibitor, metalloprotease carboxypeptidase, hydrolase; HET: NAG; 1.6A {Homo sapiens} SCOP: c.56.5.1 PDB: 4a94_A 2pcu_A* Back     alignment and structure
>2nsm_A Carboxypeptidase N catalytic chain; caroxypeptidase, zinc peptidase, transthyretin-like domain, processing, peptide modification, hydrolase; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1aye_A PCPA2, procarboxypeptidase A2; serine protease, zymogen, hydrolase; 1.80A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 PDB: 1o6x_A Back     alignment and structure
>1uwy_A Carboxypeptidase M; metallopeptidase, GPI-anchor, metalloprotease, zinc, lipoprotein, hydrolase, structural proteomics in europe, spine; HET: NAG; 3.0A {Homo sapiens} SCOP: b.3.2.1 c.56.5.1 Back     alignment and structure
>1h8l_A Carboxypeptidase GP180 residues 503-882; hydrolase, zinc-dependent protease; HET: NAG BMA NDG GEM; 2.6A {Lophonetta specularioides} SCOP: b.3.2.1 c.56.5.1 PDB: 1qmu_A* Back     alignment and structure
>2boa_A Carboxypeptidase A4; metalloprocarboxypeptidase, X-RAY zymogen, metalloprotease, exopropeptidase, hydrolase; HET: NAG; 2.20A {Homo sapiens} SCOP: c.56.5.1 d.58.3.1 Back     alignment and structure
>2c1c_A Carboxypeptidase B; insect, metalloprotease, insensitive, plant inhibitors, hydrolase; 2.3A {Helicoverpa zea} SCOP: c.56.5.1 Back     alignment and structure
>1pca_A Procarboxypeptidase A PCPA; hydrolase(C-terminal peptidase); HET: CIT; 2.00A {Sus scrofa} SCOP: d.58.3.1 PDB: 1pyt_A Back     alignment and structure
>1jqg_A Carboxypeptidase A; Pro-protein, hydrolase; 2.50A {Helicoverpa armigera} SCOP: c.56.5.1 d.58.3.1 Back     alignment and structure
>2qvp_A Uncharacterized protein; putative metallopeptidase, structural genomics, joint center structural genomics, JCSG; HET: MSE; 2.00A {Shewanella amazonensis} Back     alignment and structure
>3b2y_A Metallopeptidase containing CO-catalytic metalloa site; metallopeptidase containing CO-catalytic metalloactive site; 1.74A {Shewanella denitrificans OS217} PDB: 3ieh_A* Back     alignment and structure
>4axv_A MPAA; hydrolase; HET: MSE; 2.17A {Vibrio harveyi} Back     alignment and structure
>2qj8_A MLR6093 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.00A {Mesorhizobium loti} Back     alignment and structure
>3cdx_A Succinylglutamatedesuccinylase/aspartoacylase; structural genomics, PSI-2, protein structure initiative; 2.10A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3fmc_A Putative succinylglutamate desuccinylase / aspart; S genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Shewanella amazonensis} PDB: 3lwu_A* Back     alignment and structure
>3na6_A Succinylglutamate desuccinylase/aspartoacylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.00A {Ruegeria SP} Back     alignment and structure
>1yw6_A Succinylglutamate desuccinylase; alpha-beta protein., structural genomics, PSI, protein structure initiative; 3.10A {Escherichia coli} SCOP: c.56.5.7 Back     alignment and structure
>2gu2_A ASPA protein; aspartoacylase family, aminoacylase-2, ACY-2, ACY2_RAT, STRU genomics, PSI, protein structure initiative; HET: MSE; 1.80A {Rattus norvegicus} SCOP: c.56.5.7 PDB: 2q4z_A 2i3c_A 2q51_A 2o4h_A* 2o53_A Back     alignment and structure
>1yw4_A Succinylglutamate desuccinylase; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.00A {Chromobacterium violaceum} SCOP: c.56.5.7 Back     alignment and structure
>2bco_A Succinylglutamate desuccinylase; NESG, VPR14, structural genomics, PSI, protein structure initiative; 2.33A {Vibrio parahaemolyticus} SCOP: c.56.5.7 PDB: 2g9d_A Back     alignment and structure
>3nh4_A Aspartoacylase-2; mercapturates, hydrolase; 2.00A {Mus musculus} SCOP: c.56.5.0 PDB: 3nh5_A 3nfz_A 3nh8_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 149
d1uwya2296 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic d 2e-09
d1h8la2301 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic d 2e-09
d1jqga1 317 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton boll 2e-05
d2c1ca1312 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earwor 4e-05
d1obra_ 323 c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyce 2e-04
d1ayea1307 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo 2e-04
d2bo9a1 305 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo 7e-04
>d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 296 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Zn-dependent exopeptidases
family: Pancreatic carboxypeptidases
domain: Carboxypeptidase M, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 52.1 bits (124), Expect = 2e-09
 Identities = 19/114 (16%), Positives = 35/114 (30%), Gaps = 11/114 (9%)

Query: 5   KKAIVITSRVHPGETPSSWMMKGFMDFLT---GDSAQAKELREKFIFKLIPMLNPDGV-- 59
                  + +H  ET    ++   +D+L    G   +   L       ++P +NPDG   
Sbjct: 56  IPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEA 115

Query: 60  ------IVGNNRCSLTGRDLNRQYRTVIRETYPPVWHTKLLIRRKTKKKPVQSS 107
                      R +    DLNR +               + + +  K +    S
Sbjct: 116 VKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVSRQPETVAVMKWLKTETFVLS 169


>d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Length = 301 Back     information, alignment and structure
>d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} Length = 317 Back     information, alignment and structure
>d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} Length = 312 Back     information, alignment and structure
>d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} Length = 323 Back     information, alignment and structure
>d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 307 Back     information, alignment and structure
>d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
d1uwya2296 Carboxypeptidase M, catalytic domain {Human (Homo 99.96
d1h8la2301 Carboxypeptidase D, catalytic domain {Crested duck 99.95
d1m4la_307 Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913] 99.95
d1jqga1317 Carboxypeptidase A {Cotton bollworm (Helicoverpa a 99.95
d2c1ca1312 Carboxypeptidase B {Corn earworm (Helicoverpa zea) 99.95
d1ayea1307 Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 99.95
d2bo9a1305 Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9 99.94
d1z5ra1304 Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823] 99.94
d1obra_323 Carboxypeptidase T {Thermoactinomyces vulgaris [Ta 99.94
d2gu2a1 307 Aspartoacylase AspA {Rat (Rattus norvegicus) [TaxI 99.35
d1yw6a1 322 Succinylglutamate desuccinylase AstE {Escherichia 99.32
d2bcoa1 339 Succinylglutamate desuccinylase AstE {Vibrio parah 99.22
d1yw4a1 331 Succinylglutamate desuccinylase AstE {Chromobacter 99.21
d2g9da1 340 Succinylglutamate desuccinylase AstE {Vibrio chole 99.05
>d1uwya2 c.56.5.1 (A:1-296) Carboxypeptidase M, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Phosphorylase/hydrolase-like
superfamily: Zn-dependent exopeptidases
family: Pancreatic carboxypeptidases
domain: Carboxypeptidase M, catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=1.6e-29  Score=206.37  Aligned_cols=110  Identities=19%  Similarity=0.251  Sum_probs=98.6

Q ss_pred             CCcEEEEEcCcCCCCchHHHHHHHHHHHHhc---CCHHHHHhhhCcEEEEEeeeCCCccccc--------cccCCCCCCC
Q psy17663          4 RKKAIVITSRVHPGETPSSWMMKGFMDFLTG---DSAQAKELREKFIFKLIPMLNPDGVIVG--------NNRCSLTGRD   72 (149)
Q Consensus         4 ~k~~V~i~~~iHg~E~~~~~~~~~~i~~L~~---~~~~~~~ll~~~~~~ivP~~NPDG~~~g--------~~R~n~~GvD   72 (149)
                      +||.|+|+|++||+||+|+++++++++.|++   .++.++.+|++++|+||||+||||+++.        .+|.||.|||
T Consensus        55 ~kp~v~~~~giHa~E~~g~~~~~~~~~~L~~~~~~d~~~~~ll~~~~i~ivP~~NPDG~~~~~~~~~~~~~~r~n~~GvD  134 (296)
T d1uwya2          55 GIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYYSIGRENYNQYD  134 (296)
T ss_dssp             TBCEEEEEECCSTTCCHHHHHHHHHHHHHHHHTTTSHHHHHHHHHCEEEEESCSCHHHHHHCSSCCSSCCSCSSCTTSCC
T ss_pred             CCceEEEEeccCCCCccHHHHHHHHHHHHhhccccCHHHHHhhhcceEEEEeeecCchHhhcccccccccCccCCCcccc
Confidence            5899999999999999999999999999985   5789999999999999999999998753        3578999999


Q ss_pred             CCCCCC----CCCCCCCccHHHHHHHHHHHHhcCCCcccccccccccceeEEEEeecCCCccC
Q psy17663         73 LNRQYR----TVIRETYPPVWHTKLLIRRKTKKKPVQSSTGKMRFRKSGIVTTATMHSKQEPA  131 (149)
Q Consensus        73 LNRnw~----~~~~~~~PE~~a~~~li~~l~~~~p~~~~~~~~~~~~~~~~~~iDlHs~s~~~  131 (149)
                      |||||.    ++.++++||++|+++++++                  .++.+++|+||+++.+
T Consensus       135 lNRNf~~~~~g~~~~sepEt~av~~~~~~------------------~~~~~~i~~Hs~~~~i  179 (296)
T d1uwya2         135 LNRNFPDAFEYNNVSRQPETVAVMKWLKT------------------ETFVLSANLHGGALVA  179 (296)
T ss_dssp             TTSCSCCSSSCCCCCCCHHHHHHHHHHHH------------------SCEEECCEEECSEEEE
T ss_pred             CccccccccCCCccccHHHHHHHHHHHHh------------------CCceEEEEecCCCeeE
Confidence            999986    5778999999998777654                  5789999999999887



>d1h8la2 c.56.5.1 (A:4-304) Carboxypeptidase D, catalytic domain {Crested duck (Lophonetta specularioides) [TaxId: 8836]} Back     information, alignment and structure
>d1m4la_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]} Back     information, alignment and structure
>d2c1ca1 c.56.5.1 (A:7-309) Carboxypeptidase B {Corn earworm (Helicoverpa zea) [TaxId: 7113]} Back     information, alignment and structure
>d1ayea1 c.56.5.1 (A:1-309) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bo9a1 c.56.5.1 (A:4-307) Carboxypeptidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z5ra1 c.56.5.1 (A:6-308) Carboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1obra_ c.56.5.2 (A:) Carboxypeptidase T {Thermoactinomyces vulgaris [TaxId: 2026]} Back     information, alignment and structure
>d2gu2a1 c.56.5.7 (A:4-310) Aspartoacylase AspA {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yw6a1 c.56.5.7 (A:1-322) Succinylglutamate desuccinylase AstE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcoa1 c.56.5.7 (A:4-342) Succinylglutamate desuccinylase AstE {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1yw4a1 c.56.5.7 (A:2-332) Succinylglutamate desuccinylase AstE {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2g9da1 c.56.5.7 (A:3-342) Succinylglutamate desuccinylase AstE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure